2CLCX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gtp (2)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotide-binding protein
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2clcX00
3QI2A 5A5GA 2YKGA 1KI8A 2ZI5A 2QPAA 3E1SA 3FDIA 1G8GA 1GL9B 1UJ2A 1CR2A 1JI0A 2GNOA 2A5FA 4KFUA 2PLRA 1UFQA 2FSGA 4DJTA 1UDWA 3IQWA 4MA4A 5KYKA 2Z6VA 1G8PA 3IIMA 4NCKA 3LX5A 3OEHD 3BFVA 1OKKA 2HJVA 1D2NA 3CZPA 3IUYA 3QVUA 3C4JA 3RVBA 4CDGA 4MYUA 4Q4LA 5TMPA 1GTVA 4WA7A 1ZP6A 4KJZA 4GT1A 4AKGA 1MO6A 3NEJA 2H16A 2WWIA 4W5JA 5G41A 3LD9A 1E0SA 1SULA 4GP6A 5CK4A 5L3QA 5KSPA 3ZJYA 4FCWA 2QE7A 1LFDB 3QQ5A 1KI3A 1N3BA 4PO9A 2NO1A 5KDLA 2A5YB 2KJQA 2PZGA 4PANA 4RCYA 2FGKA 4BEJA 3BFKA 1N5IA 3MGCA 1GOTA 1KSJA 1X8KA 3JZAA 3U3KA 3CR8A 3RANA 3W3AA 2XOKD 1SVMA 3BC1A 4PHTA 1J7KA 3UMRA 1XEFA 4W7SA 5CM9C 2CHGA 2G0TA 1LB1B 2G1KA 4AG5A 1XF9A 3KFVA 3NHAA 2IT1A 3U4QA 5TY0A 5JZVA 1GKUB 4QRHA 1R0YA 3U6KA 2JJ2D 2KWIA 3A4MA 3K0AA 5CIQA 5E7IA 3NC1C 4Z8XA 1W47A 3UPUA 1W1WA 2D4HA 1GNQA 2P0EA 1GKYA 4RFVA 2FG5A 4P3YA 4EJSC 3AF1A 1Z2CA 4HB3A 2QAJA 1XFAA 2ERYA 4N0DA 4I1VA 2WOJA 2GBLA 1DVRA 1ZM2A 1I4TD 2XJ4A 1CKEA 3KTAA 5FTKA 2PMKA 4HAZA 4PPQA 4M1KA 3B9QA 1S0UA 3NHBA 1QHSA 1N6HA 3M6AA 2ZRJA 3ZZ0A 2CMKA 1CTQA 1NKTA 4QC2A 3JVUA 4S35A 2DWQA 4TYWA 1PV4A 2GDJA 5JBQA 2BKUA 4DDTA 3R9IA 3ADKA 3QIAA 4KV9A 4BFYA 4YMUA 3FB4A 4GI7A 4Z1MD 3IEVA 4JT2A 2ZRFA 1UBFA 1V43A 5DNYB 3IKJA 4LBWA 2XZPA 4HLCA 3A1SA 4BFXA 1FP7A 1M7GA 5LB2A 3RWMB 5E3HA 1I2MA 1VECA 2FPKA 2X2FA 1GRNA 5KOYA 2XTNA 4ILEA 4DSOA 3BH7A 3T34A 4BLPA 1N6NA 2HXSA 1Z6YA 4NP6A 1MR3F 2OLKA 3KJIA 3T06B 2ZIAA 1G7SA 4PHGA 4DIDA 5C4MA 1QVRA 2GVDC 4HSEA 4PSAA 1X3SA 3SQXA 1RRPA 4B2IA 3SJAA 3LVQE 2PEYA 4EPWA 2H8KA 1ZAKA 4TZ6A 4HZUB 5JS7A 1M34E 2IYXA 121PA 2HCBA 4QHTA 1DAGA 5KDDA 5DE3A 1QHXA 3P4YA 3LW8A 1G7RA 1SKYB 1XEXB 2Z5FA 4ON9A 3QF7A 5G40A 1G6HA 3GJ0A 2RGNC 1W4RA 4EKDA 5KSZA 2GRJA 4W5WA 4X8MA 2QN6A 4E07A 3I61A 2QAGA 4PZYA 2ZUDA 4Q7JB 3KKOA 3P4XA 3A8TA 3WP0A 4DIEA 1EFUA 1Z22A 2F43B 3BRWD 3CWQA 3M0EA 3DPUA 1CLUA 2WMOB 2F3TA 4P31A 4BFVA 4EUNA 4DCUA 1XBTA 3JVVA 4HLUA 4TSFD 1VHLA 3IGFA 2QMHA 3DZDA 3QXCA 2WWWA 3CW2A 2WKRA 3BB1A 4P33A 4RZ2A 5LDDC 1RKBA 3TKLA 2Q9BA 1CJVC 4HUTA 1Z83A 5P21A 4JIMA 3CBQA 2ODWA 2PCLA 4A2PA 1NMXA 3BK7A 1FX0B 4R7ZA 1CR1A 3KXLA 3HYRA 2VPPA 3ZVLA 4MKHA 4TT3A 1RRCA 1R5BA 5AUNB 2JLRA 1QBKC 5FUWA 3WYFA 2PLFA 1H8ED 1X86B 4XH9B 3FFAA 1E69A 2WWXA 3W6NA 1SVLA 3OHMA 4A2QA 1TAGA 4A0FA 3BIFA 4Q7KA 2ZRHA 3VKHA 3QBTA 4NTZA 4S2EA 1KO4A 2XEXA 2QSZA 1T4GA 3FMIA 3TW8B 3QKRA 3A58B 1AQYA 3B1WA 1XTSA 3Q9LA 2UKDA 3IPXA 3CRW1 2DFTA 4FCTA 1MKYA 3MWYW 1CS4C 2ZJBA 4XD7D 2P6RA 4QJ5A 2VIIA 2C95A 2HT1A 2QT1A 4M21A 2RGXA 4IKEA 4RD3A 1T6NA 1E2KA 3SYNA 2VLIA 4PPNA 4UJ3A 4DLSA 3FFBA 2FH5B 4WIAA 5DH9A 2EU8A 4G5QA 2VYFA 1PUIA 3SZRA 4BFZA 1EXMA 1ANKA 3I92A 3QNUA 5EE5B 2QSYA 4BLOA 1N6KA 1KDTA 3ZYCA 3KQKA 1KK2A 3B82A 4OI2A 5L8VA 2C03A 3H2YA 3AVWA 2VRWA 1X6VA 5K8LA 2FFBA 3QE0A 4AYTA 4DSNA 2X8AA 1W7AA 4QBHA 2ZJZA 3N2IA 1UBCA 3SI7A 5CYOA 1BMFA 3LBIA 1E94E 2F9LA 1Q57A 3ZQ6A 5GJWC 2OFOA 3K0CC 4LZZA 4CEIA 4QM6A 4PQYA 5F2EA 3T35A 2GXAA 4Z51A 4JLNA 4CT4B 1XD2A 4F93B 1Z08A 2YZ2A 2ZVQX 3AF3A 3TNFA 4BLTA 4L8GA 2J5XA 1Q3TA 2CNWA 4XWKA 1D9XA 3T5GA 1DEKA 4HATA 2QAGB 1D5CA 1YR8A 3EPLA 5FPTA 3MRSA 3L8YA 4HI0E 1L4YA 4LJ6A 1A1VA 5DSZA 4DKXA 2D2EA 4U5XA 1HY3A 3U6BA 2R6AA 2JIZA 4I4LA 4TQ9A 5DLQC 3CX7A 2NPIA 4Q4HB 4KBFA 3BWDD 2QROA 1OW3B 3VR3A 1Z8FA 3AVTA 3ND8A 1VCIA 3IO5A 3SNHA 1R5OA 2Z0MA 3IQXA 3OIYA 5FOSA 3SE0A 3ZS8A 3GLGE 5IDVA 4HAWA 1AS0A 1E2IA 1KAOA 4L9SA 1P73A 3SS8A 2CHVA 1T3SA 1E9AA 1W2GA 2RGGA 4BGDA 5TARA 4A4DA 2IUTA 3OFNA 2BKEA 3P27A 1OIXA 4DLWA 3NG1A 4TMZA 4IVQA 1OE0A 1OF1A 3FWYA 4C0BA 3VKWA 3IBGA 4L5BA 2OESA 2B8WA 5EUQB 1U99A 1L7VC 5FOXA 2JLQA 3TSWA 3THYA 4MRNA 2FFHA 2BMDA 2EWVA 4LC0A 3LNCA 4DSTA 4F4IA 4Q9LA 3W8NA 1RVDA 3LBHA 1OKKD 1CF4A 4URZR 4LHYA 3A4LA 3DM9B 3AGPA 4IRUB 5CJ2A 4EIWA 1G7TA 2ZRBA 1PLJA 4P0TA 4CVNA 3VQTA 2OILA 3DOEA 3E70C 1G18A 5J5CA 2VP9A 5TXGA 5JWRA 3Q3JB 1G4UR 4DUGA 2FV8A 2FGJA 4F38A 1LS1A 3DHWC 4IEEA 3GD7A 3TVDA 4LRWA 1KK3A 3KDSE 2B7CA 4LUCA 1NF3A 2BEKA 2ZSEA 3EZ6A 2V7QD 2Z4SA 1TQDA 1LNZA 2QE7D 5AUOB 2UZ3A 4PXAA 5KHOC 1G41A 1S4QA 2VF8A 1GNRA 2EQBA 2IUSA 1MRNA 3W90A 3EZ2A 3B1XA 4KLZA 4DHEA 3VAAA 3CR7A 2GF0A 1NBMD 1L2TA 1ZM3A 3QBVA 5JLJA 1G291 3TAUA 2FA9A 2LKCA 4CEIB 1N25A 2QGNA 3MWLA 1XMIA 2FF7A 1V5WA 2ZYUX 4Q9JA 4JYBA 4FMCB 4CGZA 1E2JA 3ZZTA 3THWB 3RS0A 3U3MA 3ETLA 4B32A 1NLYA 3OEEA 3BAFA 4V03A 2W6JD 4RCZA 1E0KA 4RZUA 3TR5A 2QT0A 3O8BA 1WCV1 1NVUQ 2FZLA 4M1SA 5LBIA 4R71A 4IOJA 1U8YA 2C96A 5E7JA 1MO4A 1FTNA 3L0SA 3OIVA 4M1YA 2ZM5A 4TTQA 3DDCA 4PX9A 5EUMA 3AF2A 3B8HA 5FUVA 1NNEA 1U8AA 2ZVPX 1OXXK 4LBZA 1L4UA 3BXZA 1KK0A 2GJ9A 4M0LA 1JXOA 4N3NA 2VO1A 5L3RA 2RB4A 5FPSA 1G3QA 1K6MA 4GZLA 1N2CE 4BZPA 1BKDR 4FMCF 1XTRA 2RHDA 4EPVA 1OFHA 2Q21A 1EX6A 2ONJA 4B76A 2WWYA 1J8MF 3W8RA 1NN3A 1SVOA 4OQNA 4Q03A 5EZ5A 1AQUA 4Q4JA 5CDFE 4WW0A 1KI6A 1WE2A 1YZUA 2XX3A 4MYTA 1Z5ZA 3ASZA 2FU5C 5B2ZA 1KMQA 3THYB 3LLUA 4UKDA 3TBKA 1ZNWA 4CRWB 4LGMA 4X8HA 3PEUA 2QMEA 4UXJA 4EAQA 4Q5IA 3IHLA 5JHHB 2QBYA 4Q9IA 3AP3A 2IWHA 4PSKA 2VSXA 2FSFA 1ZMXA 4G5SA 821PA 1AGPA 3K53A 1XTQA 4KCGA 4L15A 5HTKA 2IWRA 5HPYB 2QY9A 2X1VA 3LDAA 4MYHA 4QGFA 4A8JA 1US8B 4O2RA 1E98A 2JJ1A 5JS8A 1OHHA 3QXJA 1X1SA 4PR0A 4JVMA 1MOZA 1W0JA 4PQRA 5FPHA 3RWOA 2WWFA 4LK2A 3B60A 3QY0A 3R8CA 2BMFA 2WSSA 3GLGA 5TVKA 3GLIE 4IFBA 1IN7A 1Z0JA 4KBGA 3EW9A 1K5DA 2CE7A 1P2TA 1OH8A 3N2EA 3TW4A 3F5FA 3QSYA 1D2MA 4PC3A 4RKEA 5K8TA 5KNBA 4OYHA 3WBJA 4ACBA 1Z3IX 2NQ2C 1KO5A 4US1R 3VR1A 2JLVA 2FJUA 2ZPTX 2JEOA 1EWRA 1P75A 3WNCA 4ZIRA 3L0OA 3Q8XB 1M7BA 3TUIC 4JLJA 1ZNYA 1FQKA 1ZM4A 4LJ9A 5E4FA 4IDHA 4V0OA 5FBVB 5C4GB 3V4FA 4ACAA 4BECA 1F3OA 1I4DD 3UANA 2BJWA 2ZI3A 5FTJA 4MH0R 2EWWA 1ZU5A 1RJ9A 1IY0A 1KZGB 4MRSA 2EVWX 1M7HA 1SXJC 5BN3A 1XDBA 2Y8EA 1S9DA 2JLWA 3LQQA 5SZHB 4PC6A 3G82C 4TLBA 3W6PA 4IVRA 3VR4A 4M9QA 1ZC3A 3ZVMA 4TTPA 1KTVA 4Q1BA 1R0XA 1RE0A 5FPKA 1Z6XA 2DWOA 1P9WA 3S1AB 5EXSA 2X2EA 4D82A 1OYYA 1E0AA 1ELOA 4O2LA 3UMFA 2CXXA 1G8FA 4WXRA 2A5GA 4DLTA 3SBEA 1Z2AA 1HA3A 2W0SA 4DWJA 1K5GA 1TEVA 4QGAA 4D80A 1UF9A 2AWOA 2BOVA 3LVRE 2F1IA 4Q4JB 3C5HA 1KI6B 3QG1A 4B75A 4WZAE 3SEAA 1TU3A 3DL0A 3CB4A 3A6PC 2CJWA 2AK3A 3FKSA 3HR7A 3IBYA 3L0IB 4ZO4A 2CLCX 2JLSA 2QBYB 5BN5A 4Q1EA 3AUXA 2WOOA 2R8RA 1KSFX 2YWGA 3AF0A 4MKFA 1TUEA 4AIIA 2VP0A 1HUQA 3BB3A 4F7WA 1W5SA 4XTCS 1R5NA 2IA5A 2GZHA 2DR3A 1TPZA 1ZCAA 2ZUCA 4A8JB 1Z47A 3WP1B 2CBZA 3IILA 1G4AE 2G6BA 1QRAA 3FE2A 1RIFA 1BMFD 2HF8A 2ZQ5A 3AVQA 2DB3A 4UNRA 1E1QA 5CYPA 3K1JA 2ZSAA 2NO9A 4CYMA 4GNKA 4NL4H 3TLXA 3GLGB 3X1YA 2ZSFA 2GEDA 4R2HA 2QP9X 2NO7A 3PCRB 4KI0A 2IEYA 3NH9A 3PUWA 4G5OA 3DM5A 4YMVA 5FH9A 5AUPB 3MSXA 3I73A 2YHSA 5K8UA 1DAFA 2DCUA 4IOKA 1FW6A 2REOA 2CL7X 5LD2B 4QOSA 3PVSA 2GXUA 3NC0C 1KJYA 4ZIRB 1CBUA 4XWAA 5A0FA 3E2IA 1XXHE 2JGNA 2JIZD 3GFOA 4MRPA 5DYGA 3MMPA 3LFUA 4C2TA 3EPJA 2ANCA 3I3SR 1E2FA 1G3UA 1KNXA 1E9EA 2F1RA 3CRMA 2R44A 3ZZUA 1NVVQ 2X77A 5F9HA 2QRNA 1RZ3A 1RJ9B 4URUR 4QM7A 4A6XA 2RGAA 1UBEA 1JXMA 1JQJC 3HPQA 3PJRA 2IF2A 4II7A 4D4MA 5BWMA 3NDBB 1E0JA 3RAPR 4V0KA 3T5DA 1VHTA 5AWFC 1KO1A 2W2TA 5FOWA 5BXQC 4DCNA 2O0KA 4ARZB 2E9SA 3OFND 4DLUA 5EE1A 1KJWA 2OBNA 2H17A 3IHWA 3NXSA 1E2GA 1H65A 2ZRDA 3H4MA 3PEVA 3GLIA 4V0LA 2AD1A 3MD0A 2J59A 2IW3A 1FMJA 1U9IC 2EFGA 2MSDB 1U94A 4B47A 4CEHA 3R20A 1ESMA 1OXVA 1AZSC 4M1MA 4AD8A 5KU1A 1ZW6A 2CHQA 3EC1A 3FPAA 3U61B 4LHXA 3PQCA 1LVGA 3MG9A 5GJBA 1TL7C 3LW7A 1NIJA 2WJGA 3B1ZA 3ECCA 3LAWA 1DE0A 4OQXA 1NRJB 3W5JA 1SVSA 2ZR0A 4WZBE 5GJCA 1P5ZB 3UATA 4B35A 2XGJA 3E5HA 3GJ7A 5JEEA 1FQJA 2IYVA 3GJ5A 4D81A 4TYYA 3LXXA 1YE8A 4ZCIA 3DVLA 3IIKA 2WSMA 3AGQA 4FIDA 5FBQB 4AWXA 2XXAB 1GITA 4OJQA 4B34A 3Q5DA 1HV8A 3BS4A 1CU1A 1IN5A 2RCNA 4LPSA 3EARA 1W4AA 1QG2A 3KZ1E 3PIRA 3EWSA 5EE9A 4JJKA 3R7WB 5KPJA 3LQRA 4LCBA 2XSZA 5DN6A 3FTQA 3Q5EA 4PZLA 2IF0A 3X1DA 1E2PA 3L2OB 2AXNA 2ATXA 3HR8A 1Y63A 2EFCB 3CNOA 1NY6A 2BBWA 1YU9A 3CF0A 3W3ZB 5J4HA 2IXGA 4QG7A 2CK3D 2ZRLA 4B43A 4WZ6A 4LJ5A 2XB4A 1MT0A 4JL8A 3WBKA 2ZS7A 3VFDA 2ORVA 3SHWA 2P65A 3OEED 2NO6A 4V02A 3I62A 2VSFA 3C16C 2PJRA 3SDZA 4PHFA 1ZVQA 1VYVA 4LC1A 4BASA 1JECA 3X1WA 1N6RA 4HZUA 1XTKA 5EXXA 2UZIR 1NG9A 4LJAA 1JAIA 1ZU4A 1VPLA 1B23P 1UADA 4I1SA 4M8NE 2C77A 3AKYA 4KLNA 3SR0A 1XEXA 3HJNA 2GJAA 2ZAMA 1KGDA 4D0GA 2RGBA 3B85A 4B71A 2CDNA 3LA6A 2GKSA 1Z0AA 3PFIA 2OBMA 2BC9A 4AURA 3KJEA 3EASA 4FN5A 4PAMA 2F43A 1HEIA 2D06A 4DZZA 4TLAA 4V0ME 3ZIAA 3SJCA 4BFWA 4RD1A 5EP1A 1VCNA 1XZPA 3VNVA 1U8ZA 3WYGA 4C9BA 2JLUA 5H8WA 4XJXA 2GF9A 1VG1A 1XRJA 4M53A 1SXJE 2IYQA 1I2DA 5F98A 1ODFA 4QKQA 4JJZA 3GLIB 2Q6TA 4D2IA 1FX0A 3DMNA 3EIQA 4GZMA 4YMTA 4CEHB 3EZFA 2BM1A 2WBLC 2ZJOA 4TMWA 1RRFA 1AM4D 3RABA 1WA5A 2OXCA 2QQ0A 1IAQA 2NTYC 1E9CA 1VCOA 4DLXA 4D26A 5CIWA 3T1VA 1OXUA 4YDHB 1SVKA 1GZSA 1GILA 1ZIOA 1NVVR 2ZE8A 1JQLB 3MJHA 5DO9A 3UK6A 1W44A 5EP2A 4LBVA 3LBNA 4CZ2A 5AK0A 2LWIA 3A37A 2CLDX 3LY5A 3KKNA 1CRPA 5FTLA 5CM8B 1XCPA 4NYIQ 1QZXA 2WSSD 5DI9A 4YXWA 3I1FA 5DYIA 4C0LA 2ORWA 4CF7A 3CO5A 2BBSA 4JVSB 2ODEA 1YZLA 4A0RA 3TJZA 1SHKA 4EPTA 1OIVA 1E9FA 1GL7A 1NP6A 3M1IA 2QTVB 2FZ4A 1E2NA 2IEZA 4QXAA 1U0HC 4P4SA 4Q02A 4RZXA 1KDOA 5KNDA 2H92A 1JR3E 3R9XA 2I3BA 2B8TA 3MFYA 4E09A 4LY6A 3A4NA 3UWOA 1XEWY 1YZNA 2G77B 1TMKA 2OCBA 2BJVA 1BH2A 2F55A 3BH0A 1XTJA 4DLRA 4IDOA 2XITA 4LYAA 1P4SA 5L3SA 2AFHE 2C04A 3PEWA 4JKYA 3FOZA 2CVFA 4B3FX 4TMXA 2WZQA 3CRRA 2GK7A 1MRSA 1IXRC 3HU3A 3RRYA 2R6GA 3RNLA 5BN4A 5IK2D 1E1RA 2P6NA 5IT5A 4RY2A 1NMYA 1KMHB 1U2RA 4PO8A 5JRZA 2IYUA 3GEIA 3GLHE 3IPYA 3ZH9B 1E4VA 3TUJC 4DT1A 1HE1C 4HDCA 5FR2A 5UKDA 5DHAA 3EAQA 4Q4HA 1N6LA 3Q85A 1AGRA 2JLZA 1NJGA 1P60A 5EE3A 2YJTD 4ZKEA 3KKPA 3VR2A 1W0KA 3VR6A 2GEVA 2OCAA 3ZGXA 2OO7A 1JPJA 4DRZA 4B33A 2ZJAA 2VP2A 3FKSD 5EQTA 3GFTA 3PR1A 2CLSA 3QG5A 4WXPA 5IF9A 1E3MA 1QHGA 3EIHA 4YONB 3K09A 3DZ8A 2CL0X 3PG5A 1XWIA 2WWGA 4LHZA 4ZKDA 5J47A 3O8CA 3AF4A 2VHCA 3NWJA 1XXHB 4KYIB 2VP5A 2ZR7A 2YWHA 2QTHA 2AWNA 1GSIA 1P6XA 3BGWA 3HU1A 2FSHA 3D3QA 2IXFA 1KYIA 1G1MA 1IJFA 2XNDA 1OFUX 1M1YE 1GG2A 4BRUA 3LRPA 1MABB 5FUXA 3ND9A 4HDOB 1P2VA 1LTQA 3ZD7A 2VQSA 3HPRA 4DCTA 4OK6A 3J81k 3KQUA 4IDPA 4F4CA 5JHGB 1YVDA 2HYDA 1G9XA 1R10A 4U02A 3K0FB 4P4SB 2O8DA 1TQ4A 2OT3B 1CJKC 5B57C 2XZOA 1OYWA 4MUBA 1G5TA 1SZPA 4OL0A 1P3JA 1WQ1R 3WHLA 4HAVA 2AXPA 2YYZA 4M9ZA 2QORA 1J99A 2HV8A 1LS6A 1XZQA 2GESA 3A1VA 5M04A 5DIFA 2VH5R 3U2QA 3CWZA 2XAUA 4OQFA 4P32A 5JSZB 5L3SB 2YINC 2Q0HA 2Z83A 5C46F 5GADl 4AY2A 2Q9CA 421PA 1KO8A 2LCFA 4PC1A 1EGAA 5BYKA 2W2VA 1M8PA 3THWA 1IJEA 2C9OA 4Q47A 2QUZA 4US2R 4JLOA 4NYIR 3K9LA 5FOUA 1NSTA 1FFHA 3CNLA 5F9FA 5JCZA 1UKYA 4URWR 3CRVA 4C30A 1GM5A 5IHPA 4B2PA 1NN0A 4DSUA 4OJKA 4E22A 1YZQA 4BFSA 5BW8A 1Z63A 4XOIA 1G21E 4DT1B 3TSZA 4IHQA 3AVPA 3L43A 1DG1G 3NBYC 4NDZA 2W6ID 3NBFA 4KITB 3SU8A 4B2LA 4ZCMA 2I1QA 4G0NA 1MO5A 1G7CA 4DDWA 2J0UA 4P4UA 1ZRHA 4MRVA 1GL6A 4BEBA 3RSOA 2ODBA 3X2SA 1W2HA 2WKPA 4BE7B 2XJ9A 4B74A 1AS2A 4LHWA 2OSBA 3QPWA 5DI3B 2HEIA 3B9PA 2P5SA 4HB4A 3NBZC 2J0QA 2IUUA 3I32A 1XTIA 4HAYA 3GLFE 3FMOB 3U7FB 2OEPA 3ZDQA 1LW7A 4Q01A 1W36B 4WOPA 2O0JA 1F2TA 2C9YA 4L4UA 2XSZD 4OI0A 1J8YF 4M22A 2WIBA 4TYPA 1D9ZA 3NVAA 4DB4A 1N6IA 1S3GA 4NYMQ 1CR4A 3VKGA 5FR1A 3KQLA 4DDVA 5TB5A 3GLHA 4XSGA 1TF7A 3BH6A 4UXIA 1YZTA 4MGKR 1COWA 2EFHB 4EPXA 5A4JA 4D25A 1US8A 1SXJB 4BZQA 2E87A 4O3MA 1Z0FA 3KB1A 1BYIA 1RRGA 1O3YA 1T0JB 1KSGA 2RH5A 4QJ4A 4C2UA 3VNUA 2O8DB 4FMBB 5FBLB 1KI1A 2IYRA 4KSBA 1QDEA 4LJ4A 5JRJA 1D6JA 2J3EA 4MDFA 1ZUHA 1IN4A 3BE4A 3D8BA 3IIJA 4UNSA 4ZPXA 4Z54A 4Q48A 1Q1BA 4C0JA 2V3CC 5J4KA 2F1HA 2CCKA 3K9GA 2V6JA 3GCGA 3ZVNA 3VMFA 2F1JA 2FPMA 4A0HA 1SVIA 4M1WA 5J40A 1NIPA 3VHXA 3ZIAD 3C8UA 1ZD1A 4L16A 1UPTA 4HDQB 5JMTA 1JBKA 2JAQA 3ADCA 1E96A 2GBLC 1RC8A 5EZ6B 1EFTA 2AFIE 1NN1A 4FCVA 3L0PA 3L82B 3OESA 1YR9A 3ZVRA 1EFHA 1PLKA 1ZYUA 3C15C 4V0NA 3CUEF 3A36A 1Z0DA 1XJ0A 4RD2A 2J0VA 2G3YA 2B92A 1NVXQ 1T5LA 3CH5A 4TZ0A 3N70A 4EFNA 3N5CA 3ADBA 2BBTA 3ONWA 1Q3HA 2R62A 4TYNA 1OFTA 2J0UB 2ZXUA 3QKTA 3S1AA 4UJ5A 3FYHA 1T8UA 2GJ8A 4B48A 4OK3A 2A5DA 4PSVA 2ZE6A 4AKEA 4JS0A 1H8HA 1CIPA 1FUKA 1Z6TA 1KY3A 1A5TA 2J9RA 3KKQA 2D7DA 1D2EA 1TADA 1BS1A 2PBRA 2WVJA 3GJ3A 1DO2A 4YMSA 2IHBA 3QKSB 4YXWD 2YV5A 3MAAC 3BFXA 3UG6A 2O8EA 2FEOA 4LX0A 2J46A 2WM9B 2VHJA 1F2TB 4QBIA 3EX7C 2IYYA 2C9CA 2XOKA 3CF2A 3GEEA 3I72A 3MLEA 4A92A 2VP4A 2WAYA 4W5HA 4RZ3A 2QTFA 2F7SA 4N1AA 4I99A 5JJKA 2PT7A 1Q44A 3VX4A 1D8TA 2ZANA 1ZINA 2JA1A 2IL1A 2JJ2A 2WJVA 3GLHB 4A2WA 4J0QA 2ZETA 2C78A 1AS3A 4PAQA 2HJGA 1AIPA 2CCJA 3OZXA 4M4SA 2B6HA 3DKVA 1HQCA 1BYUA 2WPDA 4C7OA 3AEZA 2BDTA 2QAGC 2YOFA 4PZZA 4D4KA 5ANRB 1VCMA 4A15A 4PPGA 2A30A 2QM8A 4MUAA 1P2SA 5AJVB 4AKHA 5FL7A 2FEMA 5AUQA 1AJEA 4HLUC 3U7HB 2HF9A 2PX3A 2GILA 2ZI6A 3U3RA 4C0QC 4EJSA 1R6BX 3NKVA 4BZXA 2BM0A 2KSQA 3KJGA 4QBGB 2OCYC 1F60A 2KE5A 2IBMA 4FXPA 3EPKA 1PVOA 4NHOA 3TMKA 2FX3A 3RYTC 3NBXX 1EWQA 5TDHA 2VHQA 2H1LA 4B3DA 3U5ZB 3ADDA 2HLDA 3H1TA 4MYCA 3K70B 4NYMR 5C18A 1W49A 2ZYWX 1FNNA 1CULC 4GMDA 2ZUBA 1C9KA 3B1VA 4N0EA 3Q72A 1IN8A 2PMDA 3TH5A 1W0KD 5J4LA 1XCGB 1YR7A 4OBEA 1S8FA 3GP8A 1DTSA 2NMVA 5FTMA 1EK0A 4NONA 4BLQA 2OM2A 3T61A 3ZD6A 2YOHA 1IXSB 1U0LA 2GZAA 4NCIA 4TT3D 4K8OA 4NYJQ 2BCJQ 5BYJA 2ECKA 2JATA 4ARZA 5IRCD 3HU2A 2IX3A 2G9NA 5KDOA 3EIEA 3T1TA 2ZRIA 2HT6A 4D4LA 3CONA 2PCJA 1W36D 3GJ4A 1UKZA 4TYQA 2GTPA 2ZREA 4JL5A 3I5XA 1AKEA 1FTSA 2YWEA 4PHHA 1T9HA 1IM2A 2IS4A 2ATVA 4IXNA 5FL3A 2VHTA 3O47A 1VG8A 1PUJA 3R9WA 4AC9A 1CJMA 2GXSA 3GMTA 1Z6GA 4KU4A 4FWTA 4JT4A 4JBXA 3THXA 3U3JA 2O8EB 2R6FA 2VSOA 2ZJ5A 3QOFA 3QPVA 4B3BA 2ORIA 2ZAOA 4KVAA 1K8RA 3NH6A 5AJWA 1XP8A 1XMSA 4WAUA 3AV0B 2QG6A 2R2AA 4DVGA 5K8IA 1QF9A 2FMXA 2XXAA 3RS4A 4HLDA 3PUYA 2RGNA 5FTNA 1OB2A 1W46A 3QENA 4AK9A 1GVNB 3RS5A 2N42A 3R7WA 1Z07A 5DHFA 1YR6A 3CPHA 1C1YA 4NZYA 3TK1A 3CM0A 4XIGS 1EFCA 3EA0A 4C7OB 2H5EA 3G5UA 4LJ8A 3WYAA 2GZDA 1ZD8A 3PENA 8OHMA 4HEJA 3TQFA 1XPRA 4JZKA 4O25A 1G5PA 2W0MA 1T3LA 2CCGA 1NBME 3FGNA 1JJ7A 4DEYA 2ZRKA 2XTZA 3ZLJA 1ZNXA 1XMVA 3CKLA 5FOVA 1XPOA 2YWFA 2CNWD 4EJSB 3RSLA 4AKIA 5CLLA 4ASUA 4OK5A 4LV6A 4K46A 4FI3C 4IEIA 5FFMA 2MSCB 5CDFA 4TL9A 4Y0VA 4IDNA 3I5YA 2OG2A 1KKMA 1ZIPA 2VP6A 4FINA 2GAOA 2WJHA 1FUUA 3D6TB 1HT1E 3P20A 4RVCA 4ZI2A 4OKSA 1CR0A 3REGA 3IO3A 3LXRA 3WHKA 2PZEA 4ESVA 3U44A 1II0A 2ZRPA 3CZQA 2FDCA 1LF5A 2AX4A 3CX8A 1A2KC 3TSOA 1AK2A 3OIWA 3NTUA 1E2EA 3V9PA 4B44A 3C41J 5HZKA 1KOFA 2YVUA 2PJZA 2ZR9A 3HP1A 4HB0A 1N0VC 2A9KA 4ABYA 4EPYA 3KUDA 2ZE7A 1O87A 2CEAA 3WMEA 1XD9A 1Q12A 2W00A 3OAAA 1R4AA 4KVGA 4M2LA 1DBSA 4DLYA 1X1RA 4O0MA 4JLPA 4A36A 1IY2A 1I4LD 4Q9KA 1VG0B 1LV7A 2OAP1 1PLLA 3AQ4A 3B1YA 4GOKA 4UQOA 2BBOA 3ICQB 1RPZA 2J1LA 1UKEA 2GA8A 1T3HA 2ZROA 1Q20A 2D2FA 4C0AC 5JECA 4DEXA 5JEDA 2ZTSA 3QEOA 3THXB 5AR1A 1DARA 4RD4A 3HYTA 3DKPA 1COWD 3K0CA 4GOJA 1YRBA 2OFWA 4DUGD 4QNRA 2DBYA 2OFXA 1G6OA 5H68A 4A9AA 4ZDIA 3SQWA 3T1QA 3B6EA 2R6CA 1G64A 4LYJA 4NYJR 1DADA 4Q00A 1IONA 3WXMA 2D74A 2QA5A 2QP4A 3EPHA 1QHNA 4PQFA 1R2QA 3VU9A 1UEJA 4A1FA 3QVVA 3D31A 3QXHA 3MCAA 2QNRA 4F4JA 1HQYE 1NSFA 2BVNA 4PC2A 1KNQA 5JI2E 3B2EA 4MQBA 4HLQB 3QF4A 1TF2A 3K70D 2O8FB 3QKUA 4BPBA 3AVOA 1II8B 1OH6A 4G5GA 1F2UA 2ZI9A 1YKSA 2QQEA 2OHFA 1TU4A 4IJMA 3TUZC 1G19A 3QEJA 1OT3A 2GCPA 1GUAA 3RDPA 3OE7A 5D3MB 1A82A 3G0HA 4H9GA 4OQLA 3TR0A 2ZI4A 3U44B 4DLVA 1OB5A 3B5JA 1DAIA 2NG1A 2ZJ8A 1KMHA 3EZ7A 2RGEA 1P9NA 4P4TA 3F8TA 1JJVA 4Q4AA 4WBSA 2FE4A 2OAQ1 2YC2C 1H8HD 4B6EA 2BWJA 1VG9B 2V7QA 1E9SA 2GJKA 2IS6A 5GVRA 2V1XA 4G1UC 2WICA 4RD6A 2CL6X 2C8VA 1E2MA 2W83A 4TMTA 5HE8A 1RYHA 3I8XA 4EDHA 3P32A 2B21A 3M4YA 5D3QA 3QUSA 4QHSA 5C1BA 2IC5A 3LLMA 2IYSA 4NCNA 1MV5A 4NMMA 5DGXA 1E2HA 3SJZA 1QHYA 1KDPA 1NBMA 3BD9A 5SZIA 2FWRA 1JR6A 4KO8A 2KBEA 2OCPA 2V1UA 1J70A 3B7GA 3NDPA 4A8JC 1QVAA 2G88A 2P3SA 4YMWA 1GP2A 1N0WA 1E9RA 1G16A 2JASA 1S2MA 1IOZA 3KQHA 4QGGA 5KNCA 1OFIA 4B3GA 2W6JA 2P67A 1N5KA 1XXHA 4PAOA 3C7KA 1OIWA 3A1UA 2W58A 3WMGA 1F6BA 4GL2A 5CB8A 1IBRA 3A1TA 3GJXC 2KBFA 2JJ1D 2WPDD 1OHHD 4I1OA 3FKQA 1W0JD 3U3OA 4TN1A 6Q21A 4JLAA 3RRZA 5LD2C 1MABA 1EX7A 1P62B 4TQUS 2OZEA 4MKGA 1HURA 3UKDA 2ASEA 5FL7D 2MMGA 1HE8B 2DY1A 3GQBA 3UWKA 5J4YA 3MWKA 2R6DA 1FPMA 3NEYA 2JJ8A 1G8YA 4JVLA 3VU9B 4M1OA 3V4RA 3K0FA 4FD2A 5LB4A 1KZ7B 2F3RA 3QPUA 4Q21A 4Z8YA 2VBCA 4A0GA 1IY1A 2ZJYA 1NN5A 3WNDA 2V6IA 2HLDD 1W5TA 2OV2A 3BORA 3JZMA 3QF4B 1OLOA 2P5TB 2QP3A 1YHNA 2DHRA 2OXRA 2V8OA 2ZS8A 2IYLD 2DFLA 1QG4A 4QL3A 1F2UB 1WBBA 2NO0A 2G0NA 1NI3A 4B73A 1BO6A 3PXGA 3MJRA 1DO0A 2ODNA 4NCHA 1DG3A 5JSZA 4DB2A 2CE2X 2GCNA 2J7PA 2HDNB 3Q7PA 4JVNA 1GDDA 1XMJA 1UBGA 1E99A 4RKFA 1GRRA 3SN6A 1XD8A 1R7RA 3O8RA 3UG7A 3QXXA 4LOAA 5CK5A 2D62A 3X1ZA 2N1BA 1KHTA 1RYFA 3K9NA 2ZJ2A 4JL6A 2ONKA 1UAAA 1G20E 4Q4AB 5GJVC 3RHFA 1QHHA 5L3QB 4MGYR 2GEUA 2PEZA 1AKYA 3ICEA 3AH8A 4NH0A 3GJ6A 1OXSC 2GXQA 4IOLA 2OLJA 2WJYA 2JLYA 4US0R 3VX3A 4LJYA 2QEQA 1JALA 2GAAA 3CNNA 4Q1CA 4JLKA 3WY9A 1OJLA 3NIBA 1E4YA 5KPDA 3D7MA 4GSYA 4B3XA 4E03A 1IQPA 3RRMA 1NMZA 2WTUA 1IN6A 1ZD9A 5DI3A 3X1XA 3WNBA 4KXFB 4TLCA 2FN4A 1ZM7A 1YQTA 1EESA 3U4QB 4HB2A 4F92B 4C0HA 2ZU6A 4UNQA 2QL6A 1CJTC 4GOXA 3K0AB 4JMPA 2H18A 1GAJA 3AKEA 1JB1A 1B0UA 2XNSA 4OHYA 1FMLA 5CJPA 5SZJA 1T8TA 1TEXA 4OHVA 4DCVA 2ERXA 1E1QD 2SHKA 4NE2A 4CIDA 2I4IA 4X8LA 4BWYA 4H1VA 5KTYA 2BV3A 4XTRA 1TUIA 4V0MA 5B30A 4GMXA 3TVTA 621PA 1R8SA 1TQ6A 2Q3FA 2F9MA 3HWSA 3K8YA 3KTAB 1FP6A 2WHXA 2E1RA 4QBFA 1DOAA 2NGRA 2Z4RA 4JYCA 1SXJA 4MGZR 2IYZA 3SYLA 1E32A 1X8LA 3WRYC 3W9YA 4LJ7A 4ASUD 1F5NA 1FZQA 3CX6A 1NKSA 4KYUA 5JFGA 2PT5A 3PV0A 5HE9A 4GBMA 4D0LB 1CRQA 4ERNA 1FOEB 1NG1A 5FPYA 2QMOA 1G5RA 2V4ZA 3W5IA 1Q1QA 3GEHA 3LWNA 5B58C 1PZNA 2NOAA 2ZRGA 1XX6A 2W2XA 4LHVA 2G83A 5G53C 2ZE5A 1XB2A 3BB4A 2WWHA 3OIUA 1CXZA 1TF5A 1IHUA 1EFRA 1SKQA 1DS6A 4C0KA 2VF7A 1U90A 1E79A 1KKLA 4TLEA 2WJIA 3KKMA 1JNYA 4E5UA 5SZKB 1XPUA 1UM8A 2IXEA 4HAUA 4B3CA 1P61B 1SHZA 221PA 4LWZA 1IXZA 2ZRAA 1KAGA 4LV8B 3OAAD 1WP9A 1DAKA 4YLGA 4LDJA 4NBSA 1QHHB 2NPFA 1WXQA 4IDQA 4MGIR 1QHIA 1XJCA 4OI4A 2QGZA 1MO3A 1R0ZA 2MMCA 4DLZA 1ETUA 4NKRA 5AJXA 3EA5A 1N6OA 3H84A 1T5IA 1DELA 5JJLA 3AKCA 3SFVA 1JR3A 4PC7A 2O0HA 2K5UA 2QM7A 4UXHA 4BLSA 4BRWA 3CPJB 3DOFA 4JSTA 4I81A 4XSHA 2FFQA 1NL3A 2BEJA 3ASYA 3KJHA 1OXTA 2HXYA 2X19A 2JDIA 3PUZA 3AKDA 1P9RA 4DXAA 3OF5A 5GVSA 1YJ5A 3QKSA 2L0XA 2YC4C 1KSHA 3FHOA 3KXIA 2J45A 2O8CA 4EQ6A 1Z29A 1S96A 1A2BA 2JCSA 2ZYVX 4D0NA 1NJFA 5DN6D 1Z06A 1XU4A 1S3SA 2NZJA 1XCMA 1ZUNB 4C4PA 1A7JA 3T1OA 1FNMA 2OE2A 2XTMA 1R8QA 4JLVA 3AVXA 5FBWB 2YOGA 1GWNA 3T12A 2CVHA 2ZS9A 5HR5A 3KXKA 5HKKA 4U7DA 4ZI3A 1E2LA 4Q1FA 4OQMA 4LI0A 1NVWQ 4LYHA 1RFLA 3LV8A 3T15A 2AHOA 4Q7LA 2WIAA 3KQNA 3DO6A 3QKRB 3RRNA 2RGCA 1AN0A 1ZCBA 2O8BA 4TMVA 2J87A 1YZGA 3CLVA 2GJSA 4D4JA 1NY5A 1BIFA 2P2LA 3OE7D 3WRXC 721PA 3GFPA 2PX0A 4L9WA 1N5LA 3LH5A 2GHIA 1W48A 4DBLC 1GKIA 1U9IA 1VDZA 2WMNB 521PA 1UDXA 2VHUA 1RW4A 1XEWX 2J7KA 1J2JA 1HTWA 4R98A 1UKVY 2DWPA 2Q3HA 4MKIA 1P7CA 1OH7A 2Q3MA 1Z6AA 2ZITA 3H86A 4WVFA 2HYIC 2NZ8A 3I4LA 3SYKA 2AKYA 5CB6A 2AL7A 1C4OA 3SC3A 4M9XA 1ZBDA 1R0WA 4KODA 4EFMA 1KIMA 2A3RA 2OUKA 5EP3A 4EFLA 2VL7A 4A6PA 2EFEB 4OHWA 5G3YA 2ZRNA 4RSGA 3KUCA 4CEJA 3FHCB 4Q18A 2A5JA 1SVWA 1TTTA 1EG7A 1GIAA 3OEHA 5LPNA 1DAHA 2ANBA 4QFMA 1BOFA 4PFSA 4ZDWA 1G3RA 4GRAA 4QHYA 2DFKB 5HCNA 5CITA 1TQ2A 4IOMA 2YNMA 4G3XA 2CK3A 2DYKA 1XD2B 5EJEA 1OSNA 1ZJ6A 4OHXA 1NLFA 5JJIA 1WF3A 1AA9A 5H70A 2IK8A 2VA8A 1LF0A 2EYQA 2ZU0C 3C5CA 1M2OB 2A78A 2LKDA 2AR7A 2QI9C 1KI2A 3BBPA 3CPEA 3AB3A 3AVUA 3ZQJA 2R65A 1SQ5A 1OV4A 5C2JB 3U60B 3PITA 1P72A 1JEDA 4D6PA 4EQ6B 2O8CB 1HT2E 1VIAA 3FVQA 1G17A 3UMSA 5B64A 1N5JA 4X8OA 5EE0A 1E2DA 1Q1EA 2D7CA 3FMPB 1DAMA 2QU8A 5FOTA 3VHLB 3EWAA 4B6FA 3R8FA 4XVUA 4ITRC 4URXR 2WKQA 5JWOA 1PJRA 2O5VA 2AD5A 1Q21A 1E2QA 1MH1A 1KO7A 4KAXA 1Q0UA 4C3ZA 4TL8A 5JCPA 2FSIA 3Q7QA 1JEEA 1X8JA 1ONBA 4MRRA 4C0SA 1CEEA 1CP2A 1VYUA 1Q1ZA 3K9HA 4AYWA 4H1UA 3C14C 5JI3E 3KFXA 4URYR 3CIOA 2H57A 2PL3A 1AZTA 4GPTA 2O8BB 1HH4A 2J7PD 1KJZA 4OHZA 3TRFA 3AVVA 2KI5A 1Q22A 1DPFA 2QPOA 4LPKA 1A4RA 4FWIB 4YQFA 4GFDA 1E1RD 2PH1A 3EG5A 5AJZA 3VR5A 3SFZA 1OPXA 3B78A 4TMKA 4UNNA 5BQ5A 1GNPA 5HCIA 3SBDA 3GLFA 4R9UC 2REBA 3AP1A 3O8DA 4IW3B 2ZSDA 3SHFA 5EP4A 4HUQA 2P6UA 5FI0B 2J41A 2BMJA 4PO1A 1NLZA 2FOLA 4IXMA 4HAXA 2RAPA 4LSGA 5J4VA 2ZI7A 1VMAA 4Z1MA 3LO5A 3K09C 1KY2A 2RMKA 3DEFA 4QJ3A 4CEJB 2J0SA 5KUTA 1W36C 1T91A 5H1YA 5TV2A 2WJJA 3PUXA 1YZKA 1WRBA 2F6RA 2I1VB 3KX2A 2RKOA 4M9SA 1KK1A 1WMSA 4BFTA 1OH5A 1G8HA 4DDUA 2V55B 3TE6A 4BQSA 4RFSA 3ZS9A 3BJIC 4JBWA 4Q7MB 4ZDKA 3KL4A 3BERA 5JWHA 1ZC4A 4Q1DA 1YRAA 3H0KA 2GETA 4Y0AA 5EXPA 2BMEA 1KDRA 4Q66C 5FI1B 1U98A 2A2ZA 3UXMA 2RGDA 1N6PA 4DC9A 2NIPA 3IEUA 5KSOA 5L3VA 2XNDD 2VEDA 5IK2A 2FPLA 4YDSA 4W9MC 3RC8A 1UEIA 4LBYA 2GK6A 4MDEA 1XNJA 4FW9A 1WB9A 2B7BA 3K0EA 4FMDB 1M74A 4R2IA 2GCOA 3PUVA 4NU0A 4MITA 4TQAA 2BHRA 3FMFA 4TLDA 3LX8A 3SJBA 1SXJD 4YC7A 3RC3A 3THOA 4IVPA 3EZ9A 4G5RA 4GP7A 1VIYA 1E9BA 1VYTA 2EYUA 2QMUA 2ZEJA 3IDQA 5DISB 4XVRA 1S1CA 1E9DA 1G3MA 4NPHA 4KSCA 4TSFA 1WBDA 1F48A 2HCJB 1DAEA 3W6OA 3V00A 3AUYA 2AK2A 3MWJA 1L8QA 2H7VA 1KI7A 2PZFA 3CRQA 2ZRMA 3BOSA 4LYFA 4F91B 3REFA 4G01B 2OBLA 4JLBA 4AG6A 4POAA 4ZDJA 2QRZA 4PPFA 2A7QA 3PEYA 3MUFA 4JLMA 4URVR 5AJYA 1SKYE 1VKJA 4A82A 4CT5A 2XZLA 2V54A 1Y3AA 3A1WA 3EC2A 4DCSA 2C98A 1T0HB 1XJQA 2RHMA 4KFRA 4JSYA 1EFRD 4RD0A 3VTKA 4FMDF 2C2HA 1H8EA 2DFNA 2XB2A 2AKAB 3B13B 5KO2A 2GVZC 3TAHA 1E79D 2EW1A 2O8FA 4U00A 4XWOA 2ZRCA 3AP2A 1HYQA 1II8A 3P26A 1VTKA 2IYTA 2REXB 1WDTA 2QENA 4ESHA 3GLFB 2IS2A 4QNMA 1S9HA 2GWHA 3UIEA 4TL6A 4HUQB 1TNDA 4XVQA 5FUYA 4EPRA 1Z0KA 1Z0IA 4KFSA 3RS2A 2UVQA 3TIFA 2G1JA 4XD7A 5D3MA 1II9A 3FHTA 2C5LA 4M1TA 1SGWA 3TGPA 4LV5B 4GDFA 4CW7A 2WAXA 5CLQA 1J90A 5G3ZA 3W34A 4I1UA 3QXSA 2ZSBA 3L8ZA 1ESNA 2C99A 1JR3D 1KI9A 1ZM9A 2QZ4A 4OI1A 2FFAA 3P1JA 4TTRA 2ZYTX 2EFDB 1U81A 1CJUC 3CH4B 3AM1A 5ELXA 2D3WA 4AYXA 3RS7A 2Z43A 2AN9A 1GRQA 4HZIA 4JKIA 3EXAA 4RFSB 4ZV4A 2JDID 1P2UA 4JBYA 2IYWA 1W4CA 3I8SA 1GFIA 5E95A 4RJLA 4TL7A 3F0TA 3KB2A 2BIFA 1W4BA 2V9PA 3U7GA 2QPTA 3U7EB 1LY1A 3HDTA 4QGHA 4Q9HA 1KI4A 3RLFA 1JPNA 5KSYA 1FL9A 3SOPA 2WV9A 3GPLA 3WMFA 2BCGY 2JLXA 1ZUIA 5E7MA 2GCOB 1N0UA 2N46A 3TQCA 4BFUA 4BLRA 5HKKD 2IS1A 2Q9AA 1ZNZA 4TWZA 1E6CA 3F3YA 2R9VA 3RS3A 4ZCLA 2O52A 2KB0A 2HUPA 5EXTA 1Z28A 1TX4B 4Q19A 1S1MA 4KHZA 2DPXA 2VTKA 4UNPA 4BUJA 3CF6R 1JAHA 2W6IA 5HZHA 3GJ8A 4Q1AA 4JLDA 3K70C 2TMKA 2MSEB 3QJYA 4KFTA 1M6NA 4HYYA 1G3IA 2FNAA 4AI6A 4IFEA 4NCJA 5FBRB 2CJWB 4K81B 4PTLA 3AVYA 3K0SA 5F3WB 3DMDA 1U0JA 2IHYA
chains in the Genus database with same CATH superfamily
4U8HA 3VJKA 4KXUA 1KI8A 3ID6C 3E1SA 4PRZA 1ESEA 1GZ5A 1GL9B 1MC4A 1UJ2A 2F8LA 1RWMA 2GNOA 4KFUA 2LCQA 5J2UF 4DILA 2VNSA 5B3AA 1UFQA 5AOBA 4LF4B 4MA4A 2PBFA 1V8OA 1G8PA 2O07A 2IHUA 1G0OA 1M1ZA 3GYGA 2HJVA 1SUEA 4G56A 1C30A 3RVBA 2DUNA 3OFJA 3KT0A 4HRYA 3I1YA 1I0ZA 4I14A 4Q16A 1CS0A 3R76A 2WUGA 4CQMB 4UVEA 4WN9B 3TZBA 4WA7A 3DV2A 3BXEA 1H1TA 4J03A 1QTNA 3AFGA 5AM0A 3PLRA 1E0SA 4GP6A 4YMIA 1LLFA 4UAUA 2Z2IA 3TI7A 2QE7A 3B9RA 2NV6A 4NJOA 4WKGA 3QQ5A 4IX9A 1V7CA 3BKXA 4PO9A 2NT3A 3RUDA 3MTQA 5AKIA 1N2EA 5KDLA 4QD3A 2A5YB 3HR4A 2KJQA 5LL6P 4RCYA 1UZMA 4LVOA 4B8YA 4ZU3A 1AHNA 4D5EA 2WF5A 3KELA 3O1IC 5AO9A 1KSJA 1PTKA 5LDHA 2Q4DA 1L6RA 2PQ0A 4FFWA 1JV2B 2ID7A 4XYBA 3W3AA 5DT2A 3DHEA 1P2DA 2XVMA 4IJQA 3TECE 4CV0A 2RCYA 5CM9C 1PKXA 3EUFA 4AG5A 3KFVA 4HXYA 2IT1A 3PJEA 2BEUB 2IX9A 4GBJA 1IVNA 2CXTA 4QRHA 3NNNA 4ZOLA 2KWIA 3UA4A 1WY7A 5CIQA 1N9KA 1W1WA 3HY3A 2D4HA 2B82A 1K27A 2E85A 3V1NA 4LVNA 1NP7A 1GKYA 1YD7A 3K0KA 4EJSC 4MYSA 1TCAA 3BTVA 4HB3A 4LHSA 1T43A 3RYCA 1E59A 2PRYA 4TUYB 5JXHA 5J1TB 4I1VA 1JA0A 1LRJA 4JB3A 1CRZA 1SXHA 2C2YA 4FOSA 1EA5A 2ISCA 3UBMA 4I2NA 3K9WA 1QV6A 2CUTA 1Z82A 1CKEA 2XJ4A 1N77A 4P4NA 3DO5A 3ZCVA 3VC1A 1H4QA 3GZTB 1K9SA 1SIUA 2YQ5A 3OM1A 3VR5D 1QHSA 2XE7A 3MAGA 2F4VB 1ZK3A 2BGNA 1GEEA 1CTQA 1Z7WA 2P62A 3LUGA 1NKTA 4QC2A 4DL9A 4IBOA 4UVIA 1MF7A 5IJZA 5KTMA 2WDPA 3AF6A 4LRTB 4I5IA 1PV4A 1Y9AA 2GDJA 5JBQA 3EOAI 4EX7A 5B7PA 3QU2A 1SVNA 2C2OA 3A0UA 3QIAA 4KV9A 5G0TA 3CT4A 2EFJA 4R81A 3PLAE 3HXKA 2ZRFA 5D87A 1NR5A 1IDOA 4MQFA 4DMKA 5FHQA 3IKJA 4XIIA 3W5BA 3A28A 2HJHA 2ZB4A 5H0IA 2G4CA 4BFXA 1FP7A 2PR7A 3KD3A 4P3XA 3RWMB 2HJSA 4ENUA 1UM9A 2FPKA 4J3FA 2X2FA 5KOYA 4MVJI 4EGQA 3C3MA 1UXIA 5ULLA 4W5TA 2F3PA 3FCEA 4QYTA 1ZD3A 4N6NA 4CF6A 3WLRA 5IVPA 4HAOA 1JQDA 4NAHA 4GPEA 1YA4A 3V9AA 2HXGA 3K2EA 3HYCA 1PNRA 5CNIA 4PN7A 4DIDA 3AJEA 4NBVA 4OU4A 4PSAA 3SQXA 5DASA 4IMPA 4RXUA 1G66A 3USCS 3HO8A 2B8JA 5EPUA 1DXOA 1VLJA 1B93A 5JASA 2H8KA 1YVPA 4TZ6A 4RZSA 1WTCA 1Z2DA 3WWOA 2ACEA 3P94A 4K9QA 5JS7A 2CMHA 3OT1A 5BWLA 2IYXA 1CNMA 3IQGX 121PA 3SLKA 4CQLA 1DAGA 3I9V6 5E6RB 3UT5A 3DUFB 3DOHA 5KREA 2PD3A 5DE3A 1P7ZA 1YB1A 1AO3A 1SKYB 2Z5FA 3OM8A 3OLVA 5G40A 1QH8A 2Z95A 3GJ0A 5EESA 1VL2A 3V1UA 4QG3A 4B7UA 3GT3A 5AHRA 5FFNA 4YA6A 4E07A 3I61A 2QAGA 1N5RA 1C41A 3DR3A 1WMFA 4CKEB 4HSGA 1ZIXA 3EBOA 2AZDA 3PKJA 3BZBA 3PNBA 3BRWD 2F43B 3CWQA 3M0EA 3QTLA 1PT6A 5T4EA 1YTLA 2ILTA 1NQXA 2X0EA 4HO1X 4BFVA 4EUNA 3CFYA 3OM0A 5KKAA 3MMSA 1CQIA 3IGFA 5FJJA 2PRZA 3E27A 3KAPA 4QYMA 2ZDQA 4RZ2A 5DB4A 3RTDA 2Q9BA 5JBIA 3JD4A 1F4VA 3OQPA 3PVCA 5DWQA 1L5HA 4A8PA 4GR5A 5K99A 1RYYA 3E0XA 3N75A 1NYRA 1NMXA 1UOQA 1JIVA 1T5HX 2VPPA 3HYRA 3KXLA 1GFZA 4XGNA 4L51A 3ZVLA 4AJKA 2OGTA 1GUFA 4GICA 3P2IA 4OKIA 1ZA2A 1H42A 2AN5A 4DJJA 2HNKA 4F60A 2FMUA 3G2MA 1HYHA 4XH9B 1CJCA 4XM0A 5TGTA 5HQ3A 1H2WA 1M73E 3BIFA 4Q7KA 2ZRHA 2AFRA 2AEMA 2ZJ1A 4GMFA 4S2EA 1BXZA 4U7FA 1CCWA 3C39A 3PI7A 1E3SA 4KVZA 2XEXA 1L5LA 4ER5A 5BSHA 3FMIA 3T7SA 1ZSVA 5F5LA 5LZ7A 5IYZB 1XTSA 2RGUA 5JS8A 1XRPA 3DNFA 1WHTB 4IG4A 4B8WA 1P2BA 3BL6A 3FPFA 1EG2A 3A6GA 4XQ9A 1NW8A 3LOQA 4XD7D 2P6RA 4GO1A 4YRCA 4RA6B 4BVHA 1F38A 2HHHB 1RWKA 3DLPX 4U7HA 4MWBA 3BWXA 1PRYA 1QCCA 3EJWA 3MOSA 1HDIA 3QE4A 2RGXA 4IKEA 1GLNA 1UCFA 3F5DA 4M21A 4PRLA 3SYNA 2XQVA 4DLSA 3TZCA 3WTCA 5YASA 3TSYA 3OX2A 4G5QA 2G5TA 2X4IA 3SZRA 4BFZA 3F6EX 3LPLA 4IIXA 4MR9B 2B78A 1ANKA 2ECFA 4X3PA 4Y9SA 3IELA 5EE5B 4EZEA 4B8ZA 3M83A 3T9CA 2HZ7A 4CM4A 1KK2A 1SBNE 2GN6A 1RQGA 2EG5A 2Y1KA 3H2YA 4X3CA 5HOEA 2NXWA 1V96A 3TIGA 3Q1KA 3RC1A 1L5YA 1X0VA 2X4LA 2ZB2A 1UKAA 2GTIA 3BHJA 3SI7A 1BMFA 2ST1A 5AK3A 2X23A 4NC9A 4J4BA 3ZQ6A 3WL6A 2XWPA 2FP3A 4AO8A 3EGVA 3CINA 2O5RA 3OE5A 3HLKA 3CE9A 1X42A 1V4NA 1ZZEA 2YXEA 3O0TA 3TNJA 2GXAA 1XD2A 2PMWB 4F93B 5JW6A 2X14A 4NY1A 4TMYA 4IDBA 4B4DA 1J42A 3MWEB 5DNCA 4L8GA 4HTAA 3KCQA 2C5EA 1G2QA 2CNWA 2CXRA 3HJCA 4J8PA 4D42A 4XWKA 2P2YA 4HATA 4BB5A 1D5CA 1ZOOA 1GPKA 5CDSA 4JR1A 3MRSA 3L8YA 4NS4A 3HI4A 4P3OA 5CB4F 2CV2A 2VF2A 5AKGA 5GONA 4DV1B 1EVYA 5DSZA 5DWVA 4KQKA 1ECGA 1HY3A 5CPBA 2JIZA 1E92A 2TS1A 1NTOA 4R2JA 1VI2A 2NPIA 5JANA 3D59A 3BWDD 2HSGA 5HF8A 3TZQA 3OO1A 2Q8QA 3AVTA 3O92A 5K3DA 1XELA 1TA4A 3IO5A 5IP5A 4CFSA 3SNHA 3EDOA 5F1YA 2F67A 3OIYA 3ZS8A 2JHCA 4Z99A 1UL1X 3SIXA 1J07A 3GLGE 2O05A 1WG8A 4LNUB 2Q99A 1FYXA 3DV0B 1E2IA 4ID9A 1VLVA 3BPSA 1FBNA 5CX1A 4NENB 1HBJA 2RGGA 5JG7A 3WG9A 1JDZA 3JQFA 1TC1A 3T3NA 3MGBA 2IUTA 5CLGA 3H42B 3D7KA 3OFNA 3QIVA 3KZNA 4LGYA 1PJBA 4S0ZA 3NG1A 5I5GA 4FEEA 1P1BA 1XZDA 1H1LA 1OF1A 3DC7A 1XU9A 3FWYA 4K3UA 1A4XA 1QHFA 1XKTA 5FOXA 3GLFB 1WUHS 2JLQA 1DMRA 3AR2A 5EWMB 4MRNA 4LMRA 5KYXA 4ZGWA 3DEYX 4TXJA 2G82A 4LC0A 1AZLA 1EGVB 2C5HA 3LNCA 3O9ZA 4F4IA 1L1FA 3W8NA 3QVTA 3LTNC 5I5EA 1CF4A 3QWHA 4A3SA 3AGPA 4GSLA 1QK4A 3JQ9C 1BEZA 2OA0A 2ZRBA 1PLJA 4F1JA 4S0XA 2CMGA 1VA5A 2LPMA 4W6ZA 3VQTA 5GOTA 2ICAA 4OFXA 2ODTX 1B74A 1XZKA 4GZ6A 3RNOA 4AICA 2A0WA 1G4UR 1KJ9A 3D8RA 4AMUA 3AMVA 5F9MA 1KH2A 4F38A 2ZT5A 3AR6A 1VIDA 4E4RA 3SX4A 3N39C 3NBMA 1X3LA 3HB5X 2IRWA 3L79A 1RCUA 4NRDA 3D6AA 1TQDA 1TAHA 2BONA 1PYOA 4BNZA 2XIJA 3DDNA 4UMVA 2VQDA 5HG0A 4Q34A 3W90A 3EZ2A 4RPCA 1MAWA 3B1XA 1BVYF 2JGFA 4BVBA 2XYHA 1B73A 1E60A 2D00A 1XRMA 1Z6ZA 4MR8A 4F5DA 4GNRA 2GF0A 1L2TA 2XQFA 1ZM3A 1P0CA 3A25A 3PQ8A 3QBVA 3T54A 1PV1A 2B99A 2WT4A 1XQVA 4IHKA 2FA9A 4IIJA 1K0UA 5B4VA 3KP1A 5CYGA 3NORA 1Q7GA 3H9QA 3MWLA 3H1AA 5AIAA 1U8XX 4MB0A 4GI5A 2FF7A 1JIJA 4ZAFA 1SIBE 1YZ3A 1E2JA 2R1VB 5HM6A 4OXKA 3THWB 3A2KA 2DBVO 4FLMA 4B32A 1EXNA 3RVLA 1Y3BE 3RTBA 5HRCA 2EBHX 5GZ1A 2YJGA 3DXFA 1Z8HA 1VL5A 4G23A 4LMAA 4RZUA 3LY9A 4Q4DA 4PHCA 3QLTA 2YWCA 4DMLA 1KQFA 4RQTA 4MW5A 3EQZA 4R71A 2BMWA 4IOJA 1PV2A 2I2FA 1U8YA 2VRCA 3ANTA 1U3DA 4IPTA 5DHSA 3DL7A 1SBYA 1MBZA 1P0IA 3A9UA 3L0SA 3NWEA 2BH9A 1IEVA 3A9VA 4K1XA 4F5WA 7REQB 1O95A 3OIVA 4M1YA 1DX9A 3Q0IA 3ROFA 4D56A 1HOTA 5ENDA 2O5EA 3WBKA 3H16A 1Y33E 3D8HA 3CX4A 1WUJS 2ZVPX 2ZBFA 3E7PA 1ZJ4A 3H65A 3LECA 1OXXK 2I2XB 2XCIA 3BXZA 1VKNA 2GJ9A 4M0LA 3M1AA 5IBPA 2QR5A 3KLOA 1JXOA 1KVSA 3WGVA 4D7AA 5CIYA 1Q83A 1GG8A 1CEQA 4MIOA 4KX3A 2AQ8A 3DAGA 3UC5A 4DRXB 1K6MA 1V9LA 1OA0A 1N2CE 3TLGA 1HDRA 2BEVA 2JFBA 3BJRA 4AMZA 4D9NA 5ICGA 3URKA 5F2OA 3TLMA 4R9RA 4C7VA 5CW1A 2B2XA 3S8EA 1Y3IA 3FUWA 4MQ4A 2IZ5A 1M83A 2WWYA 2I91A 3DFZA 1X80B 3R7DA 4F71A 4V1CB 2PBLA 3W8RA 1KWKA 4MJ3A 1SVOA 1N5DA 4FUTA 3EVZA 4KDFA 5HDQA 5DRTA 5C0OE 3T7AA 4Q4JA 5G0UA 4ECAA 3GIWA 4PSDA 3CCBA 5IARA 1YZUA 3KQYA 5DKFA 2OYCA 2FR8C 3ASZA 2GA9A 1JKJB 1KMQA 2W93A 4UKDA 4M54A 1EFPA 3RKUA 4ENPA 5ICEA 3IHLA 2ZTLA 5JHHB 2W4MA 1T24A 3NAZA 3DVAA 3WA7A 5E4JA 4W6QA 2FSFA 1ZKMA 3R4VA 1AGPA 3GP3A 5FWXB 3DV9A 5FCDA 5KU7A 4KCGA 1KZ1A 4L15A 4FI3F 5HTKA 1CNFA 2W2KA 2IWRA 5HPYB 1LU9A 1TM3E 3HVIA 5I9MA 1GQRA 5K4HA 2CJYA 4HDNA 3WK7A 1I94B 1C0IA 3IMEA 3HUTA 1T0PA 5DCUA 3W5CA 3IODA 1LD3A 4O2RA 3ESXA 3BTSA 2ZUVA 1GRVA 4OV6B 1MOZA 3EVFA 4PQRA 1DX4A 3T9BA 2DLCX 2CDCA 1OI3A 2LP4Y 3RFXA 3ZW9A 3GLGA 5TVKA 3GLIE 1S7CA 1Z0JA 2Z5LA 3SLRA 4E11A 2PTGA 2AR0A 2WE7A 4AFNA 3Q11A 4ONEA 3S8YA 2J30A 1RI1A 4MPPA 3HJUA 4OLAA 2KYRA 4KE8A 4RKEA 1NQWA 2B3DA 5FTWA 3LLCA 3WBJA 4ACBA 1KO5A 3FDZA 4Z9AA 2JLVA 1ZGJA 3ME5A 1G5IA 3O6VA 3WX0A 3I34X 3C3YA 2ZPTX 5F21A 3NR2A 4RX1A 1I30A 3H1PA 5ILOA 1UAYA 1ZNYA 2WYHA 1L7PA 3OJCA 3ITNA 2P0YA 1RCTE 1EEXB 2GKGA 4V0OA 3QYPA 2JFUA 4HRAA 5DSXA 1JP7A 1F3OA 3RCBA 4C4YA 3UANA 4BECA 2BJWA 3HDQA 5BSEA 3TF5A 4ZODA 4I5GA 4YJ3F 1G8SA 1L5NA 3F7TA 5KYYB 5HTOA 3JD3A 4F5EA 1W9MA 2AOVA 1GAQA 3FI0A 5CMLA 1LZKA 2P2NA 4W1RA 4PTZA 1KC3A 1OLSA 3A2NA 3BF7A 3HLYA 3H5IA 1Z56C 1DWQA 3ASVA 1L4HA 3HLTA 3N2KB 2V0NA 3V2UA 4WJLA 3WZLA 2FR0A 3IP1A 2QW8A 4PC6A 5CLIA 3B1JA 3GYBA 3IBSA 1FVOA 4H6XA 5FNVA 2F4NA 2DPHA 1RKXA 1XZCA 4RH3A 3GFBA 1NBHA 2W4QA 3DZHA 1ESCA 4D8YA 2DWOA 2YHIA 1P9WA 2X2EA 2JCVA 4QDUA 1U2DC 3OF3A 3VO9A 3IA7A 4EMUA 2V59A 1TK3A 5AW3A 2GAFA 1BU8A 2ID4A 1QS0A 2CXXA 4QODA 3R24A 4WXRA 2OZLB 3KETA 4DLTA 1HM5A 1Q3KA 1HORA 4BO4A 4LXTA 3QU5A 4H7EA 1HA3A 5K0FA 4TZKA 1K5GA 4D80A 4R3UC 4ZHQF 1T8SA 2X5KO 3H5AA 3QW2A 3DMFA 1L8AA 2CEKA 3RQSA 4IM7A 3TZEA 4BQPA 5IANA 3C5HA 2AVDA 3SF8A 4B75A 1NFFA 3W5VA 2IDKA 3M6FA 1IHXA 5JPDA 1EK6A 1FX1A 1Z5NA 2AMVA 3CB4A 3M5DA 1U2PA 2ZYAA 3FKSA 3N74A 4ZO4A 2JLSA 2MINA 2QBYB 3OFVA 4JJAA 3T9FA 1ZK1A 4YCCA 1N32B 2WOOA 4DLNA 2CNBA 1AKRA 3H7AA 3PFBA 1TUEA 4AIIA 5K0JA 2GEJA 3KSBC 1FP2A 3IOBA 4F7WA 5JZ9A 3KEFA 2PAFA 4JD5A 4LG1A 1GPWB 4CKBB 1Z47A 4I36A 4D8UA 1XCLA 5BV2P 2PGDA 3AVQA 4WASA 2DB3A 2O3UA 1P9LA 4UNRA 1E1QA 2Q5IA 3PD0A 2JVKA 1QH1B 1J1IA 1B41A 2PUJA 1M6YA 1KKUA 1OGJA 2PFSA 2Z1DA 1W94A 4GNKA 4NL4H 1CZNA 1NU6A 2MYTA 3TLXA 2ZSFA 5C7YA 3LGSA 5JAMA 2NO7A 3PCRB 3NH9A 4G5OA 1QQAA 2I4MA 4YMVA 1J6UA 1DT5A 1RKUA 1DG9A 2QG9A 1TO1E 5DHQA 2JI9A 3T3GA 2DCUA 3V8VA 4IOKA 3CEAA 3K16A 1OTXA 1YQQA 2PNFA 1ISGA 2ON6A 2JAWA 5I7HA 5EHXA 1M33A 2EV9A 2HD4A 5K0EA 5ALXA 1PS8A 1FMCA 3RYIA 1SIWA 5AK6A 1H2XA 5A0FA 1GA6A 3GFOA 2JGNA 4IKOA 4ZOEA 5DYGA 1GQOA 5JQGA 3LFUA 1BGXT 4QEKA 4C2TA 2EKDA 3I3SR 1G3UA 4K8RB 3SAJA 3BXXA 1LCIA 3MS7A 3RFCA 2X77A 1RZ3A 1E3DA 1KOLA 1VKZA 2QOEA 3E8MA 3QKWA 1YA8A 4A6XA 1F8GA 1UBEA 1AC5A 1P2FA 3HPQA 4TT8A 4WOJA 4BE9A 5JRDS 1YGYA 1E0DA 4D4MA 1CHNA 1J7JA 3HXLA 4NQRA 4ZRDA 4V0KA 3VYTB 1O57A 3HKCB 4OFBA 1KO1A 4R8SA 5FOWA 2R7KA 1N57A 3IHKA 4DCNA 1Z4QA 1Z5GA 2L69A 1UXJA 1L5KA 4C6SA 3R5TA 2H17A 1I14A 1I24A 3CVYA 3H4MA 3GLIA 4JT9A 3C6BA 4CV3A 4V0LA 4M7PA 2J59A 1FMJA 2O2EA 1GJRA 2EKPA 2DQSA 1YI8A 2QU7A 2RB5A 3AJ9A 1B2LA 3CUYA 2P3QA 3T3MB 5LXTB 3GJTA 2ZOSA 4B47A 1OXVA 4AD8A 2ZT8A 2PK3A 3HA5A 4MV3A 4L7QA 4BS9A 3R41A 4C1NA 1IULA 3PJGA 1Z6PA 4LMPA 2B4TO 1B42A 3DDHA 3ECCA 1Y4ZA 5ALYA 3A1NA 3AZPA 1DE0A 3FNBA 5IT4A 3S99A 5DULA 4JUAA 4YV7A 2UXDB 1I10A 2FG6C 5GJCA 3W5JA 2VDJA 3UATA 3PIIA 5D00A 1TEZA 2Y66A 3K31A 4MV1A 1YUBA 5JEEA 3RIMA 3GJ5A 1FRNA 3HCPA 4TYYA 3LXXA 1YE8A 4B3RB 1CQXA 3KQHA 3ZU5A 1N78A 5FBQB 1GITA 4A0SA 5IDWA 1HV8A 2WE8A 3IFSA 1W1UA 1IN5A 2RCNA 4LPSA 2YNMC 4UOZA 4ZEMA 3EARA 3R0VA 2XCTB 4R0MA 1W4AA 1QG2A 2P69A 5EE9A 1E4EB 3U3ZA 3C1UA 3HGQA 1FNBA 1GKLA 5E2BA 3IUPA 3ZD8A 5KOJB 1H3FA 3QVGB 3H2ZA 2E3JA 2ETVA 2ZYHA 3UC9A 4BMNA 3QU9A 4D57A 1MRZA 1MPTA 4XLZA 5ECWA 1Y63A 3ANLA 6LDHA 1UZLA 1SCIA 2Y1GA 4YWJA 2G1AA 1X77A 2Q41A 1ML3A 1S6YA 1NJSA 2QTTA 4JXKA 1Y1TA 4EA9A 4YX9A 5AQ1A 1LBQA 4QG7A 1TZBA 3WQQA 4LJ5A 1GR0A 4NCAA 5JALA 2L82A 4QYSA 2XBMA 1V3VA 3OPYA 5TR9A 1LVHA 1KYYA 1QLWA 1KYZA 3OEED 2NO6A 2BFOA 2WY2D 1AX9A 1NXVA 1CF2O 2POCA 4FWBA 5AQEA 4BASA 3KUKA 4HWRA 5FA6A 1N6RA 5EXXA 5JSYA 4BVJA 4MV8A 4LJAA 5AOAA 1U5CA 1HETA 4OMFG 1KAQA 1MPXA 2XMQA 2NU6B 3RFFA 4I1SA 5FYQA 4R41A 1HMYA 3BXHA 4QQ8A 5B2EA 2O8NA 4RTPA 3ZCSA 3QUAA 3H3FA 3NHPA 4D0GA 1KGDA 1DEHA 1LW6E 3LA6A 4UATA 1LK7A 2BFDB 3DP7A 3QEMB 1BDJA 4S1TA 1AGNA 2YICA 5JZOA 3EASA 4XB1A 4PIVA 2D06A 3EF3A 1SRQA 4OY3A 3OCUA 4KN6A 4RD1A 1QYVA 4O4LF 5E2AA 5EP1A 4BFWA 1EJ0A 1G5HA 2PHZA 2R7AA 4U3JB 4D8XA 4BV2A 3VNVA 4C9BA 2F59A 3PEEA 1STOA 3LT4A 3SS9X 3WRXA 5K2OA 2I78A 1VRVA 3H4IA 2NVBA 1VG1A 1XRJA 3ND6A 2X8WA 2E4YA 1O7JA 3H9BA 4O2AA 5LP6C 4DDMA 5K0BA 2B9VA 4A23A 5B3LA 1DIGA 4RLFA 3AONB 1DC3A 3BKWA 1Z68A 4WK2B 2WUWE 3EPPA 3I53A 1KOGA 1FX0A 3F47A 3FA2A 5K3SA 3EIQA 5K8CA 1UAGA 4GZMA 1F4PA 4DA9A 4CEHB 1ZVKA 1JGTA 5DM2A 1FFWA 3M6IA 4QA9A 2F64A 3H1EA 4CG3A 5BQXA 1ZWLA 2I4TA 2ZJOA 3WK4A 3I28A 9ATCA 1AM4D 1QVZA 1MOQA 4AROA 4YBZA 1IAQA 2NTYC 1E9CA 3DOIA 3NOQA 3TB6A 2WTMA 3FTCA 4V0QA 4D26A 1C7RA 1PFWA 1OXUA 4YDHB 4GI1A 1VGRA 4IIBA 4JMLA 4YNBA 5A4DA 2XUIA 1JQLB 2NSDA 2X1MA 1CEYA 3VNRA 1UC8A 2ZR8A 4U7GA 1UWVA 3KOOA 3L1VA 1W88A 3LY5A 5BURA 1CRPA 3A1EA 4DABA 2OYRA 5FTLA 1HNXB 3NGXA 3KJQA 4XDGA 3H0CA 1PR5A 2KX7A 4B87A 4K6CA 2E4AA 3I1FA 4B82A 4D3SA 3RVSA 4C0LA 5K7SA 3CO5A 4JVSB 2NYRA 2ODEA 5FV4A 4A0RA 1YS4A 3BRSA 4XEHA 3E7FA 4PIPA 1GL7A 1KEWA 1DUVG 2FZ4A 2IEZA 2LV8A 4H08A 4NATA 3LIIA 2WWVD 3Q2OA 1U0HC 4P4SA 4EYQA 1MAHA 1PD1A 3DT9A 3QEAZ 1RWVA 1KDOA 3P4UA 5KNDA 4HQLA 1Y3CE 1SB8A 2OHGA 3QLUA 4CWAA 5D2CA 3JX9A 2JHGA 3MFYA 4E09A 1IATA 1YZNA 5LP1A 3G17A 3PWSA 3WKCA 1X7YB 5EKUA 4UAVA 1X94A 4HS9A 3PDCA 3WAGA 1SG0A 2BKXA 5AOVA 3BH0A 3WYBA 1FXUA 1E6UA 2I2DA 4D8TA 3CXUA 1URPA 5ALSA 4E1AA 3GOHA 1P4SA 4UHFA 1UMDA 1W85A 3IRUA 2CXPA 4QQNA 3CTMA 4G1MB 1EBUA 3NYIA 4I9FA 2WZQA 4M0CA 4HH3C 2O19A 3A9WA 2R6GA 5BN4A 5KYWB 1DEOA 1RNLA 1BKSB 3MC1A 4GF5A 1IAVA 1V5EA 5ESRA 4XDZA 5IT5A 3TTYA 2I80A 4RY2A 4AU1A 3GFGA 1KVTA 3ZNPA 2YJZA 1P5JA 1D6SA 5BR8B 5NULA 1TT5A 2BUBA 3IPYA 3ZH9B 2BTOA 4DT1A 4OA5A 1A9RA 2DKNA 3NGMA 4RL4A 3VBEA 2FLWA 3A9SA 4IGFA 1H4VB 3HL0A 4DQUA 1QP7A 3JAKA 4N7RA 4Q4HA 1SELA 2JLZA 1R9GA 2ZSHA 5G4KB 4IYJA 2FMIA 3VR2A 1J49A 4DG8A 4AZ0A 2GEVA 2J3MA 4DREA 5C35A 5ALTA 2OXIA 3PDIA 4J29A 1PQUA 2R97A 3C6QA 1NQOA 3CLUC 3Q9UA 1Z18A 4YGYA 1JVSA 3SYTA 1JG6A 5KJ1A 4QQKA 3TB4A 2JHFA 3GFTA 1D6MA 1TU0A 3PR1A 3D7NA 4WXPA 4CTJA 1QHGA 2I1WA 2YCLA 3C45A 4ODIA 3U13A 3WNQA 1JG1A 3FYTA 4DQKA 3DZ8A 2WFLB 4ZKDA 1N8TA 1XWIA 5FP0A 3P45A 2AN3A 3NV9A 2LIVA 2NTJA 3GAMA 1NXOA 2H2FA 2VZLA 4LWQA 4LJRA 1VPEA 2I3AA 4CM9A 4BP3A 3GBVA 2GPWA 2V03A 4JUFA 1IPEA 2PQ2A 4HKTA 2I99A 2W9XA 2FQQA 4IV5A 2O57A 3RJ9A 1V4BA 2BGGA 3THSA 1G1MA 1E6LA 1NPYA 3LTEA 1A7UA 2BR3A 1IJFA 1OFUX 3AFOA 5LLDA 1GG2A 3QE9Y 1MABB 2DGDA 3G02A 4N18A 5GQSA 3K05A 2H4YA 1K6EA 3FIJA 1LTQA 3A9RA 2ACKA 5EHQA 4OK6A 3ZHOA 1PO7A 3A4TA 4FDMA 2EGGA 1DFHA 4B6JA 3NC4A 4F4CA 3TE7A 4IIUA 3QA3E 1IOVA 5L4LA 1EK1A 4IP0A 1R10A 1B76A 1U3FA 2X6RA 3FUUA 3K0FB 3PA8A 5DIZA 2XHEA 5SYNA 1F4LA 4K86A 3WB0A 3WMWA 5KHLB 2OT3B 2Y92A 3D81A 4L9AA 4G0WA 5A7HA 1QM5A 3ONFA 2X9GA 1OYWA 4PX2A 3HEMA 4D3DA 3DDUA 4NOLA 2FX5A 3OFSA 1MB3A 2P8JA 2ZBUA 4QOGA 3IJEB 2BW0A 3D6NB 1USKA 2OVFA 3LQ4A 3FPHA 4CIXA 1OWMA 3C6ZA 2R6R1 1JDSA 1DBIA 1GV1A 4HC4A 4MS1A 5DIFA 2HIGA 1U28A 4GWLA 4OQFA 2HA5A 4P32A 3AJDA 1YI0A 3EGCA 4MMXB 4Y8VA 3RV3A 3SQNA 5A5FA 5I9LA 5H9VA 5C46F 2Z83A 4NWIA 2JZOA 3FZEA 2B1GA 4QARA 1EVJA 421PA 3GVCA 1EGAA 1EQ2A 2W2VA 9MHTA 3F98A 3L9XA 1S4MA 3GZNB 2XWSA 4JP3A 4HQFA 4E5KA 5HRAA 2QUZA 5GOZA 4LDRA 4MW9A 1GU1A 4KR3A 5F9FA 2BT4A 3WB1A 2AMLA 2GD2A 1MV8A 2W6CX 3R6GA 5AW6A 3ZPXA 5IZCC 2B5OA 4RHTA 4BQIA 2ZJ0A 5U4XA 2O48X 4G89A 3WWEA 1NUUA 1TO2E 4E22A 2RBGA 4EFDA 1YZQA 4BFSA 5BW8A 1Z63A 3TSZA 2P77A 2AQHA 1FRFS 2WC1A 3K0BA 1DG1G 3ELYA 1KEVA 2X41A 3LWDA 3QMPA 3N58A 2W6ID 3CW9A 3AEKB 1MQ8B 4HF7A 3T7DA 5K51A 2I1QA 2A9OA 1ZUWA 1T2DA 2C58A 2VJDA 4S12A 1WP4A 2HCTA 4ESOA 4JQZA 1Z34A 4X7BA 5BR1A 3VDXA 5BR4A 4P4UA 4OOFA 1YBFA 1MENA 2FN7A 2WD7B 2ODBA 2XGOA 1Z7GA 4P92A 4E7PA 4Z5XA 5IEJA 4BE7B 2XJ9A 4LF8B 1RVV1 1H0KA 2OSBA 3IUNA 1C8VB 3QPWA 4CLOA 1VJGA 4I19A 3GL9A 3S2YA 3WQBA 4HB4A 3N2LA 4GRIA 2D5CA 1T4DA 1OZHA 4HAYA 4NZ9A 2VHYA 5FB3A 5B12A 4HFNA 4LKOA 4YUXA 2D6FA 1DLIA 3PUIA 3IMFA 3R09A 1LW7A 4TLLB 4L3OA 4WOPA 4X91A 1W36B 4LOKA 4WECA 1F2TA 1QCYA 3FCYA 3EEOA 1TI7A 2HLNA 3H9UA 3M6LA 2XSZD 10MHA 1J8YF 4OI0A 4GWKA 3EZLA 4V3CA 4DB4A 2AVNA 1QAMA 4TX1A 4W99A 4OL9A 5EGNA 1T3TA 3KQLA 4EECA 3U48A 5CDGA 3IVGA 3EVNA 4MI1A 1T8RA 2VCHA 2QJTA 2DSTA 3IKVA 1D1QA 4PNHA 1YZTA 2HM7A 3BA1A 3L7OA 4AMGA 1UBUS 4MVXA 1US8A 3MBOA 4D25A 4L75A 3ZDAA 4UU7A 4IMIB 3CWCA 3GGPA 1BYIA 1K88A 5TQ0A 3ES9A 2VDNB 3LHDA 2Y1OA 4JJEA 4L3WA 4QJ4A 3WLMA 3VNUA 2O8DB 3EXEA 1KI1A 1UQTA 3U40A 2KLHA 3L7AA 4AN1A 5LOVB 3QYJA 2XTAA 3EY4A 4RGQA 3TTXA 4AZ3A 3ROXA 4PNEA 3S81A 4TPKA 1ZUHA 3AERB 1Y5IA 2JLAA 4UNSA 2UYGA 3PJFA 3WGKA 4BQNA 4IIEA 3L0CA 1Q1BA 3CLKA 4IQ4A 4Q48A 4L8LA 2KHZA 3I6QA 4ZAWA 1W52X 3GRYA 5J4KA 5J59A 2V6JA 1LDBA 1EI9A 4G8DA 4DR1B 5KYNA 1O6FA 3VMFA 3NU1A 3K4PA 2FPMA 4EFKA 2NU9A 3CZCA 3MIIA 2QIPA 1PT8A 5J40A 1NIPA 2P9TA 2BN4A 1DIOB 3C8UA 2XE8A 4HEA1 1KQNA 1KGSA 1UPTA 2GUGA 3ACBA 4HDQB 4H7KA 1JBKA 2Z9CA 2OO5A 4H3SA 4YP7A 3QMMA 4G4SO 3UJAA 4X1YB 2VN8A 3D02A 3CUTA 4HWGA 3MN1A 4OJTA 5CH3A 2AFIE 1LDNA 2GK3A 5EZ6B 4GEKA 2MCFA 2GN1A 3IIIA 3UUEA 4CETA 3ZDCA 1HYGA 1IZ7A 4MUGA 5BYBA 2JCBA 1AQIA 3ZVRA 1EFHA 2FI1A 3PPVA 1L7NA 1PLKA 1G6KA 3GRVA 4GE3A 4KMOA 4ZAYA 3A36A 1I0LA 1CC1S 4ETNA 2VATA 3SSNA 1EM8A 1PEDA 1HDXA 4C88A 2J0VA 2G3YA 4DM4A 1NVXQ 4YALA 1KH3A 1MLDA 3MVEA 2C9ZA 4IXWA 4OBBA 5LQRA 2AZTA 3W79A 1BG6A 2RC6A 5IJ0A 4MQEA 2EC5A 4TYNA 2VYVD 2J0UB 4YYZA 4HNUA 2XRMA 3FYHA 4QO8A 5CTAA 4B48A 2GJ8A 2IHVA 4R2MA 3RSFA 2Q5JA 1Q7BA 4AKEA 3H8VA 1H8HA 3M9LA 4X7MA 1O77A 3G2JA 4LMBA 5G1OA 3E4DA 1V16B 3ESQA 2X7XA 2I5PO 3GRKA 1KY3A 4J90A 1A5TA 4GQAA 2HW8A 1DI0A 3GQVA 5I7EA 1TADA 1ZGAA 1B3RA 5JFTA 2WVJA 2G67A 1FBTA 2A94A 9GPBA 4YMSA 1WMAA 3FPBA 3QKSB 4YXWD 4IXDA 5I4IA 1OR8A 2HRZA 2YS7A 3BFXA 3EPRA 1QUEA 1DDGA 2L19A 4LX0A 4O5OA 4MO9A 2J46A 3UG6A 2O8EA 3U3XA 2O59A 4MJ7A 4AUEA 3H2HA 2IYYA 3MLEA 4OXRA 3G6WA 5EJ9A 2XMBA 2VP4A 4CNBA 2ADFA 5FWDA 2J4CA 3ZWBA 3G9QA 3I3OA 1V48A 3SZUA 2VA9A 3PXEA 1KHHA 3KPWA 4D43A 2YMLA 1PN3A 3FOFC 2QB5A 1PP4A 3B7WA 3KZMA 5J5AA 4J0QA 3ENNA 2PUBA 4LY9A 4H1HA 4AF8A 1AS3A 3NTRA 4BGEA 1AIPA 2HJGA 4M4SA 3KR2A 3DKVA 2ZP1A 3EODA 1Y7IA 4FSDA 4MCHA 5L51A 1QTRA 2BDTA 4LFBB 1MCZA 4PZZA 3BL8A 5KHAA 4D4KA 4PF1A 2X1LA 4EGFA 1ZITA 4IJUA 3KCNA 1P8JA 3UK1A 5B37A 4RDXA 2ZBPA 1PNOA 2VTDA 1KYQA 1P3Y1 4PPGA 3LNTA 1SCQA 1U0SY 2A30A 2NADA 1ZMBA 4PZEA 4QPPA 5I4KA 1JFRA 1LBHA 1JHDA 1CB0A 1OY1A 1R4MA 2FEMA 3P71T 5FL7A 5BRAA 3SVLA 1U4OA 4KQEA 3DE2X 2O1SA 1AO0A 5AYVA 2I2BA 3U7HB 3PRJA 1E3TA 1GYQA 1ZJJA 1R6BX 2VWGA 3FYCA 3NKVA 1K2VN 3OX1A 3G8CA 2BM0A 4JGIA 4MNTA 4TLMB 2QX8A 5EIAA 2P2DA 2KE5A 4XA8A 1C1XB 2IYOA 3D6VA 4AJOA 2WV7A 4FGKA 4K9MA 3EPKA 3BWYA 3VHXB 1DJOA 4R3NA 4WDRA 5ADWA 3BEDA 5E3JA 2GKOA 3OWHA 3BTOA 1GZ4A 2JRLA 3ZY6A 2WHPA 4F46A 4MYCA 3E03A 1YDFA 3P9NA 3W9UA 5I7FA 4I55F 1OFUA 1SHLA 1W581 1FNNA 2E2WA 3QVWA 1N3YA 2ZUBA 2EL9A 2FEKA 3Q72A 1IN8A 2PMDA 3L0ZA 1VLQA 4HVTA 1HFWA 3WGYA 4OBEA 1YR7A 3V4OA 3GP8A 4UDYX 1DTSA 1NPTO 5AI4A 1EK0A 2AG0A 5H02A 4MEJA 2AFVA 3DD1A 3UHOA 2YOHA 2BKVA 4EHBA 3A6FA 3IP7A 4B83A 2EIHA 3QTBA 1KWGA 5CFZA 4NYJQ 4MJLA