2CLCX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gtp (2)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide-binding protein
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2clcX00
4RFSA 2DHRA 4BLOA 3PEUA 4LRWA 3HU3A 1BMFD 5KNDA 3K70C 4C0QC 4DC9A 5JFGA 4Z8YA 1VKJA 2OBLA 1E2EA 3LXRA 1N5LA 3M4YA 4M22A 3S1AA 4AYWA 3K9NA 3ZQJA 4Q4AA 4D4KA 2W6IA 2RGBA 4TL8A 2R8RA 1X6VA 2VYFA 2R6AA 1ETUA 3B9QA 4JVLA 4LJ4A 3IEVA 2XB4A 1XD9A 1JJVA 4OK6A 4TTPA 1TEXA 5DHAA 1DEKA 1XEWY 2FSIA 2QAJA 3VNUA 2QM8A 3ADKA 2VHQA 2C5LA 2ZPTX 4AURA 4C0BA 2JLYA 3ZIAD 4PSVA 1QHHA 3H1TA 1P2TA 2RHDA 5F3WB 1GP2A 4M1WA 5FTNA 5SZHB 3IIMA 3IUYA 1S96A 4B32A 1W0KA 1OFTA 1IY2A 4YDHB 2DFKB 2C9CA 1E99A 5HCNA 1XTQA 4QHYA 3U3JA 5FOTA 2GJSA 3LX5A 3QPUA 4WA7A 4B2PA 4FWTA 2IYTA 3QVUA 2D7CA 4YC7A 1SVMA 3CPHA 1U90A 4JKIA 5FR1A 4A2QA 2BBOA 2P2LA 1DADA 4NYJQ 3QF4A 3PITA 4W9MC 2FOLA 3AF4A 3D8BA 4Q4HA 4D6PA 1XZQA 2ZYUX 2CEAA 2WAXA 3VNVA 1ZIOA 5EP4A 2Z4RA 5F98A 2QGNA 3LV8A 4WIAA 3X1YA 1S3SA 5AWFC 5DIFA 1VDZA 3HPQA 3V00A 2ZJAA 1NMYA 1KYIA 1KHTA 2IBMA 1GWNA 1GDDA 3C8UA 2QA5A 3QOFA 4LBZA 2G88A 4MRNA 3ZDQA 4MDFA 4N1AA 4XVQA 3WMFA 3O8DA 1M2OB 4LGMA 3NTUA 4Q1CA 4DZZA 1NVXQ 1CEEA 1SVLA 3BBPA 4F91B 2CL7X 4AKGA 1LF0A 1US8A 1KSJA 1E79A 2Z4SA 3K0EA 2VHCA 1NKSA 4M4SA 4O25A 3M0EA 1F5NA 4KJZA 3LX8A 1CR0A 2IYLD 1XWIA 2RGAA 4B76A 3GJXC 3U44A 4D4MA 2NTYC 3ONWA 2O8CA 4Z51A 2G83A 2J7KA 3PEYA 1C9KA 1NBMD 4M8NE 1S1MA 1P5ZB 1N6HA 1YQTA 4KLNA 1OYWA 4PC6A 1OH5A 3DOFA 4AG6A 4RKEA 3T35A 5FTKA 3K0FB 2OXRA 3THXB 1U9IC 1ZD8A 2B7CA 1AZSC 4PC3A 2JLVA 5KTYA 4DUGA 2UZIR 2EVWX 5E7MA 4NYIR 1DG1G 3U3MA 2FPLA 4AK9A 4DLWA 5SZKB 5C4MA 1NVWQ 2JAQA 3D3QA 1KO4A 2BC9A 2ZE6A 4LV5B 1U99A 1HV8A 3OIUA 3E70C 4NCHA 2B21A 2IYQA 3G82C 4FMDB 4ACAA 2NPIA 3U6BA 1T8UA 5K8TA 3F8TA 2J0QA 2WZQA 2OT3B 1MT0A 2VEDA 4HB4A 2CL6X 1Z29A 3HP1A 4B34A 4D80A 2OUKA 3A1SA 5LD2B 1GVNB 1UADA 4I81A 5F2EA 4JLVA 4A6PA 1B0UA 4GOKA 2ZJ2A 3LVQE 2JJ8A 3B2EA 3FFAA 1W47A 3PJRA 3CRW1 1AS0A 2ZS8A 2GILA 4R2IA 2KBEA 5FPHA 5A5GA 1C4OA 1AGRA 4EPYA 4V02A 4TSFA 1E9BA 2BMDA 3H86A 3TR5A 3GFOA 1QDEA 4TQUS 1Z28A 3VR6A 2OG2A 2ZYWX 1R5OA 2GEDA 4BGDA 3H2YA 1ZC4A 3NBXX 4DSTA 2CL0X 1W4BA 1K6MA 2GBLC 2VP4A 2ZI3A 5B58C 1LS1A 1NN0A 4Q9IA 4TL6A 4IEIA 4Q02A 1QG4A 5GJVC 4ZI3A 1Z6GA 1JPJA 2P5SA 3QF7A 3VR2A 2CJWB 4A0GA 2ZI5A 1G17A 1P6XA 3ND9A 2QBYB 3OAAD 2XNDD 3K0FA 3ECCA 4OJKA 3G0HA 3OFND 3V9PA 1R8QA 1KO7A 2ZSAA 4BEJA 3VKGA 3AGQA 4JLBA 1KMHB 2BKEA 3RSOA 2AX4A 2NPFA 3EG5A 5KDOA 1R2QA 3AVWA 2LWIA 1EWQA 1IJFA 2CK3D 2CCGA 3LA6A 4OBEA 1S9HA 2QENA 4B73A 1JNYA 3O8RA 3OEEA 2IUUA 1OXSC 3RS4A 2CHGA 2WWHA 2ZRAA 2ZSBA 5CK5A 3FHOA 3I1FA 4HAZA 4BLQA 1GRQA 1KI8A 2ATXA 2XOKA 2QGZA 4HUQA 1N6LA 5E95A 1IJEA 3BH7A 3VX3A 1L8QA 5K8LA 5KYKA 4QKQA 3WYGA 4TZ6A 3A4LA 4CZ2A 2ZRFA 3AVVA 1G291 1HE8B 1G8HA 4B3BA 4FCWA 5AUNB 1XD2B 1NIJA 3HWSA 1MV5A 2JLSA 4JBYA 3QQ5A 1HE1C 3QKSB 1LW7A 4WOPA 2IYRA 1OPXA 1QHGA 4RD4A 2IXGA 2IW3A 2VP9A 1M34E 4M1OA 1TUIA 1RKBA 2HT6A 1IXSB 1E2KA 4M9SA 2FA9A 2HDNB 3B1YA 4ON9A 2WAYA 5BQ5A 3TMKA 1E94E 2DY1A 2IEZA 3W90A 4GI7A 1YU9A 2I1QA 3WNBA 3QJYA 4DLVA 4KBFA 2C9YA 4GMDA 3MGCA 1R6BX 2P6RA 1N6KA 4QBFA 2QBYA 2RGXA 3Q5EA 4PXAA 2IHBA 1OIXA 1D6JA 3B60A 1H8HA 4PPNA 3NBYC 5F9HA 4Q21A 2VSXA 4DDTA 1ZUHA 3K1JA 5FPKA 3PCRB 3FKSA 4QJ4A 4KVGA 1E9AA 1E96A 1FL9A 4YXWA 2A5GA 1CU1A 4PX9A 2ZJYA 4XH9B 1N6NA 3IBYA 4G5SA 4JKYA 4DT1A 1VCIA 1COWA 2FZLA 1GKYA 1ZJ6A 3FHTA 1VCNA 2A5DA 2IYSA 3K9HA 5IT5A 2R62A 4ACBA 4LPSA 2RB4A 4A4DA 4MYCA 4K8OA 3THWB 1NJFA 3AF2A 2ZJ5A 5FR2A 4M0LA 2VH5R 4R9UC 2O8FB 3QKSA 3DZDA 5BYJA 3THYA 4EQ6A 1ZUIA 121PA 4PO8A 2C9OA 4PR0A 5C4GB 2Z83A 1R5BA 2FDCA 4TN1A 4C3ZA 2A5FA 2YOGA 3B9PA 4TLDA 5EP1A 3TVDA 1II8B 3A58B 3Q8XB 5TARA 2ZRCA 3AF1A 4KLZA 4OQFA 3SR0A 3ADCA 3B1WA 4V0KA 3CR7A 3E1SA 1KJZA 3ZS8A 4JYBA 3LBHA 4HAWA 3H0KA 3EX7C 1YRBA 4UNQA 2J0SA 2F6RA 1NLYA 3OIWA 3BS4A 5CJ2A 3KQHA 2DB3A 2Q9AA 4PPGA 4EFLA 2B92A 2O8BB 1MO6A 2NZ8A 2C8VA 3AVQA 1A5TA 3I8SA 3H84A 3BIFA 4BLSA 2ZSFA 1KI6A 1H65A 3AKYA 3EWAA 4PZYA 4UXIA 4NYIQ 1E9CA 2CVHA 4B3FX 1SHZA 3T1VA 3DKVA 1AKYA 1E79D 4Q7MB 2KJQA 4OHXA 4P33A 4EPXA 4WW0A 1GL6A 1XBTA 3KJHA 5EE1A 4A0FA 3C7KA 4NKRA 4W7SA 3MRSA 5FBQB 4JVNA 1YRAA 4WXRA 2YWHA 3CPJB 3E5HA 2O8FA 1IBRA 3BFXA 1EFRD 1T5IA 4JSTA 1RE0A 4A2WA 1U9IA 4US1R 2Z5FA 1UF9A 3AKCA 1DO0A 3CUEF 4GRAA 4LHWA 2OAQ1 3EW9A 3LNCA 1CP2A 1D5CA 3CH5A 5H1YA 4OYHA 3I72A 4HYYA 4LJ6A 1KSHA 4S2EA 4HB3A 1QHXA 3AUYA 4HSEA 3GLGB 3SYNA 4L9SA 3CF2A 4UNRA 4U5XA 1R8SA 3BRWD 1R0XA 421PA 5HTKA 3MFYA 2JLQA 3KKNA 1F3OA 1ZNYA 2ODWA 5TMPA 1OT3A 2OEPA 4GFDA 3UXMA 4TMXA 2YWEA 1KIMA 4WZBE 3N70A 1Q57A 2FGKA 3F0TA 4MYHA 2I3BA 1L7VC 1XTIA 1XEFA 2GXSA 4HZUB 3I4LA 1KMQA 2W58A 2NZJA 2QPOA 1GFIA 1T8TA 5KO2A 4NCNA 1RVDA 4TSFD 3SQWA 2D3WA 4JS0A 2QM7A 3PENA 1DELA 1GIAA 3OE7D 4GMXA 2X19A 2HJGA 5AUQA 2GZDA 2VA8A 3GP8A 2F9LA 1E69A 2GBLA 1XPOA 3AQ4A 4PO1A 1LY1A 5DN6A 2JDIA 1MABA 2AKYA 3ZJYA 5JWOA 1NVUQ 3U7FB 2UVQA 3KUCA 4RFVA 4Q5IA 1W5TA 2ZRPA 3QKRA 4MGZR 2NQ2C 2A9KA 2Q3HA 1BS1A 2GF9A 3GCGA 5FTMA 1R10A 1NN1A 5FOSA 2WVJA 2PH1A 1XJQA 3WXMA 4A8JC 1DAMA 1E2LA 1S2MA 1EFUA 4LJYA 4US0R 1JJ7A 1X8KA 1CS4C 1ZMXA 4QNMA 4OKSA 2MSEB 4B75A 2ZTSA 4JT4A 5H70A 3QIAA 2J0VA 1N0UA 4OHZA 3QXSA 4ZO4A 4RZUA 2OCYC 3CX6A 3PUVA 4Q1AA 4BFUA 2JJ1D 1KKMA 2R65A 4MGYR 3ZZUA 2GCOA 2J7PA 3OEED 3MJHA 1NLFA 2XOKD 4B48A 1CBUA 1QHYA 3DMDA 2WJJA 4ZI2A 4PQFA 3VHXA 2KB0A 2QTVB 4M1MA 4FMCB 1YJ5A 2D06A 2J45A 1KI3A 1E1QA 1TNDA 3TRFA 4DEXA 1YHNA 1SVIA 1LTQA 1M8PA 1ZP6A 4XD7A 1L4YA 2CMKA 3AKEA 4X8OA 3WHKA 2ASEA 2A78A 2YNMA 1GUAA 4C2TA 4DLUA 5JEDA 1T3HA 4GP7A 4BRUA 1Y3AA 3QPVA 2HJVA 4HB0A 5EUQB 4DCUA 3K53A 1XCGB 4I1UA 3HYTA 4LBVA 4ARZA 2YOHA 2F1JA 5AJZA 3BGWA 4CEJA 3D6TB 2C95A 1MO5A 2G77B 1P73A 5GJBA 2VP5A 1FTNA 3IQXA 3B13B 5FBLB 2QT0A 2VBCA 1CRPA 3SI7A 1E4VA 5H68A 4OI1A 4MRPA 5FTJA 5AJWA 2D74A 1E2PA 1P2UA 1G7SA 3HJNA 4LI0A 1KI2A 3BAFA 1DTSA 3K70D 2BM1A 3LO5A 1H8HD 3VR5A 1S9DA 1Z07A 1E2HA 4QBHA 2W83A 4G3XA 4MRSA 1P9WA 1XTRA 5DI9A 5TDHA 5UKDA 2P5TB 5IRCD 3T61A 3CLVA 4DVGA 3UPUA 1WF3A 4YXWD 4PZLA 3SYLA 4D4JA 5L3SA 1J90A 2AWOA 1RRGA 1KY2A 2KSQA 3VX4A 3W3ZB 2JLWA 3PEWA 3SFZA 2AWNA 2IS4A 1CR2A 1TADA 2O8EB 1COWD 1DG3A 3BE4A 3F5FA 1Z47A 4QGFA 3HR8A 3AP3A 4C7OB 3CB4A 1SXJB 5CLQA 4XTRA 4C30A 1P62B 3VQTA 1VTKA 2CCKA 3LW8A 5DSZA 3BB4A 2AXPA 4ZKDA 1ZU5A 1I4DD 4QBGB 5GVRA 2ERXA 3CPEA 4GOJA 1N6OA 2GTPA 1M6NA 2IC5A 2XB2A 1Q1ZA 1R0WA 4JLOA 3ND8A 1E2DA 1KJWA 2ORVA 3CWQA 3QXJA 1CF4A 4LC0A 5C46F 4IDQA 2C03A 2R6FA 3IO5A 4JJZA 1E3MA 2YINC 1OW3B 3W9YA 4XTCS 2A5YB 1VHLA 3TUZC 2YC2C 3W3AA 4LHXA 1E9FA 4IHQA 2E87A 4HLUC 2ODBA 4D25A 4TTQA 4B3DA 4RJLA 2PLFA 4D0LB 3DEFA 4RFSB 1W4RA 2PCJA 1DBSA 4X8LA 4ZDIA 5IK2A 2QP9X 4D4LA 1E2IA 3S1AB 3NDPA 2BHRA 3RNLA 2PL3A 3R20A 3SEAA 2BJVA 2FWRA 2HYDA 1ZNXA 2YOFA 3EIQA 3GJ3A 4Q4AB 5HPYB 2EWVA 2FFHA 4HAYA 3C41J 4UJ5A 3T1QA 1XNJA 4RKFA 4J0QA 2FH5B 5E3HA 1OSNA 3DKPA 5JCZA 2ZXUA 2GK6A 4XWAA 1E6CA 1RW4A 4B6FA 4W5WA 1NMXA 1XMIA 1WXQA 5KPDA 1E2QA 4Q03A 4KFRA 2C99A 2GCNA 2OBMA 1QHHB 3NIBA 1YVDA 2V1UA 4OI4A 2VSFA 3REFA 3SFVA 2F3RA 3ETLA 3TSOA 1T9HA 3RLFA 1VYUA 2W0SA 5EE5B 1FQJA 4DLZA 1A4RA 4QC2A 4TMWA 1FX0A 1JQLB 4A9AA 4B44A 1A2BA 3B5JA 1OH8A 1F2UB 2ZSEA 1AM4D 1UM8A 4IOKA 1ELOA 4UJ3A 5HE9A 1DS6A 4JVMA 2F43B 1SVKA 1TQ2A 2F7SA 4M1TA 4Q4HB 3CZPA 5BW8A 2J46A 4XVUA 3LAWA 1YKSA 1KDOA 3HU1A 5FPYA 3QVVA 4BASA 1E2JA 1WB9A 1JBKA 1OIVA 3B1ZA 2QP3A 3NC1C 1N25A 2PX0A 2QN6A 4TTRA 2WOJA 1PLJA 4LJ7A 3WY9A 4L8GA 1G3IA 1N5IA 2J5XA 1MOZA 1Z06A 3CRRA 4L5BA 1W4CA 2GK7A 1P2SA 4Q1DA 1NSTA 2FSFA 3U60B 3Q7QA 3AVUA 1QG2A 1SKQA 4TQAA 4ESHA 1US8B 4BLPA 2ZUDA 1RYHA 4JLAA 3CRQA 1P60A 4KO8A 5J40A 5HKKA 3SHFA 4Z54A 3EC1A 3I92A 3T06B 2V55B 1GRRA 3SYKA 3WYAA 2JLUA 5BWMA 5DN6D 2JDID 4C9BA 3G5UA 3U44B 4H1UA 4IXNA 2O8CB 2VP0A 1D2EA 4Z1MD 3PUZA 3KZ1E 5LDDC 2FNAA 1VG0B 2HCJB 4NTZA 4A8JA 5G53C 2ZJ8A 3P27A 3MWJA 1NVVR 3KJIA 4LV6A 5CIQA 4CYMA 2AR7A 2HLDA 1UBGA 5KSPA 1F2UA 5AJXA 3FWYA 2R9VA 2GAOA 2F43A 2IWRA 1P2VA 4KAXA 3UG6A 1ODFA 4CT4B 4M9XA 3F3YA 2MSDB 3MSXA 4BPBA 2JEOA 3IEUA 2O8DA 5HZKA 2J7PD 3EWSA 2ZR7A 5J4VA 4MKGA 4OQXA 2ZETA 4LYFA 2P65A 4H9GA 1GILA 4CW7A 2WHXA 5AUOB 1G5RA 1WRBA 3GLIE 3R8FA 1GTVA 5J4KA 1VG1A 1UBCA 4RY2A 4CIDA 4DBLC 3NKVA 4XD7D 4BZQA 2ZJZA 1DAGA 4GT1A 4Q4LA 3MG9A 4DLTA 4F4JA 5EP3A 1MH1A 4RZ2A 1E9DA 1MRNA 3U3RA 3CIOA 1RYFA 2FE4A 4TLCA 5L8VA 5FOWA 4QHSA 2VP2A 3U7GA 1EFCA 3B85A 5FTLA 1Z6AA 4OQNA 3A6PC 1U8AA 2ZQ5A 3GJ6A 4JLPA 3SJZA 2HUPA 2BMJA 4OL0A 1ESMA 2YJTD 3K8YA 4F38A 3TAHA 3EPLA 1ZYUA 1FZQA 1G7CA 4Q9LA 2GRJA 3BB3A 5EJEA 3DHWC 3TH5A 5KSZA 2PZGA 3EASA 3KXLA 2G0TA 3FMOB 1JPNA 2AFIE 3B8HA 2WV9A 1P72A 2H17A 3E2IA 5JLJA 2V8OA 4LX0A 1YE8A 1F60A 4KSBA 3LBNA 3A1TA 4BFZA 3DL0A 4L15A 3ZVNA 2K5UA 2F9MA 4OQLA 5KSOA 4AKIA 4FN5A 3NH9A 1B23P 3U61B 3MLEA 3RS0A 3X1XA 3HR7A 2OCPA 1N5KA 4M1KA 2FMXA 2VF8A 4GZLA 2FJUA 3RSLA 2MSCB 5JRZA 4AYTA 4BZXA 1OXVA 2D2FA 2QT1A 5FL7A 1QHSA 2DCUA 3QKUA 4D0NA 5KOYA 4YONB 4HUQB 4HEJA 1T3LA 3BC1A 1A82A 2GWHA 1OJLA 1G6HA 2R6GA 4PAQA 4LCBA 3BJIC 2EFHB 1OHHA 1CIPA 3K9LA 3GLIA 1CJUC 4LDJA 3LH5A 1XMSA 2QP4A 2P0EA 3AF3A 5JECA 1E9RA 2ZM5A 5G3YA 1XX6A 4LOAA 3X2SA 3CRVA 2DWOA 3FE2A 5FBWB 3QXXA 1BH2A 4NU0A 3P20A 4G01B 4AKHA 2ZS9A 2CVFA 3TKLA 4LSGA 2ONJA 2WICA 3R9WA 2WSSA 4UNNA 1S1CA 3U7EB 1CJTC 3MWKA 4TL9A 3DVLA 4DIEA 4N0DA 3QSYA 2FU5C 5KSYA 1JR6A 2QNRA 1G7TA 1KNXA 3CO5A 1HA3A 3L8ZA 3W8RA 1NIPA 3P4XA 2IYUA 3T12A 1XF9A 4HLUA 4DDWA 1EESA 4CDGA 1U94A 3THOA 4X8HA 2VO1A 4GZMA 3K70B 1QZXA 4R7ZA 3BH6A 1KK3A 3GEHA 1XTSA 3TR0A 2WIBA 3L0PA 4ILEA 2AK2A 4EJSC 1K5DA 1Z2AA 5CYPA 3CH4B 1XCMA 5GVSA 4Q48A 1UKYA 2OESA 4K81B 3L2OB 1Q22A 4LJ9A 2FV8A 3PUWA 1TQDA 4YMUA 2LCFA 4DT1B 3SS8A 4FD2A 3PFIA 1IY0A 1SXJD 2HF9A 4IJMA 4TT3A 4U00A 2BV3A 1ZC3A 4RD6A 5FFMA 3LLMA 2F1HA 2GAAA 2IK8A 2ZRHA 3MCAA 3LVRE 4E5UA 4JT2A 4OHYA 5KHOC 1Z6YA 3A8TA 4QRHA 3AEZA 3BERA 3AP2A 2LKCA 4I1OA 4D81A 2OO7A 5TV2A 3THYB 4YDSA 4B2LA 4EQ6B 1ZIPA 2ZYVX 3T1TA 4BUJA 3QPWA 4WVFA 3A1WA 2DFTA 2W2XA 4B33A 1OH6A 4GOXA 1G8YA 3AVPA 1KNQA 4C0LA 3QEOA 1F2TA 1KAGA 2RGGA 2QI9C 2QTFA 1F6BA 4TMKA 1XTJA 3TW8B 4OI2A 1NNEA 3TVTA 1XTKA 2IYXA 2XX3A 4W5JA 4DCSA 3PEVA 3PXGA 5B57C 4NPHA 3FDIA 5DH9A 1JB1A 1WMSA 5DE3A 3UK6A 1WCV1 1D9XA 2XITA 3SBEA 4KYUA 3DOEA 3NWJA 1II0A 2IYZA 1WA5A 3AVOA 1FUKA 4JIMA 4P4SA 4OK3A 1NY6A 221PA 5JS8A 1N0WA 1NVVQ 2YC4C 4JL6A 1CKEA 2Q0HA 4P0TA 4MKHA 3C15C 2NIPA 3FPAA 1NY5A 4PSKA 1KZ7B 2QORA 2HCBA 2W6ID 1KI6B 2F55A 2GVDC 1E0KA 1OFHA 4NONA 3OIVA 3UKDA 4BECA 4FCTA 2RGNC 4HATA 1J8MF 5HKKD 1GNPA 1UEIA 1ZCAA 2BCGY 6Q21A 1QRAA 2CE2X 2R44A 4KI0A 2OFWA 2QU8A 1HEIA 2W2TA 4PZZA 3SJAA 1OXUA 3QY0A 3O8CA 2C96A 1SKYE 3RRZA 1AA9A 3FYHA 3R7WB 4ERNA 4YMTA 1AJEA 4TMZA 1W0KD 2WKRA 5ELXA 2ZVPX 1W36C 1XJCA 2OSBA 1DAIA 1GZSA 2FEMA 3Q3JB 2HLDD 1W1WA 2JA1A 4G5OA 1KOFA 4XSGA 2YVUA 1RRCA 2NOAA 2BVNA 1G21E 4US2R 2C2HA 2FF7A 4PHGA 3OIYA 3RS7A 2PZFA 8OHMA 2CE7A 4IEEA 1UBEA 1RRFA 3VU9A 1GG2A 1XFAA 2XXAA 2O0KA 4KHZA 2AL7A 2P3SA 2X2FA 3U3OA 1Z3IX 1G8GA 5BYKA 3EZ7A 3T5DA 4CVNA 2VHJA 1VG8A 2G3YA 3AB3A 5F9FA 1Z5ZA 4F7WA 4RD0A 4Z8XA 2GESA 4F92B 4A0RA 2CCJA 5IHPA 2CLDX 3A4NA 4LYAA 3RANA 2ZUCA 3B1XA 3RWOA 4Q9JA 2PMKA 2ZU0C 3PV0A 2H8KA 4KVAA 4M21A 5SZJA 1UJ2A 1XZPA 2QTHA 1II9A 1BO6A 1AGPA 2H7VA 2WWGA 2XTMA 2IS1A 2HYIC 4P4TA 1ZNWA 1FMLA 2GXQA 3OEHA 5FOXA 4L4UA 4LYHA 4YMSA 1O87A 3M1IA 1YZLA 2HEIA 4IDPA 2GVZC 3QE0A 3KQLA 1H8EA 4AG5A 1E98A 1QHNA 4MYUA 3LQRA 1IN7A 3R7WA 4Q4JA 1MABB 1Z22A 4V0OA 4FMDF 1XCPA 1KJYA 4TLAA 3QKRB 1D8TA 1HT2E 2WTUA 3L0SA 4B3CA 1BKDR 2FZ4A 2QRZA 1KO1A 3A1VA 3TUJC 1SULA 3KKOA 2O0HA 1OFIA 2JIZA 1DARA 2V54A 3CNNA 3PR1A 5C2JB 4C0AC 1AK2A 5EP2A 4QJ5A 1NN5A 2AD5A 2IYYA 3TNFA 4DUGD 4ZIRA 4CGZA 2BDTA 1P75A 1M74A 4QGHA 1FTSA 4MDEA 1GL9B 2DWQA 2RCNA 4LJAA 3KQUA 1CXZA 2ZI9A 5BXQC 2J59A 4URZR 3AP1A 5FPSA 4Y0AA 4U7DA 4G5RA 1D2MA 4Q19A 5FL7D 5J4HA 4TYNA 2GCOB 1MO4A 4EPRA 3CR8A 3TBKA 5DNYB 2UZ3A 2PT5A 4LK2A 3RYTC 2ZEJA 1YZQA 3UG7A 4N3NA 3CW2A 4ZV4A 1JEDA 4ZDWA 1Q1EA 5TXGA 2BMEA 2NMVA 1G1MA 1OHHD 3A37A 1IM2A 1GITA 1S3GA 4PANA 721PA 1SZPA 3I5YA 1TF7A 1P61B 5FI0B 3DM9B 3EIEA 4XOIA 4Q66C 3ASYA 1OE0A 5L3VA 1SVOA 4NZYA 3V4RA 4E07A 1R0ZA 2XJ9A 3K0CC 2CNWA 1X3SA 4F4CA 2GDJA 2PLRA 2BBTA 1UBFA 3CWZA 4ITRC 4IXMA 2WSSD 2DYKA 2PT7A 3AUXA 2CDNA 2EFDB 4ARZB 4AY2A 2MMGA 1IQPA 1DOAA 4CEJB 2IEYA 2KWIA 3W5JA 2V7QA 2PJRA 2ZROA 1JECA 2HV8A 4HDCA 1FQKA 2V6JA 3MUFA 4Q9KA 2CLSA 1JALA 5E7IA 5CDFE 2BIFA 2FFAA 1KK2A 4FW9A 1WBDA 1X8LA 2FSGA 4Q1FA 5EXSA 1GKUB 3IQWA 5JRJA 4B35A 5KDDA 5JBQA 3Q9LA 2J0UA 4EJSA 3IHLA 3MJRA 4PC7A 3DMNA 4DSNA 1SQ5A 4JBWA 3KUDA 4PHHA 1UAAA 5AJVB 1TEVA 2AK3A 3IGFA 5L3SB 4XIGS 4DXAA 4ABYA 5CB8A 3ADBA 2ONKA 3WMEA 1XDBA 2WOOA 3W6NA 4NCKA 4HUTA 3KXKA 1JAIA 4GDFA 1FP7A 3U2QA 1G18A 2A3RA 3VFDA 2ZRKA 1ZINA 3K0AA 2QAGC 2ZRJA 4JVSB 1Z8FA 4OJQA 1XD8A 3IDQA 4TT3D 2HF8A 4IVRA 5B64A 5CJPA 4KBGA 1ZW6A 3U4QA 1KI7A 1DPFA 2B8TA 4WBSA 2O0JA 4DDUA 5G41A 5IDVA 1Z63A 5DISB 3PG5A 1CJVC 3GEIA 3N5CA 4KSCA 1HUQA 2EU8A 1NL3A 4B71A 4TLEA 4QG7A 4BWYA 2WWYA 3R8CA 2G1JA 3DM5A 3CKLA 4A6XA 1ZUNB 2LKDA 2VQSA 1W4AA 1NN3A 2ZSDA 3I62A 3FFBA 1JXOA 521PA 1W48A 5EE0A 2PJZA 4Q1EA 4TL7A 3MD0A 5GADl 1XPRA 3H4MA 1IXZA 1KK0A 1RIFA 5JEEA 3QUSA 1UKEA 2XZLA 3KTAA 1W49A 5DYGA 3QBTA 4LC1A 1RC8A 3RAPR 3EZ2A 4E03A 4PTLA 2QMOA 2XSZA 4NYJR 5EUMA 4A2PA 5CDFA 1XP8A 4H1VA 1OXXK 3C5HA 3W5IA 2YKGA 2V1XA 4I99A 4TYPA 1AQUA 5LPNA 3FKSD 2ZJBA 1G16A 3GLHE 1G8FA 4AI6A 3K09C 2OCBA 2VTKA 3FB4A 3RABA 1NMZA 2QROA 4FMBB 4KXFB 1KI9A 2YV5A 3IO3A 2RGNA 3GLHB 5KDLA 1CR1A 1ZBDA 1ZM3A 2QPAA 5DO9A 4C2UA 1Q3HA 1U0LA 2RKOA 3EC2A 2X77A 2QMUA 1G4AE 2ORWA 4PPQA 3GEEA 3VR3A 4A15A 2WIAA 1OLOA 3JVVA 2NGRA 1ZVQA 1UDXA 4IVPA 4JMPA 5JJKA 4LV8B 3U5ZB 1I2MA 2IUSA 1TF5A 2XJ4A 5B30A 2CHVA 5J4YA 5CM8B 1XEWX 4TMVA 5GJWC 3KQNA 1ZD1A 2OZEA 1OF1A 3L8YA 5FUVA 4CEIA 2RGCA 3T15A 1FX0B 2ANCA 1XXHE 1UDWA 2FFQA 4JLKA 2R6CA 4TYYA 1PUIA 1N6PA 1CJMA 1E1RA 4ASUA 1IHUA 3JZMA 1XXHB 1XMJA 3A36A 4DIDA 4DLRA 1HURA 1SHKA 2EYUA 1IXRC 1PV4A 1FUUA 3GQBA 1Z0JA 2L0XA 1YZKA 2H16A 4NCJA 5CK4A 3X1DA 2IUTA 3Q85A 4C4PA 1ZM7A 4URYR 4MUAA 1E0AA 1FMJA 3KJEA 2E1RA 1TTTA 3BWDD 1A1VA 3I73A 4WZ6A 2ZVQX 3QBVA 1HT1E 4JSYA 3JZAA 3D7MA 3TUIC 5IF9A 1AN0A 3OF5A 2IF2A 4URVR 4OHWA 3GLHA 2WBLC 3U3KA 5G3ZA 2ZRIA 1YR7A 4AC9A 4BFWA 1GAJA 5JS7A 1YR6A 1TU4A 3TQFA 3LD9A 2DR3A 621PA 5A4JA 2HT1A 3OAAA 4LJ8A 4M2LA 2Q9BA 3LQQA 4EUNA 2QE7A 1H8ED 4ESVA 4CEHA 4PO9A 1FP6A 3SZRA 3IIKA 1DAFA 1ZD9A 3W34A 4LBYA 3RRNA 3P26A 1S8FA 1WE2A 2XEXA 3AKDA 4A8JB 4PHTA 1U2RA 4WXPA 5C1BA 2JIZD 1EXMA 2CBZA 2RH5A 1T3SA 2QMEA 2WM9B 2BOVA 3CBQA 4G5QA 1XXHA 3KKMA 1ZAKA 4LWZA 3RS2A 1KDRA 4XSHA 1HY3A 3BFVA 4NYMR 4DCTA 1TQ4A 1FFHA 4DJTA 5FBVB 3TQCA 3VKHA 2D62A 2O8DB 5P21A 4L16A 5D3MA 3RHFA 2QAGB 5BN3A 2NO7A 4KFUA 2ZI6A 1FNNA 5JSZA 5JZVA 4P3YA 1SVSA 3CF6R 2IS6A 1IN6A 3ZZTA 2X2EA 2H57A 1E4YA 2D2EA 5L3QA 4NL4H 4DKXA 2GCPA 1Z0AA 1LF5A 3K0CA 1WQ1R 3TJZA 4C0HA 3IHWA 3MMPA 3EIHA 3ZQ6A 2IX3A 1G3MA 4BFXA 5AUPB 1YZTA 4Q47A 2KI5A 2RGDA 4MKIA 4NHOA 1GM5A 4DRZA 5DGXA 4IOJA 3CONA 1Z0DA 2VP6A 2JLRA 4XJXA 2V7QD 3A1UA 4MYTA 1ANKA 1G4UR 1IY1A 1TUEA 2I1VB 3ZVRA 4G1UC 2G9NA 3IILA 5TB5A 1Q21A 5HE8A 4AWXA 2MMCA 4FMCF 1YZUA 3L82B 5TVKA 4V0NA 2P6NA 2VPPA 2ZJOA 5TY0A 1EG7A 2NO1A 3SN6A 4MUBA 2WMOB 2JATA 3AV0B 2WWWA 1GRNA 2A5JA 4UNPA 1OB5A 2VL7A 1FW6A 1CTQA 1PLKA 3P32A 3EPKA 3IPXA 2FPMA 4GP6A 3TLXA 5D3QA 3NHAA 3GJ7A 3C4JA 2ZR9A 2CLCX 2QAGA 2SHKA 3WRYC 3TIFA 2W00A 1UKVY 1W0JA 1HTWA 4I1VA 1LVGA 4I4LA 4IFBA 2EWWA 1F48A 1E1QD 1KZGB 1G9XA 2W0MA 1E2MA 3GLIB 1DAHA 2VHUA 3IKJA 2OAP1 2WSMA 2QUZA 2AN9A 4D82A 1TQ6A 1MO3A 4QM6A 3B78A 5ANRB 4GSYA 3IIJA 1W7AA 1AKEA 1VHTA 3KB2A 4A82A 3U6KA 4HDQB 4II7A 4F4IA 2I4IA 2YYZA 3C16C 4B43A 3Q72A 2FN4A 5JWHA 1PUJA 1D9ZA 1S0UA 4K46A 1XEXB 4MRVA 5AK0A 1E9SA 3HYRA 2IT1A 4MA4A 1QF9A 1L4UA 2WMNB 3QG5A 3KDSE 4IRUB 3EARA 5J47A 4PC1A 2GHIA 3SHWA 2ATVA 1EGAA 5FH9A 2IA5A 3QXCA 3WBKA 4B2IA 4YMVA 3FHCB 1X86B 4PQYA 4C0JA 3EPJA 1HQCA 1RJ9B 2JGNA 1DVRA 1LFDB 1E32A 2ZE5A 1LS6A 3CRMA 3WP0A 3X1ZA 2UKDA 2RAPA 2N46A 2XSZD 3ZVMA 4RCZA 4TYQA 1U81A 3ZVLA 2HXSA 5JWRA 1NF3A 4JYCA 2QRNA 2VIIA 3UMSA 1Z6XA 4TZ0A 1GOTA 3WHLA 3K09A 3TE6A 3EPHA 4DB2A 4D2IA 1UFQA 3QXHA 3RVBA 4KV9A 2AXNA 4PPFA 3WP1B 4L9WA 3PVSA 1BOFA 4NP6A 3ZGXA 1JI0A 1NG9A 2AKAB 1XB2A 1Z83A 1AS2A 1EFRA 3W6PA 1UPTA 1I2DA 3ASZA 4M53A 2QSZA 2BWJA 2H18A 2VSOA 4QXAA 4IKEA 4HLQB 4M1YA 5J5CA 1NJGA 4BRWA 1QBKC 2EYQA 4BLRA 3HU2A 1M7GA 1X8JA 4CT5A 1N5JA 1CULC 3T5GA 1G41A 1YR8A 3GPLA 1W36D 4LHVA 3GLFE 2J3EA 2W6JA 2AFHE 2FSHA 2V6IA 2WKQA 2GKSA 2WPDA 2WJVA 3BB1A 3BORA 5DI3B 4QM7A 4MH0R 5EE9A 1ESNA 2DBYA 5AR1A 1XU4A 1J70A 3GLFB 4QNRA 3AM1A 1JAHA 1KDPA 1SGWA 4MKFA 4D26A 1XEXA 1E2FA 1K8RA 1E1RD 4ASUD 4R71A 4WZAE 1F2TB 2ZU6A 3CX8A 3P1JA 1IOZA 1R0YA 3RS3A 4QFMA 4XWKA 2O5VA 1TPZA 4Y0VA 1KK1A 2J87A 4BLTA 4A1FA 4HDOB 3REGA 4CRWB 1Q12A 1RJ9A 1TF2A 2QQEA 3KKQA 2H1LA 2IXFA 4URWR 3PUXA 4JLMA 2Q6TA 3AVTA 1Y63A 3LDAA 4P4SB 2C77A 2ZITA 3OE7A 1NG1A 2H92A 4AD8A 1TL7C 5JI2E 5IK2D 1VIYA 2HXYA 2EFCB 3NEYA 1AIPA 1NSFA 3QG1A 1EX7A 4MQBA 5CIWA 1I4TD 3LRPA 2C98A 3ZH9B 2YZ2A 3O47A 2QQ0A 4JLNA 2FFBA 4NYMQ 5SZIA 1MR3F 3CNLA 2GXUA 3AVXA 2JJ2A 3KX2A 3FMIA 4PSAA 3THXA 2IL1A 1YR9A 1PZNA 2F3TA 4DWJA 2QE7D 4DLYA 2ZANA 4IW3B 1VYVA 4BFSA 1VCMA 2BMFA 1XPUA 3WRXC 2GJ9A 2VRWA 5LBIA 3ZD6A 3EA5A 4JZKA 4Q01A 5L3RA 3AH8A 1OV4A 2FG5A 5DI3A 4I1SA 3GJ4A 3SBDA 4UQOA 2WJHA 5KPJA 3C14C 4PAOA 1J8YF 3GLFA 1U98A 3QKTA 2JJ1A 4GBMA 3RRYA 1P7CA 4ZCMA 1A7JA 3IPYA 1QVAA 3NEJA 2WKPA 3NDBB 4TMTA 4RD3A 3A4MA 3ZLJA 1P9NA 2WJGA 4LBWA 2Q3MA 4KITB 3ZS9A 1OH7A 3TW4A 2Z6VA 3VU9B 4AYXA 3GJ0A 3NG1A 4M1SA 1R4AA 3EZ9A 821PA 2XXAB 3ICQB 3GFTA 4URUR 3UATA 3SU8A 2BEKA 1T91A 1A2KC 1KO5A 3MWLA 2ZYTX 2DFLA 2J1LA 2ODNA 4MGKR 2OLJA 4KYIB 4RZXA 3D31A 4ZCIA 3X1WA 3GJ8A 4QGGA 1DAEA 3SJCA 2GEUA 3LY5A 4CF7A 4HLDA 3KKPA 3VAAA 4W5HA 2GEVA 4Q1BA 4V03A 1VECA 2O52A 4DEYA 1EX6A 4X8MA 2QY9A 3T1OA 2CJWA 1RPZA 3PIRA 1VMAA 2OILA 2ZRDA 3FMFA 3BD9A 4C0KA 3WMGA 1KTVA 1T0HB 3SNHA 3FVQA 1OYYA 1OKKA 4R2HA 1DE0A 3KB1A 1CLUA 3MWYW 3FOZA 1KMHA 1M7HA 3AVYA 5JJLA 4Q4JB 4PFSA 3B1VA 5EQTA 2REBA 4WAUA 1MKYA 4KCGA 1DO2A 1DAKA 1SKYB 2PEYA 3RDPA 1VIAA 5JMTA 2BBSA 1RFLA 2QZ4A 1EFHA 3WNDA 3BK7A 4AKEA 1E2GA 2IYWA 3GD7A 2OE2A 3T34A 3UMFA 4ZIRB 3LBIA 2G6BA 3TK1A 2RHMA 4BFYA 3EA0A 3KFXA 5C18A 3N2IA 1KI4A 2ZRNA 4DLXA 1XD2A 2PBRA 4YMWA 1FOEB 4EKDA 1KSFX 1GKIA 1M1YE 3U7HB 2EQBA 1W0JD 3N2EA 2FEOA 4KODA 4O2RA 4PQRA 1KY3A 5G40A 3RC8A 2OCAA 1PJRA 4HAVA 5E4FA 1O3YA 4ZCLA 4V0ME 1X1SA 2V9PA 3B7GA 3VKWA 3KFVA 2CHQA 2Z0MA 3CM0A 3WBJA 1JR3E 3I32A 1G7RA 1J2JA 3FGNA 1N0VC 3C5CA 4LJ5A 2OFXA 3WYFA 3KJGA 4Q9HA 5DYIA 4DSOA 1V43A 3DPUA 5GJCA 3VR4A 2ZRLA 1Q1QA 1JEEA 2WWFA 3SE0A 3BOSA 1IAQA 2D7DA 5CYOA 3J81k 1D2NA 1K5GA 2OBNA 2YWGA 2DPXA 3P4YA 4ZDKA 2ANBA 5JCPA 2W2VA 3TAUA 4B3GA 3QNUA 1W5SA 1IN8A 1AQYA 1HH4A 3UANA 3QI2A 2N1BA 4UNSA 2KBFA 2G1KA 2IHYA 2P67A 2YHSA 1G64A 2YWFA 2ZRGA 2GJAA 1E2NA 2VLIA 3CF0A 4KU4A 1MRSA 4A36A 1CJKC 4LHYA 3AF0A 1E9EA 4XWOA 2B6HA 4FIDA 2GA8A 2J0UB 2C78A 4EJSB 4M9QA 4QHTA 2ZAOA 4PC2A 5CB6A 1Q0UA 4LZZA 3THWA 1Q3TA 1SXJC 4EPTA 3KQKA 5LB2A 2X1VA 1IN5A 4DDVA 2J9RA 3BXZA 2GF0A 3VTKA 3ZD7A 2A30A 1T0JB 4JL8A 3UWKA 4GNKA 3HPRA 5JHGB 5JJIA 3LWNA 3NVAA 4IDOA 5KUTA 2AD1A 3LFUA 3K0AB 4A0HA 1KKLA 3GLGE 5FPTA 3B6EA 2ZAMA 1RZ3A 5DHFA 1WP9A 1LNZA 3U4QB 3DZ8A 3WNCA 5KNBA 4B3XA 1UEJA 2IF0A 1II8A 2W6JD 2BJWA 2WPDD 3EZ6A 5K8IA 4V0MA 2BCJQ 4A92A 5FUXA 4RVCA 1GSIA 1N3BA 3SJBA 4QOSA 1JR3A 1Q1BA 4OI0A 4S35A 2ERYA 4TWZA 4XVRA 2CXXA 4NCIA 4FCVA 4O2LA 4EDHA 4NE2A 1JXMA 1N2CE 4D0GA 4JBXA 1BMFA 4GPTA 2O8BA 4UXJA 3GFPA 4RSGA 4BFVA 1RRPA 4LPKA 2XZPA 1OXTA 4QJ3A 5HZHA 3MAAC 4IOMA 1BIFA 1BYIA 1M7BA 3KTAB 5FUWA 3R9IA 2DFNA 5J4LA 2WWIA 3VR1A 2F1RA 1GNQA 2WWXA 3GMTA 2B8WA 2REXB 5EZ6B 1IONA 4NBSA 2XZOA 1IN4A 2OM2A 4KFSA 1VPLA 2BEJA 2ZUBA 4IVQA 5E7JA 1XMVA 4LUCA 4R98A 1TAGA 1W2HA 1ZNZA 1NBME 1QVRA 3UWOA 3ZIAA 2ODEA 5LB4A 2P6UA 1HYQA 2QL6A 4GL2A 4BFTA 4QGAA 5EE3A 1PLLA 1NI3A 4Z1MA 3PQCA 3DO6A 1TMKA 1ZU4A 2JJ2D 2VF7A 1W44A 2V3CC 2REOA 3K0SA 1U8YA 3CZQA 1NP6A 1QHIA 4EAQA 1W46A 2ORIA 2RGEA 5KNCA 1XJ0A 1Z0IA 1G5TA 4ZDJA 2ECKA 2QSYA 2R2AA 3OZXA 3I5XA 2WJYA 3GLGA 1S4QA 4AIIA 5M04A 1KO8A 4IOLA 1UKZA 4YQFA 4NH0A 4JJKA 2PEZA 1W36B 1BYUA 2NO9A 4EPWA 1E0JA 1VCOA 3W8NA 4DCVA 4OQMA 4CEIB 1Z2CA 1EK0A 1VYTA 1G6OA 3KXIA 2GNOA 2OFOA 1FPMA 5FBRB 2Y8EA 2NG1A 5BN4A 3RC3A 1TU3A 2A2ZA 1OB2A 4UXHA 3PUYA 5JI3E 1XRJA 4HZUA 4DCNA 3V4FA 3NBZC 1JQJC 1LV7A 5CITA 4P31A 2NO6A 4Q7JB 1R7RA 2ZIAA 4EIWA 4P32A 4G5GA 1ZCBA 3W6OA 3BH0A 2FX3A 4DB4A 1P4SA 2B7BA 1Q20A 3O8BA 3UIEA 3Q7PA 2GJKA 4BQSA 2GXAA 1G19A 4EFNA 3ZZ0A 3VHLB 4QBIA 2JLXA 2OHFA 1NKTA 2QMHA 3RRMA 3NH6A 2V4ZA 3NBFA 1NBMA 3DDCA 4E22A 1Z6TA 5FOVA 2C04A 4HZIA 2ZREA 4V0LA 3SC3A 2ZS7A 2GETA 2PX3A 2PCLA 2ZE8A 3NC0C 2E9SA 2WJIA 1E0SA 4BE7B 4FINA 1OKKD 1NLZA 4HB2A 1AS3A 4MRRA 3L43A 4BEBA 1J7KA 4TYWA 4CEHB 2N42A 5FOUA 1N6RA 5CLLA 4POAA 1I4LD 4E09A 3Q5DA 1GNRA 3NXSA 5FI1B 4P4UA 3TSWA 2BBWA 1T5LA 1OIWA 3CX7A 3KL4A 1HQYE 2R6DA 1GL7A 4RD1A 1KI1A 4HLCA 4UKDA 5FL3A 2ZRBA 4IDNA 3OHMA 2DWPA 1WDTA 2X8AA 1SXJE 4M9ZA 1X1RA 4ZPXA 3SDZA 3SOPA 4F93B 3R9XA 1EFTA 4IFEA 4Q7LA 4IDHA 4N0EA 4DLSA 3B82A 1W2GA 3L0OA 3K9GA 1ZM4A 1YZGA 3FTQA 2XNSA 1VG9B 4DHEA 3QEJA 1AZTA 2G0NA 4ZKEA 4EFMA 5BN5A 4FWIB 3LXXA 1C1YA 5D3MB 5KU1A 2Q9CA 4MITA 4B74A 5EXPA 1Q44A 2Z43A 1OFUX 3I3SR 3TSZA 5JSZB 2IS2A 2IXEA 3FKQA 1ZM2A 4Q18A 5EXTA 4RZ3A 1KGDA 2FGJA 2EFGA 3EXAA 2JASA 2J41A 3RS5A 1KDTA 1V5WA 4U02A 4HAXA 5HR5A 3JVUA 3EAQA 4OK5A 3RWMB 5L3QB 4MGIR 4HAUA 5A0FA 2QG6A 2AHOA 2EW1A 4HI0E 2EFEB 1L2TA 1Z0FA 2BKUA 3NHBA 2IYVA 2ZRMA 1J99A 3OEHD 3SQXA 4DSUA 5AJYA 4B47A 3ICEA 1Z08A 4EPVA 4JLDA 5HCIA 2OXCA 2XNDA 1KSGA 4PAMA 1P3JA 1FNMA 5CM9C 3OFNA 4Q7KA 4PHFA 2Q3FA 4O3MA 4LY6A 1G3RA 4RCYA 1NRJB 2IWHA 1LB1B 2XAUA 1P9RA 4BZPA 3VMFA 1Z0KA 4RD2A 2Q21A 2CK3A 2RMKA 2GJ8A 4FI3C 4Q00A 1U0JA 5DLQC 2PZEA 3I61A 4TQ9A 1PVOA 4B6EA 2O8EA 1CR4A 2ZR0A 4NMMA 5FUYA 1WBBA 4JL5A 2XTZA 2OV2A 2JLZA 5B2ZA 5JHHB 2KE5A 1R5NA 3L0IB 1G20E 5K8UA 4C7OA 4O0MA 1CRQA 5LD2C 1SXJA 1T6NA 4JLJA 5EZ5A 1ONBA 2A7QA 3LLUA 1G5PA 4NDZA 2OLKA 3CNOA 5EXXA 3EZFA 1TX4B 3OESA 5H8WA 3UMRA 2QPTA 3TGPA 3BFKA 1YZNA 2GZAA 1EWRA 4URXR 1G8PA 3QENA 3ADDA 2D4HA 1G3UA 2XGJA 3GJ5A 1KAOA 1U8ZA 2F1IA 3HDTA 3QF4B 4KFTA 4TLBA 3ZYCA 2GZHA 2JCSA 3LW7A 1U0HC 2FPKA 3FMPB 1T4GA 1JR3D 2BM0A 3I8XA 2CNWD 2XTNA 1N6IA 2H5EA 3IBGA 4C0SA 2ZE7A 4LYJA 2PMDA 2ZI7A 4LHZA 4QL3A 1ZM9A 1G3QA 3M6AA 4YLGA 4G0NA 2VHTA 2QEQA 2TMKA 4FXPA 2ZI4A 1SVWA 1ZRHA 4OHVA 2NO0A 3AGPA
chains in the Genus database with same CATH superfamily
4HR7A 3Q40A 3PEUA 4GICA 3S8MA 5KNDA 3F47A 3PC7A 4DC9A 4JP2A 4Z8YA 3LXRA 4M22A 4ZCQA 3M4YA 4AYWA 5DNAA 4XX1A 1Y4DE 2AE2A 3M6UA 3AYZB 4EI2A 4C4TA 2RGBA 2D3TA 4TL8A 1X6VA 2L69A 1YL5A 1L6RA 3CF4G 1ULZA 4GYYA 4LJ4A 1EA5A 1UJ6A 2XB4A 1GY8A 1XD9A 3MB5A 5ECYA 4AP6A 1JJVA 4E5DA 2ZBVA 5HZMA 1TM1E 3WX0A 3DZBA 1XEWY 3KVRA 1E64A 2Q4BA 3ADKA 2VHQA 4I14A 3Q11A 1T0PA 3NM6B 1QHHA 3H1TA 1P2TA 4WLEA 5DGDA 2OQ2A 5JXWA 2W2KB 3OICA 5CEFA 3IUYA 4HP8A 4DEVA 2J9YB 4YJ3A 4C2BA 2DFKB 2WF9A 1E99A 3VC3A 3L0BA 1UDAA 5HJ5A 4FWTA 3R5TA 2WTAA 2FCAA 3OJOA 1EVJA 2IX9A 7REQA 2D7CA 2VF4X 1WL8A 1BXKA 3UTDA 4PZ9A 3ZU2A 2IPOA 1Q2UA 2H07A 4QO7A 3QF4A 1T8PA 1RQ2A 2FOLA 3AF4A 1KE2A 4EMTA 2AF4C 3MUNA 4NOKA 1JLMA 3PNBA 4HNTA 1TTHA 4ETIA 5BR7A 1Q1NA 1N2GA 4ND8A 3LV8A 4RNCA 5F2KA 1WJGA 2CMGA 3HCCA 5LIPA 2EATA 1GUZA 2OGUA 1C1DB 4P35A 3OE1A 4GD3Q 1JJFA 3DOJA 5IPFA 3HPQA 2BAGA 3T52A 2ZJAA 3F2IA 5T8KC 4W9RA 2IBMA 2ZSUA 3C8UA 2QA5A 5LFAA 2XE6A 3CKMA 3T4UA 1Y8CA 1UINA 1SZJG 2Q5QA 2WA1A 4XIYA 4AJKA 3O8DA 4N4AA 4LGMA 3IALA 3NTUA 3MJFA 4Q1CA 1DQNA 4X95A 1L7EA 4CIXA 3AEUB 4IDGA 3W9BA 2P91A 1MTOA 1P3DA 2XLCA 3L04A 1JNXX 4HVAA 4OHOA 2P9HA 4HWPA 1M5UA 3NYWA 1E2BA 4GOND 4L3VA 4TV8F 4OLBA 5IJ9A 3U7QA 3LO8A 1WU7A 2QNBA 3U0BA 4NV1A 2Z4SA 1RAIA 4OQYA 2DULA 1KDZA 3GUVA 1THMA 2IIVA 1NKSA 2J9ZB 3E9MA 3KT0A 2JHGA 4M4SA 3QLJA 4A5SA 4B0PA 4CTMA 1F5NA 4FYHA 1E3IA 1KZ9A 1V8BA 3UXHA 4OXQA 4PWYA 4EYKA 2RGAA 3SC6A 1XWIA 1R6UA 3OPMA 1YB5A 2ZB3A 4E70A 3ONWA 4JI3B 2O8CA 5CNKA 2J7KA 4I55A 5FV7A 5IYZB 1NBMD 4LVCA 3URMA 4H18A 2R85A 4LI3X 3T5PA 5JFTA 2E89A 4WCFB 1FDSA 3RLIA 3VR3D 1OH5A 2FDRA 2O2XA 1TLTA 1U7WA 4MAAA 3T35A 5GOZA 5FTKA 4OL9A 2OXRA 4ZZ1A 4CKWB 2A88A 2B7CA 2DH5A 3FTPA 4K9SA 2ON6A 5CEEA 5KTYA 4DUGA 2UZIR 4RESA 5HVNA 3NGXA 4KNVA 2ZFUA 3BMXA 4NNPA 4JX8A 4O5OA 5F1KA 2Y0EA 3ZW8A 4CM6A 5EEHA 1R66A 2C5FA 2FPLA 3ROPA 1Q7CA 1KAMA 3RUAA 4AK9A 4DLWA 4F60A 4RC9A 2CLKB 1YJ8A 1DDIA 3FCYA 1VBNA 2CUZA 2ZE6A 1L3IA 3JYOA 3UV7A 3N0WA 4CLRB 2F8LA 1Z0UA 1SG0A 3I64A 2B21A 4UC0A 3UHPA 4ACAA 2IITA 2NPIA 1QRTA 3ES9A 2VRBA 1YMVA 3F8TA 2OFFA 1NJ2A 4D9CA 1Z4KA 3BX1A 1FVHA 3AONB 2CUKA 2XRFA 4HB4A 4MX8A 4NEHB 4QUJA 3VTZA 3K6RA 1N4DA 2R47A 4PNPA 4D80A 4D8XA 1P1KA 4I81A 4RJJA 5H4GA 3RFXA 2AI2A 4JLVA 2IIBA 1RZRA 4GOKA 5EIWA 1P7ZA 1M2OA 1VLZA 1RRKA 1U0GA 3GNSA 3LVQE 4CDRA 4PO3X 5L7WA 2JJ8A 4P58A 4NQRA 3GT0A 3FFAA 2AN5A 1UIMA 3UBMA 3CRW1 2VQ3A 4WT7A 2IYAA 1GGEA 3GDGA 2PPLA 2HPZA 2KBEA 3E48A 1AGRA 5J2UF 3UPTA 1E9BA 2BMDA 4ZV7A 1QDEA 5LBTA 3PUHA 5KJEA 4AZVA 2OG2A 1FW8A 2ZYWX 1D5WA 1YMQA 3TX6A 4OA5A 3PC8A 2X8JB 2YIJA 2AQIA 2HA5A 3ZHUA 4JR2A 4P08A 2H4ZA 5A5DA 3BDIA 3F2VA 4QU9A 4R2LA 4DSTA 1W4BA 2ZI3A 3AFIA 5G2OA 5B58C 5FI3A 4HRAA 5JH7A 1ESDA 1P80A 4MYRA 1Y81A 2DLNA 4TL6A 1XAJA 2A33A 4Q02A 4MVJF 4N8SA 1JPJA 2XCOA 2FSVC 4JEMA 3VR2A 5A5FA 1G17A 1MUUA 3N6RA 4DMCA 3KYDA 1QUEA 3ND9A 4RVGA 2QBYB 5AI4A 4K7JA 1XG5A 3K0FA 2C2XA 2PZKA 3ECCA 2JFYA 5I48A 2Z5LA 2RGRA 1U63A 3H2GA 1NBAA 2ZSAA 4BEJA 2P40A 3I39X 3LUJA 3SXPA 2BI4A 2E0IA 4IMJB 2QRUA 1L5KA 4RTQA 2Y1XA 2B4KA 3V8NA 1RM5A 2WP8J 2LWIA 1EWQA 1IJFA 3F6SA 3ZR4B 2CCGA 1L4BA 1UBJS 3N8DA 2MIIA 1S9HA 2QENA 4Q3NA 3UJ8A 1VGQA 3MVEA 3V8RA 1U65A 2ZRAA 1U0EA 2AZ4A 3FHOA 2NVOA 3GLUA 3HI6A 4HUQA 1SUIA 3AV3A 5E95A 3UANA 3Q7SA 1T4MA 1WW3A 3D59A 4D4HA 5LP6A 3BH7A 1LU9A 3VX3A 5K6TA 1NW4A 4LXTA 1YKGA 1FFSA 5I5EA 3K6KA 3WYGA 2XT9A 4GPAA 2WJZB 2X2OA 1HRDA 1HE8B 1D1QA 4B3BA 1OU4A 1Q7GA 1RLMA 5AJHA 1XA4A 3PIDA 3N2NA 5ALEA 3OT5A 4KQWA 3HWSA 4JBYA 2O2YA 2DXIA 1P0IA 2X13A 4EYSA 2DTEA 4L6IA 4FU0A 1ZJ4A 4ZOCA 1QHGA 2IGTA 2MT9A 4RD4A 4YN3A 3UB2A 2IXGA 3UJ9A 4I9FA 1I01A 5I9MA 3V1YA 2HT6A 1IXSB 1E2KA 4M9SA 4IRXA 2FA9A 1Q74A 3QHPA 4RF2A 2WAYA 5BQ5A 1A7UA 3H42B 1VZ2A 2PZAA 3CJQA 5CCDA 3NAGA 4U3JA 2O1WA 3ICVA 1YU9A 4U39A 3RTEA 1N3YA 4IJKA 3QJYA 3AUAA 1HK7A 1DKNA 2JF0A 2C9YA 1TQ8A 3WHIA 3T3NA 5LVAA 3EGWA 4HXYA 4U7WA 5CA0F 1N6KA 2JGDB 4QBFA 3KAKA 3D8NA 3OBIA 3OWXA 4P5EA 4YR7A 3T1YB 4L73A 3MJCA 5B12A 1W85B 2A59A 2B0CA 1RZVA 3B60A 3G0DA 2HK6A 4HX9A 1H8HA 4B0OA 1R37A 5CD9A 3NBYC 4CM9A 1NFRA 3G6WA 2W2MA 3KR1A 1B8NA 4O2AB 1ZUHA 3AIIA 1OPRA 3K1JA 3OJ0A 3OPYI 4B4VA 5FPKA 4NY1A 3I01M 1PJSA 4ITUA 2ZBQA 4KVGA 4GE3A 1E9AA 2PSEA 1ZONA 1IPHA 4YXWA 3V48A 4B2YA 2PXAA 4GP9A 2GASA 4ZU3A 4LF5B 1AKTA 2YV2A 5ALHA 2ORED 2P1RA 3PHCA 4JKYA 1IDOA 1YV9A 5JMOA 3OQHA 4DT1A 1ORIA 5JCOA 3GO4A 2NVWA 4U2EA 3H5AA 4X85A 5BQPA 2HSJA 1EQUA 2VKQA 4MVJH 5JAPA 3EULA 3SQOA 4A4DA 1T5HX 3UBTA 2XGOA 1U28C 1NJFA 1ZPDA 1WNTA 2TS1A 5FR2A 2Z3WA 2GPSA 4OMCA 5HEKA 5LDGA 2X7HA 3IQHX 4R9UC 5AI5A 4I5EA 4IEFB 3IDFA 1U2GA 2JNWA 2ZUWA 4LOJA 4ARIA 5AW2A 1ZUIA 121PA 4PO8A 3FPFA 2C9OA 1NZDA 1SCJA 2C4VA 4A23A 4YV1A 3I1YA 1PHPA 1O97C 1R5BA 5YASA 3D3KA 5AI8A 5D7NA 4MRMB 2RGWA 4RF5A 3JWHA 1SD2A 4XX0B 3RAEC 1NVKA 4I50F 1V96A 2VJDA 1PS9A 4I36A 1B42A 5JR3A 1DTWB 1I9GA 3AF1A 5DF1A 2FUKA 4R68A 3B1WA 1KJZA 4F3YA 2DZDA 3EPPA 1ACJA 1GZ7A 5EVJA 2WILA 3H0KA 4IIJF 1YRBA 3TQHA 1U8TA 1TMOA 2WFZA 5K0BA 4L3OA 4QRDA 5AK5A 5E2AA 1NLYA 1IIRA 5SYAA 1OBOA 5CJ2A 2R751 5AJTA 2PTHA 4FYWA 4ZAZA 3RS9A 2NZ8A 1UPAA 1L7NA 2ZSFA 1U80A 5KKNB 5F7XA 3K9WA 1T1EA 4Y6PA 1IG0A 1PWYE 1TCBA 3VSBA 3DKVA 3O7MA 1AKYA 3RPEA 4K9LA 2CNDA 1ORWA 1IEWA 4P33A 2AEFA 3P0RA 3C3EA 4KYVA 4EPXA 4GR5A 2ZTMA 4A0FA 1OV6A 5EE1A 5A4AA 3C7KA 3F5DA 1L3BA 1MG0A 4LQCA 5FBQB 2HN9A 4FE4A 3VYUB 1TTQB 1YI0A 4I1YA 1I7PA 2EKQA 2P2ZA 1AG9A 3DMGA 2H63A 1XCOA 3CPJB 4RMNA 3EXG2 2GBCA 2HPAA 2PSJA 4RGYA 4I4TF 3JD1A 1JA1A 1H22A 1EP1B 1RE0A 1XDSA 3OMXA 5HFJA 4US1R 5TMEA 4A2WA 1L4MA 3AKCA 1DO0A 1GGKA 4LHWA 4YJHB 5MDHA 1A0OA 1YJQA 2WYWA 3JQAD 3H2KA 4PZPA 3L7LA 1SRRA 3R7NA 3F90A 2HH9A 3ZC3A 2IHNA 4IMPA 3RG8A 3AUYA 3W2IA 4X5OA 4H3KB 4IJWA 3KYCA 4RY0A 4E7PA 1QYIA 2WHPA 2W6NA 3D7SA 3EK2A 3W2EA 4GXRA 2ICAA 4FBMA 3ZD8A 2JLQA 3KKNA 4YJFB 2E5LB 5BVHA 4NFHA 2ODWA 5TMPA 2ZBUA 1SOAA 1FLAA 2WTXA 5I7VA 3PCXA 2PLAA 4GFDA 1HMYA 3FMGA 3LT5A 4JKOA 2B4TO 1QSGA 4TMXA 1T2AA 5KYYB 2VTBB 3AF5A 2WKSA 3CZ9A 2SNIE 1S3FA 3CSSA 3VM6A 1H2ZA 1RHJA 2JEYA 1Y8QA 3PHHA 1CB7A 2GXSA 2OZLA 1FFEA 3DDHA 3W4JA 5IXJA 1QTNA 1JHYA 4QEKA 4CUZA 4J43A 3ZZ1A 2GKOA 3FBGA 1R0KA 1JHZA 3M81A 3REQB 5KO2A 3JQ7B 1RVDA 3H1EA 4NS4A 4OY3A 5KVVA 4OCZA 2RH4A 5CT4A 2OD2A 2WMDA 4DGSA 3T9FA 1VSUA 1BHQ1 2E3JA 3EXIA 2NU7B 4KWHA 5EG5A 1SD5A 1SC3A 2PUBA 3OE7D 4QYXA 3MOIA 5EXEA 1ZESA 5CDHA 2YQZA 1FNSA 2WAOA 1V4NA 2VA8A 4W7HA 3GP8A 2O19A 2F9LA 4J16C 3ZKWB 1GSOA 1R0LA 3GHHA 1LY1A 3ZJYA 1IZ8A 1K8XB 2Y1DA 3U7FB 4BAZA 3T3PB 4KN6A 2UVQA 4N18A 1U4SA 4Q5IA 4BJ6A 1W5TA 3JQDA 3MTQA 3QKRA 3EXFA 3SQNA 1RMTA 4ARSA 1N3LA 4G1VA 1TUBB 5K3FB 5JAHA 5IH7A 3I4CA 4MSUA 1ZGBA 2WVJA 5IN4A 4YALA 4A8JC 2C84A 3G8BA 4A0QA 4EA9A 4OSPA 2DETA 1JJ7A 1X8KA 3OZEA 4RSMA 4B6QA 3AR5A 3BGDA 4O63O 3QEMB 4IRMA 2C4WA 1K8ZB 4RVFA 5CBPB 4YLEA 2O57A 3IIEA 1OWLA 2H11A 4LRQA 1DUSA 4YUVA 2VF2A 5AXDA 1K4KA 1CW2B 3RT9A 3S3TA 4BFUA 1WY7A 2C1EA 2CDRA 3FNQA 2GCOA 4CQMD 1T4CA 1FDRA 4GX0A 2H8GA 3V7NA 5KTSA 3FXAA 2XOKD 3CZAA 2I80A 1XQVA 4IFTA 3WISA 5C7OO 2HZ7A 2KB0A 3R9XB 2PT6A 2XYVA 3CEPB 3G9QA 3O8NA 2BTOA 2D06A 1KIFA 3ORFA 4JU9A 4CN9A 1E1QA 4GMFA 5ESXA 5KTMA 1M8PA 1CQIA 4HQRA 1JT2A 5F1PA 4HHEA 1T2UA 1OT5A 4O4JA 1ZSNA 2YNMA 3T4EA 1YVUA 5D1HA 4C2TA 4MW1A 4CCWA 4DLUA 3S4YA 1SY7A 4GP7A 1M72A 3CUKA 1KPGA 1M83A 1EEHA 3QPVA 3IJPA 1KS2A 4RLHA 4UBKA 1QHEA 4AECA 4G09A 4YUZA 1CHDA 3OSUA 1XCGB 4KX5A 3HYTA 1A9ZA 4JDUA 1CUSA 3U13A 3R6DA 4PN3A 1GQYA 1JKIA 3GAMA 3H9GA 2I34A 1GQ2A 3D6TB 1L7AA 4DQ0A 3JR7A 2G77B 3ABIA 3AG5A 5BW6B 4CODB 3EC7A 1FNDA 4WN9B 3KM0A 4ZGBA 1FTNA 5FBLB 3K4QA 4WNAA 2QN3A 5AH0A 3I3OA 4DR7B 4LW8A 4D46A 2JFBA 2EHDA 4MRPA 2J07A 4CIWA 1GTL1 2D74A 1P2UA 1Y1TA 2JAWA 5AJWA 4LI0A 3DVAB 4Z7JA 5EQFA 3K70D 3LO5A 4G6ZA 4KQEA 1RM3A 1FCJA 3DZHA 3VR5A 1E2HA 1K0FA 1GCGA 1KL7A 1V11B 3DTVD 2O48X 3EQZA 1P1JA 4G3XA 2YXBA 4HDAA 4P7FA 5TDHA 2P5TB 4ARBA 1YAJA 4C7BA 3CLVA 2JFPA 1ZRNA 4HKTA 4DIFA 1Z4IA 1WF3A 2QS9A 2Z2IA 4FFOA 1KORA 1O03A 2V9ZA 4PZLA 2AWOA 5T3YA 3VX4A 1KY2A 2KSQA 4G4IA 4GKBA 3NHFA 1SBTA 2ISCA 1RWXA 3HCNA 3R7BA 5AVQA 1TOAA 1YONA 1TADA 4NJMA 2O8EB 3H17A 2RGYA 1COWD 1DG3A 4R2WA 5HM6A 4F2HA 4KNYA 2HRDA 1Z47A 2PYDA 3VISA 4FB5A 1WB6A 1XXLA 1P1IA 2IU3A 2O20A 2LR0A 3AP3A 4Q39A 2Q7DA 5HQ3A 1QWSA 2IYOA 3KJXA 4HDSA 2ZIXB 3ZWOA 1P62B 1LC0A 3EVZA 1PWEA 4BCBA 3LW8A 3M49A 4RA6A 2H5IA 1C50A 2OD7A 4G97A 3R3HA 2P9EA 4PR3A 4QBGB 4R9SA 3KVNA 5CUQA 4XR9A 1K68A 3UH1A 1NVFA 2BGKA 2E4AA 3E9YA 2GSDA 1N2SA 4FHZA 2I22A 1VMDA 1XALA 1XJWA 3ND8A 1E2DA 5FA6A 1EU1A 2TRSB 5DX1A 1H1LB 2C03A 4YAGA 4DV3B 1JDTA 1ZL0A 2QTAA 3IO5A 2WQZA 4TWRA 4J03A 3EXEA 3KTFA 1NXPA 1G2PA 1J2YA 3DMYA 3W9YA 3R5KA 4GKVA 1PR4A 2QNIA 3P7MA 1DKUA 2DT8A 2IW1A 3W3AA 2BM8A 5BRJA 4IKOA 4L95C 4HNQA 2F59A 1QYCA 1E9FA 4IHQA 1MZPA 1Y9ZA 2WRZA 3N07A 4H35A 4MLCA 4O2BF 5CGZA 2ODBA 3V4OA 1QIMA 3RBAA 1IRIA 4D0LB 3O2QB 3VR4H 1K5HA 2ZK7A 2H1CA 3NV9A 2PCJA 1DBSA 3KNZA 4BGVA 4DRXA 4XDZA 3F97A 2V3WA 4BO7A 3O7WA 2FWRA 1B3RA 2HYDA 2NXJA 2YOFA 3AILA 3DEAA 4P53A 3GJ3A 4Q4AB 1L5SA 5ESRA 5AW3A 5HPYB 5HZGA 4UJ5A 1UQUA 1XNJA 3EIFA 2DM6A 4GGMX 4GI2A 4JY7A 4GRDA 4KQ1A 4QXQA 1USGA 1I32A 1JR4A 3LPCA 1M2GA 2C3UA 5CAEA 1E6CA 3FSRA 4RFLA 3V7YA 1EUQA 5MFZA 4UHFA 1M1ZA 1NMXA 1KE1A 5KPDA 1E2QA 4XUDA 5AKIA 5GM1A 2C99A 3WGMA 2OBMA 1QLWA 1G20B 2XD9A 3L5KA 1YRWA 3CLKA 4KQ9A 3GW8A 1K7XB 4R3UC 5AKEA 1SIBE 1D4OA 1VYUA 3GJSA 1QDUA 2DQKA 1FQJA 1N2XA 4ER6A 1UKBA 5K0TA 4GPIB 5CJJA 4DVJA 1K2WA 1KR5A 1JQLB 1SCNE 1PR9A 1CWUA 1SQ6A 1NJ6A 1H3NA 4B44A 4BMVA 4MAMA 3B5JA 3KUKA 3EMVA 1F2UB 2ZWMA 1UM8A 4IOKA 4UJ3A 3HK2A 4GPEA 4XB1A 3TI7A 3EOAI 5LUBA 4H4EA 3TF5A 1JS1X 4M1TA 2NSLA 3ESDA 4XLTA 4EHNA 3VO2A 5AM5A 4C6TA 5F5NA 1UT8A 3MS7A 3QVVA 4JBLA 3NPMA 4QQRA 4BASA 1E60A 2A92A 5KNBH 2H51A 5K45A 2EP8A 2V6GA 4MKRA 1OIVA 5ICGA 1Z2PX 2MCFA 4PY2A 1NQ5A 1N25A 2QN6A 2L19A 4TTRA 4MUGA 1J0DA 2XVYA 2AQHA 2MYTA 4GH5A 4LJ7A 3K72B 4RVUA 1LUAA 1N5IA 1ULBA 3HE3A 4MICA 1MOZA 1Z06A 3HQ4O 2NU8A 3WQQA 4EEZA 1DJLA 5MFPA 1NU6A 1S2IA 2YJNA 3DFIA 2FUG6 3IVGA 5FNZA 3WADA 2FSFA 5B58T 2QYTA 3O2JA 2CF6A 4ZTBA 3GMIA 4TQAA 2V5UA 5L40A 1EE9A 1US8B 4HRYA 4DNXA 3AUJB 4JLAA 3CRQA 2XIJA 3OG9A 4CE6A 1OI7A 5HKKA 4MR8A 3NBMA 3T0IA 1Z5NA 1BU8A 3ZI0A 4G36A 4MMZB 3I92A 3T06B 4DR4B 2ODQA 1SB8A 2XQGA 1R8XA 2IIQA 2JDID 1Z6QA 2G76A 2Q2QA 3D4LA 4HGOA 5DDIP 5H9VA 3U44B 3HP7A 1D2EA 4ER5A 3KZ1E 1DRWA 5LDDC 3GPBA 3R0VA 3ENVA 1VG0B 2HCJB 4KPGA 4IHAA 2W48A 5G53C 2ZJ8A 2C2ZA 1AD2A 4O4LB 1U0NA 3MWJA 1NVVR 5T41A 4LRXA 3L6CA 1QMGA 3Q2KA 1E1KA 3OCUA 5EWMB 2VK2A 2FW8A 3IESA 4MPJA 3R41A 3JQAB 5U9CA 4DM7A 3ZZMA 1GRVA 3HB0A 1P2VA 4KAXA 4A6EA 1ODFA 2FUNB 4CT4B 1R9GA 2FMTA 2QY6A 2OPBA 3HVKA 3ABSB 3DWIA 4M0FA 4RORA 2MSDB 1VP9A 4BPBA 2O8DA 1H2AS 1QFMA 2IZ5A 3NTXA 3AESA 3E7PA 2XB9A 2QTTA 4N40A 2EJUA 4OQXA 5HKLA 3ROFA 1NXWA 2P65A 1NJSA 1NX6A 1U31A 2H85A 1U3WA 1VMEA 1EE2A 2WHXA 1G5RA 1GSHA 4JUDX 4G67A 1AKWA 3X1KA 3EGCA 4FHGA 5CVUA 5J4KA 1VG1A 2PR2A 1L7PA 2ZGVA 3HFGA 5E4TA 3AEQB 4DBLC 4PLGA 5K03A 5KYXB 2ZJZA 4X1YB 2C8LA 3H1GA 3O8QB 3R6TA 3BL6A 4CMHA 3FHLA 4K9DA 3WA7A 2C07A 1MH1A 3EFBA 2ZAIA 1MRNA 4B81A 1LI4A 3CIOA 1RYFA 2FE4A 3FUTA 3SDSA 2QR3A 5KVQA 3TEMA 2HQSA 2QVLA 5FOWA 5IXYA 2XMRA 5L8VA 2VP2A 1HETA 2UXCB 4YREA 3FLEA 5FTLA 2WJ6A 4OQNA 1KP3A 1U8AA 3GJ6A 1U7OA 1L5QA 4EHKA 1ESMA 1EQAA 5DM60 2WU3A 3KWFA 4YCJA 4F5ZA 3EPLA 1HNWB 2H6EA 1TPYA 1YZFA 4Q9LA 2GRJA 4Q12A 5TEVA 1JSRA 5JNSA 3DHWC 2HJ9A 1VSTA 4A91A 5JUWA 4Z5XA 5K6AC 2UUBB 3ISJA 3K16A 5DTRA 1MXFA 1IZ0A 2XYRA 5B3AA 4LJLA 1FVXA 3KD2A 2A9PA 4H0CA 1EFAA 3E2IA 4M0CA 1JTFA 2VXOA 1RXUA 4EI9A 5JLJA 1UKCA 5M5BA 1EXDA 3B9RA 1ATIA 3C3XA 2VZ8A 2KYRA 1ZKMA 3NT5A 1TB4A 1XZLA 1HL7A 4HYQA 4LZPA 1QE0A 2A0KA 2C4HA 3DL0A 4KVFA 5EMLA 3ZVNA 2DOKA 4MB0A 4OQLA 5KSOA 1B23P 2ECOA 3R0QA 2JGLA 2OCPA 2PVSA 3G2MA 2HIAA 4KTTE 4WOKA 3D1LA 4YPOA 4GLFA 5AYVA 4EARA 4R2JA 2DJIA 1GPJA 3HJBA 1CS0B 2D2FA 2ZBRA 4CQMB 1I4OA 3O8OA 3FCAA 4IP0A 1CUEA 4YONB 3WGJA 4DR6B 1H5UA 2B5VA 5C31A 5CPBA 4E51A 3BC1A 1NRIA 2Q62A 2VN8A 4FGUA 4DUYB 3BJIC 3S2ZA 1KJ8A 3TECE 2X0FA 1ZX1A 3QWBA 3T38A 1CIPA 2EKDA 5EMHA 4LDJA 3U7HB 1YGPA 2N75A 2NADA 2P0EA 2IH4A 1CIVA 1UMDB 4IXDA 1T26A 2ZR8A 5G3YA 3WYCA 2WTBA 1A77A 3ISVA 3D3WB 4LOAA 1C14A 3CRVA 3FRJA 3FE2A 3JTEA 4ZAYA 3X2SA 3QXXA 4NU0A 2Y93A 3ESBA 3P20A 2P2NA 3HJCA 3I2IA 3VH2A 1LI7A 1EGQA 2JFGA 3QX9A 3TKLA 4IX1A 1U5AA 4KDFA 2WICA 3OPQA 5FAXA 1ZMOA 3S29A 2DHEA 1KMNA 2D00A 5BWMA 1OLUB 3SKXA 1MEEA 3CA8A 3SSNA 4RXUA 3ZBQA 4TL9A 3R09A 1JEQB 4TTAA 3JWGA 1HQKA 1VKHA 4PYQA 1XNHA 3LT2A 2QNRA 1JR6A 3WLSA 1FRNA 4GIBA 1KNXA 1ISJA 2ZJ6A 3CO5A 3A2MA 4H0FA 4RQAA 2VC2B 1NIPA 2XVAA 3P4XA 3LDUA 4WJLA 4H16A 1XF9A 2IU4A 4HLUA 2WM3A 3A3PA 4RADA 3R6LA 4CDGA 5TT1A 4HYEA 2PVCA 5H9WA 2VO1A 4GZMA 3DHEA 4IILA 3K70B 4R7ZA 2JFNA 5LOVB 2F90A 4C1BA 2O2CA 1I5EA 2QAIA 1XTSA 1QORA 3L4BA 4PCAA 4Z4EA 1Y48E 3L92A 4Y2QA 4YJ3F 2WIBA 3SIXA 5AVUA 4E14A 5EJ7A 1NPTO 4D41A 3ZG6A 5GVSA 3OEWA 4C7KA 1I2CA 2OESA 3CN9A 4K81B 3L2OB 4LJ9A 3TOVA 2PZLA 2V7XA 1CQPA 2YASA 2HUNA 3EFEA 4L5JA 3M82A 3ID6C 5ARCA 1RWNA 2DUJA 3QM1A 4OLJA 1NI4A 3BUSA 1SXJD 2V7PA 4TT3A 4U00A 2QVXX 3KRTA 4DTCA 2BV3A 4QTTB 5LL6P 1XT6A 1Z5OA 2GAAA 1C3JA 4X97A 5AK4A 4NECA 5LSAA 3Q7EA 4W63A 3VOSA 1LPPA 3OA0A 4E5UA 2NNWB 2WJPA 1Z6YA 5KQPA 5DXAA 2FVYA 3AEZA 3BERA 3AP2A 3R5SA 4GRIA 2R8BA 2PIAA 4YDSA 1UPUA 1ZIPA 3FIUA 3DL7A 1ST3A 1X1EA 4URHA 4WVFA 2B1QA 3RK0A 4IICA 4YRPA 1ZLYA 2OBYA 1XKQA 4PSUA 1WUHS 3I45A 2Z95A 1KNQA 3NXKA 4C0LA 3QEOA 2XUJA 2QI9C 2QTFA 1KPHA 2ONCA 1XTJA 1IWPB 1WB4A 2D1YA 1EDBA 3FW1A 1YC2A 2PJUA 3CINA 1XTKA 1GG5A 2XX3A 3F7TA 4NJEB 3VPDA 4DIKA 4E4RA 2I1LA 3O1JC 1WDWB 3PEVA 3VU1A 4NPHA 1JB1A 4CV0A 1DWUA 1HYEA 4D5GA 3UK6A 3SBEA 5A2GA 2MTBA 1V2HE 1L5FA 4PYLA 4UBNA 1TUGA 3NWJA 1YBAA 3BQNB 3OURA 1CETA 2IYZA 2P35A 4KK3A 4B9EA 4DABA 3DQZA 4EHAA 2FW6A 2Y3IA 1WOMA 4P4SA 4EKGA 1NY6A 221PA 3TTVA 5LQRA 1CQZA 4JEIA 3WYNA 1CKEA 4P0TA 5DRYA 4I55F 2CFSA 2NIPA 3ANXA 4C4RA 1IEQA 3GCDA 3GROA 1NY5A 2CT8A 2A9FA 3EYAA 3DOOA 3LC2O 2GM5A 4OEHA 5B7QA 1CDDA 1BTOA 2ID8A 3AW9A 4HVCA 2F64A 3TZQA 1OFHA 3I83A 2CNNA 5DTJA 4Y9DA 1OD6A 2Y1OA 3B5EA 2JAOA 4HATA 4RJIA 5JCJA 5K0SA 3TQOA 5EZYB 1T5OA 2BCGY 3C3JA 1QRAA 6Q21A 2CE2X 2Q46A 3PDCA 4YCLA 1JR2A 2GARA 2OFWA 1HEIA 2FFRA 3QY0A 4YRNA 1ZDMA 3O8CA 4K0KB 3IQZA 4WGGA 4DILA 1CY2A 4C4YA 1V3QE 1W0KD 3OCCA 4KEAA 5LZ8A 4DIUA 5D5QA 2J6HA 1K4MA 1TVKB 1VDMA 4MWCA 5H02A 4CUKA 2FEMA 3FZEA 3P9RA 2QW0X 3Q3JB 4IGFA 1EVQA 4MQEB 2HLDD 2Z30A 4KE9A 1HPLA 2BEVA 4Q7EA 4YFVA 2IZ7A 3VDNB 3R7DA 2WIDA 1H4QA 4D3XA 4XSGA 4L8LA 3VYTB 3ML1A 1G21E 1WXEA 3NB0A 2ZDHA 4US2R 1N1DA 4DTIA 4KR6A 3U4CA 4QG3A 1AV6A 2Q5EA 5JPCA 2CE7A 1E1LA 4IEEA 5DCYA 4CG3A 5CEJA 3ABRB 3DZFA 3CSUA 5F21A 3VU9A 3WZMA 1GG2A 2WF7A 2I2BA 4FEAA 2XXAA 4KHZA 2L42A 3PPIA 5IJ0B 3WLQA 3NONA 2B82A 2I7TA 3CEAA 2E5WA 3ENWA 1JVSA 3I0NA 3PHIA 3OOJA 3BIJA 1QU3A 5BYKA 4JBNA 4CVNA 4QVKA 4YAOA 1WUJS 1XDWA 4QT0A 1Z5ZA 1FUIA 1ZCZA 4A0RA 1AO0A 5JH7F 3A4NA 3UEOA 3D2AA 2ZUCA 3B1XA 5EKXA 5CW1A 3WE7A 2ZU0C 2OMEA 2H8KA 4KVAA 5GP1A 4C21A 3ND6A 1H2FA 4DQKA 2FJ0A 2QTHA 3O93A 3E7FA 4FR2A 1II9A 3R5XA 3ZV7A 2I4TA 1YD7A 3H8VA 1N57A 4MVJM 1N9GA 1IZYA 4RIEA 4DNQA 4GLJA 1GRCA 5DK6A 2NP6A 5ETJA 1FMLA 2X8BA 2VFAA 4L4UA 1C9YA 4WKPA 2FUG1 5KCZA 4WZZA 2O8VA 3PK0A 5KHLB 1XMOB 3D0RA 4G0VA 1D03A 3MC1A 3H7IA 5C1PA 1QHNA 4CWAA 4MYUA 3LQRA 4RTOA 1NBOA 2RI1A 1E5DA 3D6MA 3KCNA 4P3NA 3FM9A 2B36A 1XCPA 3PDIA 4V0OA 4BO8A 1JHRA 3WDMA 2REQA 4TLAA 1KVQA 1TRKA 2H0QA 3QVGA 3K0SA 3L0SA 3JD2A 1NA5A 4EBFA 1KO1A 5ISMA 4RDHA 1HKUA 1ST2A 1UBUS 5LP6F 3R3SA 3WGQA 2CN1A 4B3RB 1HZZC 4C0AC 1AK2A 1Z68A 3I9JA 1HNZB 5IUNC 2HMWA 4YAJA 5MN4A 4ND6A 4F84A 1PG5A 4E46A 1T0UA 1RXWA 2OYCA 1NYRA 3INNA 3HYNA 4N3CA 2MYNA 3SX0A 1GL9B 1X19A 3D4BA 1LPBB 1UH5A 1HDGO 2RCNA 3KQUA 3K31A 1CXZA 1ESZA 1TXGA 3A6EA 1USUA 4OHFA 4QPPA 5GMOA 4G5RA 4V0SA 1NRWA 3GV0A 1EFVA 3V4ZA 3DEIA 4W4TA 1JDBB 3RWBA 3ZBUA 2RONA 3ZXUB 2WZDA 4ALKA 4EPRA 5JXGA 1TU0A 2QN1A 4L3WA 1YZQA 2CDAA 5FWYA 4Z99A 3UPDA 4IXWA 2XNJA 1FDUA 3RVKA 4AZ0A 2BMEA 2Y1WA 1RPJA 3NHYA 4FHFA 2NMVA 1OHHD 2BL4A 4LWPA 3QQPA 4PANA 1DBRA 4AX4A 1IDN1 3Q9SA 4EVSA 1SC4A 2A1TS 1UC8A 4Q66C 2AFVA 4XGNA 5KTTA 5L3VA 3E4DA 3FWZA 1ICEA 4NZYA 4AJEA 3H3JA 3K0CC 3HB7A 4Z0TA 4FYJA 1WZCA 1P7VA 3O21A 4YA6A 4ZAWA 2PLRA 3G7NA 3JD0A 1CZOA 4OJYA 5TLSA 3OZIA 1I51A 3KSDO 4J3JA 2P78A 2PT7A 5CLHA 5DPMA 1TJ5A 4JMLA 1QF7A 1I6WA 2EFDB 3V7UA 1WG8A 2WG1A 3K9BA 3HO6A 2ZJ1A 2XDAA 4QUBA 3DWGA 2V7QA 2PJRA 3FWKA 4HDCA 2NO5A 2D1QA 4MARA 5ADUS 3U4GA 2XWPA 4IFIA 4IR7A 3MJTA 1CZNA 4Q9KA 3SSOA 3TMAA 4HPJB 4FJ2A 5E7IA 2DHCA 4L5IA 5CDFE 1TK2A 1X80A 4KXLA 4DBVO 3LDFA 1QCCA 3WLIA 2FSGA 4NFYA 5EXSA 3MF4A 4ZVRA 4J7AA 3ZCSA 1VGRA 2WD8A 3E1KA 3IHLA 2GZSA 4IYRA 4PC7A 4BBPA 1K4YA 3MA0A 1SQ5A 5HJ7A 1KRHA 3OJWA 4PHHA 4RTJA 3J80A 4B46A 4BATA 5HA5A 1QH1A 3LQYA 1TEVA 1RPAA 2AK3A 3DAFA 3EIWA 4HTAA 4JASB 2HSGA 2O3JA 4IJQA 4NZ9A 1XZFA 4UUQA 1JX6A 4IMRA 2GM9A 3UMMA 3AIKA 2C20A 1VZ3A 2H1SA 2P4HX 1JAIA 2X7XA 3K1YA 4XPZA 2B69A 4KR9A 1H1TA 1G18A 3KELA 2JZNA 2ZRKA 4CM8B 4D92A 2I1WA 2ZRJA 4OJQA 4MLZA 3NP7A 3MYRA 3A14A 2F4NA 2QX7A 4IVRA 4E3ZA 3HFSA 1KI7A 1BGVA 4DDUA 2B30A 1ULAA 3M6LA 4KN5A 3BXEA 5GONB 3HCAA 4EB0A 1Z63A 2Z58A 3KEQA 4LCJA 3LOQA 3LJKA 1CJVC 3L7IA 3PG5A 1OBVA 2OL4A 4AG3A 4KSCA 3W77A 4B71A 1PX2A 3O9VA 4BWYA 4TLEA 3IUEA 4QG7A 4I19A 2XGGA 2Q99A 3CV3A 3DXYA 4YRIA 2WWYA 1U7ZA 2LKDA 1L5NA 1R8JA 3WGVA 3WIUA 4CL8A 1PK7A 4YJGA 2AG6A 1O54A 2JCGA 3H9EO 1NN3A 3EODA 4FM9A 2PY6A 3IODA 2H52A 1POWA 5KS2A 3FFBA 2C59A 2FOIA 4R9RA 4R54A 5EE0A 2TSYB 3K2BA 2H1WA 5ECGC 1FJGB 4Q1EA 4TL7A 5I7EA 1XPRA 2VJOA 1L4NA 3BD8A 3INYA 2O4UX 4WKNA 9ABPA 3C2QA 3QUSA 1UKEA 3EHEA 4S04A 1SK8A 4O4IF 1W49A 4JD5A 5DYGA 4X20A 2VP3A 1RU3A 1UPFA 5IUKC 3S0JA 1RC8A 2WZBA 3EZ2A 3FPKA 4NYJR 1ZJZA 4II2A 2FEXA 2FPIA 5CDFA 1XP8A 4H1VA 3OBBA 3W5IA 2YKGA 4WKGA 2BFPA 3R3ZA 4RS3A 5JSQA 5FLYA 4M37A 2GX6A 3GLHE