2CLCX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gtp (2)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide-binding protein
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2clcX00
1YQTA 2A7QA 1RRGA 2J0SA 1E2FA 1G41A 2IUTA 2XOKA 3RWMB 2FJUA 3LX5A 1D2EA 5JHHB 2VLIA 2GXUA 1FUKA 1GM5A 1G8PA 1FPMA 4ESHA 2GK7A 1ZRHA 3CPEA 1L4UA 2O8EA 2WJVA 4Q00A 2C04A 2OO7A 3I5XA 3QBVA 4F4IA 3PV0A 1CRQA 3RANA 1G7RA 5L3VA 3U4QB 5JHGB 1TNDA 2V3CC 4OBEA 2YC2C 4ARZA 2IYSA 5DGXA 4PC6A 1CRPA 3AH8A 2CL7X 4NCIA 4A82A 5BYKA 4ZCMA 4NCJA 4ZPXA 4RKEA 2VA8A 5DH9A 1M7GA 2CNWA 4PC1A 4OI1A 4Q21A 1PLLA 1N6RA 3UATA 1LFDB 1LVGA 3R7WA 1AA9A 1Z8FA 1ZC3A 1KI6A 3WBKA 2H5EA 3PEYA 1X8KA 4ZDKA 1K8RA 1GNPA 1JAHA 1N5KA 3WYFA 5DE3A 4B43A 3CX6A 3GLIA 4M1OA 1JNYA 1ZJ6A 1VYTA 2ODBA 2QEQA 1G20E 4IVRA 4Q7KA 3GLFB 1Q12A 1R4AA 2DPXA 4TYPA 1UJ2A 1CJMA 2PT7A 3CNNA 4BLOA 3V00A 1TTTA 3S1AB 1ZCAA 4I4LA 4Q5IA 4GT1A 1IN6A 1PZNA 2VH5R 2BMDA 1LF0A 1KNXA 1CJUC 1HY3A 2ZYWX 3Q8XB 3QG5A 4LJ9A 521PA 4BFYA 2ZROA 2JJ2D 4V0KA 5TVKA 3SHFA 1P9NA 4Q03A 421PA 4L16A 1E32A 1FNMA 4E03A 1W0KA 2VP6A 1GIAA 3KTAA 1HQCA 4PHHA 1T5IA 4TL8A 4JVNA 4KYUA 1NIPA 4O0MA 4BLPA 1S3GA 2ATXA 2XTZA 3CIOA 4LY6A 2AWNA 2AR7A 2X77A 3K1JA 2J7PA 3EIEA 2C98A 3THWB 3D3QA 2CLSA 5KU1A 4XD7A 4QHYA 1Q44A 1AQYA 2VHJA 1JB1A 3QKRA 1XJCA 4G5RA 5AJXA 2DR3A 2MMGA 3THOA 1O3YA 4B3FX 4OQNA 1XU4A 1QRAA 4X8OA 3PUZA 2XZLA 1GL7A 3AGPA 1TUIA 4PC3A 1CR4A 3OAAA 3TUIC 3U6KA 1NN0A 5FUXA 3VU9B 2RGXA 2OESA 1FOEB 4ZKDA 1QHHB 1BYIA 1XTRA 2GCOA 3CH5A 3K9HA 2XEXA 1EESA 1W4RA 4LGMA 2XXAA 5J4YA 1ZD9A 3L0SA 1E69A 2SHKA 1BIFA 1PLJA 4UNPA 3UPUA 4EPYA 4C0HA 2AFIE 3EZ2A 1ZYUA 4PHTA 1X86B 4Q9HA 3A36A 2YV5A 4UNNA 3NBZC 1N3BA 4I1OA 1X3SA 2ZAMA 4A15A 2IK8A 1ZNWA 2WJYA 4JJKA 1VG8A 3OIVA 4US1R 3VKWA 3TW4A 3QNUA 1UAAA 1B23P 1CEEA 1KSGA 3QKTA 3N70A 1UBCA 3KKOA 1DG3A 5CDFA 3SBDA 1RW4A 1N6KA 1D2NA 3OFNA 2WWXA 2ZVQX 4MDFA 1SVMA 1XXHE 4UNQA 4QJ3A 4C0SA 1JQLB 4LV8B 3K0SA 1RYFA 2I1VB 2C5LA 2DY1A 5JFGA 4JLVA 4XWOA 4XSGA 5JRJA 3GLHE 1YJ5A 3IEVA 3Q85A 1WXQA 3LV8A 3GEIA 5FOWA 4C7OA 3VKHA 2R6CA 4HI0E 4LJ7A 3TQCA 3ZD6A 3K0CC 4JLDA 3DO6A 4TMVA 1XWIA 2TMKA 1M7BA 1MV5A 1Y3AA 2VIIA 4Q4JB 3K0AB 1S8FA 3B2EA 4QHSA 3A1SA 3GFPA 2JJ1D 3X1ZA 4DDTA 2J1LA 1Q20A 2I4IA 1XTKA 1Q1BA 2A5FA 3FKQA 3T12A 3RDPA 4EIWA 2G0TA 1EK0A 3L0IB 4XJXA 1RZ3A 1VIYA 2FSHA 3T5GA 4DSNA 4CEHA 1EFTA 1IN4A 4TMWA 1W2GA 3V4FA 5JSZA 3ADDA 1GNRA 2JIZD 2QE7A 3U3MA 1SVIA 2PEZA 4D0GA 4BFUA 3BIFA 4GDFA 2C03A 4IKEA 4MYTA 4B2LA 2H8KA 1AGPA 5KDDA 1XMSA 2ZI9A 4FCWA 2P2LA 1YZTA 4KYIB 3I62A 4B3BA 4NCHA 1AKYA 5FOXA 3PITA 2EFGA 1KI1A 2ODWA 2GJAA 1E1RD 1E0JA 1T8UA 2CCGA 4JLOA 5HE8A 3RS7A 3KQLA 4URWR 2ZSAA 4LJYA 3QENA 1XDBA 5K8IA 1D6JA 1W48A 1Q1EA 1CU1A 5H8WA 3THYA 1UKYA 3Q7QA 4JLPA 3TJZA 2IW3A 5C4GB 4Z51A 3KQNA 4R2HA 3ZVNA 4AKGA 2DFTA 5JMTA 2QTVB 4TT3D 2G1JA 4B32A 5CK4A 3UKDA 1ONBA 3QUSA 4IHQA 4BEBA 2MSDB 1VHLA 3K8YA 4RD1A 2ZUDA 1RVDA 5JWOA 2OBLA 4PX9A 5J40A 4QM6A 2OFOA 1GRNA 2ZJBA 4LJ8A 1SHZA 3R9XA 2B6HA 4I99A 3F5FA 4BECA 2JLQA 5FOVA 1XZPA 2VEDA 2XSZD 1AJEA 2EQBA 2FPKA 2CHQA 3GMTA 2O8FA 1MO4A 1PJRA 3KKMA 1NY5A 4V0MA 1NJGA 3TSWA 4B33A 5JEDA 1N0UA 2UZ3A 3LBHA 2FX3A 1DOAA 1UBFA 2J0UB 4PPQA 1ELOA 3FKSD 4YDSA 3U3KA 4B73A 1HT1E 4F4CA 2V1XA 2JLYA 2JLXA 1TEVA 2BDTA 5EXXA 4Q9IA 3BORA 3KUDA 2OFXA 3GLGE 2JDIA 3G5UA 4OHVA 1E94E 4ZIRB 1XXHA 1KO8A 2Y8EA 1KMHA 3B1XA 4Y0VA 3KX2A 3VNUA 4DRZA 1FP6A 5TDHA 3RAPR 2BC9A 3MGCA 3QI2A 2NQ2C 4G5SA 4BPBA 1RC8A 4RY2A 2ECKA 4B6FA 1E0AA 3AV0B 4QBIA 4JLNA 4Z54A 5SZIA 1AK2A 1BYUA 2Q9AA 5GJVC 5BN3A 1I2DA 5IF9A 4UJ3A 3NHBA 1XEFA 2ZR0A 3WYGA 3ZZUA 3EXAA 3DOEA 3BE4A 1KZ7B 3K0FB 4Q1AA 1XPRA 3ICQB 1NJFA 2R6AA 1G3UA 2NPFA 1EGAA 4GI7A 3EPHA 5EUQB 4PPFA 3PXGA 3AVPA 2HF8A 2DFKB 3FMIA 1P2UA 4IXNA 5UKDA 2CLDX 1H8HA 5L3QA 3X2SA 2FPLA 2YINC 3QEJA 5KNCA 4NMMA 3Q3JB 1W49A 4Q4LA 2IYUA 2PBRA 2CHGA 3NC1C 4L5BA 3BXZA 4ABYA 1A2BA 2IF0A 2RKOA 4PPNA 4LV6A 4JMPA 3KDSE 4RZUA 4PFSA 4IOMA 4FMDF 2IUUA 3VR3A 3T1OA 2AXNA 3SQXA 3C14C 4NKRA 4A2WA 4M9SA 4II7A 1J99A 3K0CA 3MWLA 5HKKA 3G82C 3V4RA 5J4HA 5HCIA 3T34A 2IWRA 1GFIA 4HATA 3CH4B 4JSYA 5CJPA 3AVXA 2ZJAA 2ZRFA 5GJCA 2O52A 1NY6A 3THXB 4OK6A 3RS2A 2BV3A 2IEZA 1EXMA 2XX3A 4LPSA 2F43A 4PQYA 5H68A 2ZRMA 2IXFA 1DVRA 2FSFA 2XAUA 2R6GA 4A36A 1Z0KA 4V0OA 1MKYA 3TVTA 2G6BA 1T5LA 3ECCA 4HZIA 2EVWX 3TRFA 5AUPB 2GJ9A 2QORA 3F8TA 4OYHA 3KL4A 1A82A 4Q4AA 2WJJA 1KSHA 2IHBA 3B8HA 3FHTA 1OB2A 2ZRHA 2H1LA 3UIEA 1U8YA 1S2MA 2H16A 5D3MB 3U44A 2G88A 3I32A 1QG2A 3NG1A 4B3XA 2IUSA 2XGJA 1KSFX 3CF6R 4OHWA 2XZOA 4M2LA 3B60A 1FX0B 5GVSA 2VTKA 2NO0A 5JWRA 2P67A 1RIFA 2RH5A 1JR6A 3HPRA 2F3TA 2HJGA 1P75A 1U99A 3RWOA 2JLVA 3OE7A 4DUGA 3FWYA 4M0LA 3EZ7A 3QKSB 2D7DA 1EFRD 3AF1A 4CVNA 1MRNA 2Q9CA 4BRUA 3QJYA 1WE2A 2XTMA 1E79D 1E2QA 1LY1A 2NZJA 4TSFD 3TIFA 2E1RA 1ZNYA 2IYWA 2OV2A 2ZYUX 2GETA 4IFBA 2D2FA 4BEJA 4URXR 1ZBDA 4D4JA 5J5CA 2K5UA 1OIXA 4WZAE 2RGDA 3B1ZA 1KI3A 4WA7A 1AS0A 4EPVA 2R8RA 2WHXA 1N6HA 4WOPA 2O8DB 4HB3A 3K53A 3ZD7A 4C30A 3QE0A 3W8RA 1H8ED 5L8VA 2WOJA 3H2YA 2BCJQ 3FFAA 4EJSA 3SYKA 4US2R 5KSZA 2VYFA 2RHMA 4AI6A 4LSGA 4LYJA 4ILEA 1E0SA 1J8YF 3PEVA 5A0FA 4CGZA 2QUZA 1UEIA 3A1TA 1GTVA 3ZH9B 2O8CA 1VTKA 4RD4A 3OEHD 2ZM5A 1AZTA 2N42A 4G01B 3LVQE 1Z0JA 2CK3D 1ZAKA 4MRSA 1KDTA 1N6OA 2PZFA 2IYRA 1Z6XA 1G5PA 1DELA 1SVOA 2H7VA 1LW7A 3PQCA 5EP3A 3UG7A 1JALA 1R5OA 2HT1A 1E9DA 2VP2A 4DWJA 2VSOA 1N5LA 2QAGA 3BBPA 4UJ5A 2NG1A 3AGQA 3MD0A 4B2IA 1S96A 1JJ7A 3LVRE 2QL6A 4A6PA 3DKVA 2YOHA 4X8MA 4ZV4A 3CR7A 5IK2A 5DYIA 1OXSC 4PZYA 1A1VA 2F1HA 3SU8A 3UMSA 2D74A 4KCGA 2ZYVX 4K8OA 1QG4A 5KHOC 1E9RA 1U94A 1R7RA 3FGNA 1N6LA 3CLVA 2P6UA 1TQ2A 1QHYA 3K70D 1U0HC 2G3YA 2VO1A 2FFAA 2IBMA 2R65A 1N6IA 3EIHA 4MRPA 1NRJB 3EA5A 1KJYA 3U60B 2OFWA 3VAAA 3SJAA 3KJIA 3LLUA 5CB6A 5FPKA 2IA5A 3PCRB 2ZXUA 1E2DA 3DOFA 2J0VA 2WWGA 3GJ7A 5DYGA 3T35A 2R2AA 4YQFA 4MRRA 3ZQJA 3K70B 2ZI4A 2RB4A 5IDVA 1MOZA 4JVSB 3A37A 4N3NA 4CZ2A 4DLUA 3LDAA 2GJ8A 2JEOA 3KB2A 5FTKA 2Z6VA 1P2SA 5EXSA 3KXIA 3NXSA 1FL9A 4Q1BA 2REBA 1G5TA 2CVHA 2WSSD 5JZVA 2O8EB 2FZLA 1FP7A 1QBKC 3B1VA 1V43A 3BRWD 1E2EA 3KB1A 2DBYA 3CONA 3H86A 3OHMA 1AKEA 4N0EA 3TE6A 4D4LA 2JLUA 3CRQA 1NNEA 3W6PA 4BZPA 3U3JA 4A2PA 4D4MA 3RHFA 3RRNA 4RFSA 1JECA 3BC1A 2NGRA 2JGNA 3ZJYA 2WMNB 5DHAA 3CR8A 3LW8A 3WHKA 1ESNA 4AYWA 3KJGA 2GK6A 3CO5A 4GZMA 2CJWB 3CNLA 4MRNA 1NMZA 4DT1A 2DYKA 4IOLA 3R7WB 4ZI3A 4MGKR 5ELXA 3C8UA 1I4TD 4M1YA 1KI6B 2OXRA 2Z43A 3BOSA 2MMCA 5KUTA 4HUQA 3KUCA 3QXSA 4MUBA 3GFOA 3SN6A 3QQ5A 1UBEA 5EZ6B 4CT5A 3CNOA 3FYHA 4R7ZA 3IQWA 4KITB 2QU8A 1VKJA 1N5IA 1P73A 1ZNXA 1OXTA 1KAOA 1G5RA 3D7MA 3A4MA 1TF7A 5KO2A 4GNKA 1U98A 3VR4A 4MYUA 4QBFA 2G1KA 4E22A 3KTAB 2OT3B 1YZUA 1KI4A 2ZE7A 3WMEA 1ZP6A 2ZI7A 2GEUA 1MT0A 2J59A 2B7BA 3JVVA 4A8JA 3PENA 2NOAA 1RRCA 3ZIAA 3NDBB 3U2QA 2GNOA 3HR7A 1W5TA 5EP1A 3TGPA 1Q22A 2P5SA 2R44A 2FV8A 3E5HA 3MLEA 3HYRA 3QKRB 4LZZA 2HEIA 2JLZA 4IDPA 5FUYA 1F3OA 1U0LA 2JCSA 1TQDA 4URZR 2ZRKA 5FBRB 5JBQA 4PQFA 1LNZA 3BS4A 2CHVA 1IXZA 1NN5A 2BMEA 3BD9A 3CW2A 4LWZA 4MKHA 3MUFA 3T06B 4TLBA 1T0HB 2I3BA 5JECA 2JLSA 5KTYA 2GCOB 4Q1FA 1UADA 2ASEA 3DM9B 2XXAB 5KPJA 3UWOA 4ERNA 1WBBA 1NG9A 5AJWA 3B1WA 4NU0A 2IS6A 2BKEA 3K9LA 3LD9A 3CB4A 1ZMXA 4MGIR 1SKQA 1KZGB 4RSGA 3B9PA 2AK2A 4GRAA 1OE0A 4DDVA 1VECA 2QAJA 3U7EB 3U7GA 1S1CA 1Z22A 1OJLA 1KI2A 2GILA 2QZ4A 4LUCA 2DFNA 4V03A 4CEJA 1VCOA 4BFXA 1OIVA 5LBIA 5HR5A 2AXPA 1AZSC 4PC7A 4DBLC 3ZZ0A 3O47A 2BMJA 4W7SA 3AVVA 3VX3A 1NSTA 1E2MA 1OKKD 3NIBA 2GXQA 4PQRA 1GP2A 4NTZA 4AG5A 4TWZA 2ZJZA 4UNRA 4HLUA 4Q1DA 4JSTA 3PEWA 3IPYA 3GJ3A 1IQPA 1GNQA 2GEDA 5FTNA 3DM5A 1NL3A 2F55A 3SR0A 5KDOA 2Z0MA 4IVPA 1FQKA 1G64A 1R6BX 2XNDD 4DLSA 3UMFA 1OYWA 3O8CA 4HDOB 3W6OA 4P0TA 2ZANA 1E96A 3LXRA 5JS7A 1G3RA 1ZUHA 1QVAA 4EQ6A 2GESA 5DLQC 1EWQA 3U3OA 5GADl 3WNBA 3Q9LA 1ZM7A 1TADA 3FE2A 5CM8B 1NKTA 4B3DA 3PUYA 3L8YA 2D06A 4I1SA 1TF2A 4E07A 5LD2B 3A1UA 3TK1A 4CEHB 2OCYC 4B34A 1ZUIA 1XEXB 3PIRA 1ETUA 3WBJA 1NVXQ 5JSZB 4NYIR 2WPDD 1CIPA 1DBSA 5F2EA 5LB4A 1OF1A 3IPXA 4BASA 2ZS8A 3H1TA 3H84A 1EFCA 1QHXA 4YXWA 3X1YA 4DB2A 2REOA 1SXJD 1M34E 4RCYA 4QM7A 4F4JA 4HEJA 4TYQA 2W6JD 2ZI3A 3N2EA 1E2GA 1DAIA 4RD0A 1P2TA 1KKLA 2D3WA 4JLBA 4BFZA 1Z83A 1YZKA 1ZU5A 2ZRPA 4Q4HA 3W9YA 2FSIA 2QG6A 3OEEA 5P21A 1YR6A 1T3LA 1X8LA 2VHUA 3H4MA 3GLFE 2QSYA 3TKLA 1SGWA 5J4KA 5KSOA 3Q7PA 3GD7A 4Q7MB 4KHZA 3THYB 1SXJB 4EPXA 4Z1MD 2QSZA 4S35A 5CIWA 5DSZA 3VR6A 1E2HA 4M8NE 4KLZA 4YLGA 2OM2A 2V7QA 4DB4A 1UKZA 2GBLC 4M1TA 5AR1A 5E95A 1QVRA 5FBQB 1YVDA 4MKIA 4K46A 5J4LA 4LJ6A 1XPUA 3DVLA 5DIFA 1NLYA 4JL8A 4ZI2A 1MR3F 4F92B 3C15C 2Z4SA 1FMJA 4QBHA 2AX4A 1ZM4A 2BEKA 4QNRA 2KBFA 4R2IA 4TQ9A 3J81k 2DWOA 3T1QA 4Q66C 4IVQA 2RGAA 2IYTA 3MWKA 1HA3A 4RZXA 2GF9A 3QG1A 2HCBA 1ZM3A 4Q9KA 4O3MA 5AJZA 2J5XA 3EPLA 4QGGA 4HZUA 4URVR 2WAYA 1DAFA 4Z8YA 2O8FB 3LH5A 1WDTA 1F2UA 3WYAA 1GL6A 1N5JA 5C1BA 4OQLA 1PV4A 4AK9A 4HLDA 2X2FA 2GZDA 2PMDA 3QPUA 4Q02A 3A1VA 3ZS8A 4ACBA 2QBYB 4FINA 4C0LA 1ESMA 4RCZA 5JJKA 4KFTA 5H70A 5KDLA 2BJVA 1QDEA 1KMHB 2P65A 1DAEA 4FXPA 1F2TB 5EQTA 3LW7A 1FFHA 3CF0A 4XSHA 4AKEA 1YZGA 4JLMA 4JS0A 4BLSA 1E2JA 3EARA 2ZSFA 1TF5A 2C95A 4P4SA 5CM9C 3FDIA 3D8BA 4LX0A 4OQFA 1DPFA 2BBOA 4M1KA 4A0HA 2LWIA 1T9HA 4UXIA 1A7JA 1M6NA 1E6CA 1NLZA 4N1AA 4TLCA 3U61B 1W7AA 1NLFA 1SKYB 1RPZA 4U00A 4M1MA 4NHOA 3PUVA 2O0HA 1DTSA 1TL7C 2AKAB 2B92A 2D62A 2IYYA 5TMPA 4E5UA 1P6XA 4TYWA 1U9IA 4LBYA 4YMTA 3IILA 4NYIQ 1G17A 1SVWA 2RGEA 2ZI5A 1Z5ZA 5BWMA 1DO2A 2ZSEA 4XTCS 4AYXA 1IN7A 1W0JA 4B47A 4ESVA 8OHMA 4GSYA 1H65A 1II9A 2F1RA 2NTYC 2ZSBA 1QZXA 5DISB 5KSYA 5L3QB 1BH2A 2ZRNA 1JXOA 4QRHA 1GZSA 5IRCD 2QROA 2KI5A 3NHAA 1AM4D 4DVGA 3SBEA 2IX3A 2GF0A 3NTUA 2GDJA 1G19A 1P62B 1YR7A 1DEKA 1W44A 5E3HA 1C9KA 3RS5A 3HPQA 1KK1A 1ZC4A 2F9LA 3BB4A 4WZ6A 4R9UC 4QG7A 1GKIA 4QC2A 4CT4B 3QVUA 3RRYA 1YRAA 3RC3A 2VP4A 3TR0A 2ZR9A 1NF3A 4MYHA 4QGFA 1HV8A 2ZSDA 4HLCA 2CBZA 2HLDD 4M9QA 2ORVA 3GLFA 4L8GA 1E3MA 2R9VA 4KLNA 1CKEA 5GJWC 3ONWA 2FGKA 2F43B 2H92A 4H1VA 4LOAA 5TARA 3VFDA 2ZE6A 2ZUBA 1HQYE 1SHKA 1COWD 1TUEA 2J46A 1NP6A 3QBTA 3A4LA 1FQJA 5FL7D 3W90A 2FFHA 4JJZA 4TL7A 3B85A 2WJIA 3SFZA 3TUJC 2BBSA 4KAXA 1XD2A 1VMAA 4LCBA 1DADA 1Z6GA 3BH7A 4URUR 3ZVLA 4G0NA 1P7CA 4XVQA 2KJQA 3R9WA 3TNFA 1JPJA 3U44B 4Q18A 1UM8A 2DCUA 1K6MA 1KY3A 3RS0A 1R8SA 5EE0A 3B5JA 3ZVRA 2JJ2A 4YONB 2CE7A 3P4YA 3W8NA 1E0KA 2V6IA 3AQ4A 4D4KA 1E4VA 1Z47A 4ZDWA 4PAMA 4MGYR 2AD5A 1VCIA 4ZKEA 5FFMA 1JXMA 4O2RA 4N0DA 2JAQA 4ASUD 1QHHA 3FVQA 4MA4A 4IDQA 4TMKA 5HZHA 3AF2A 3QF4A 2GBLA 2AN9A 1TX4B 2OE2A 1BO6A 4A92A 1G8HA 3VR2A 2C8VA 4HUTA 4WBSA 2FWRA 2ORIA 4NE2A 3MAAC 1GL9B 3DZ8A 1XMIA 2VF8A 3A1WA 3QPWA 2QM8A 4B76A 4KFSA 3N2IA 1BMFD 4W5HA 3D6TB 1OHHD 4AIIA 5EE3A 3GLHA 1OW3B 2VHTA 4RKFA 1FTNA 1UDWA 2QTFA 4HB0A 2XZPA 4OJKA 4EJSB 5E7JA 3LXXA 2GJSA 4KFUA 3PFIA 1X8JA 4MH0R 3U7FB 2VPPA 1II8A 4PR0A 1I2MA 1XJ0A 2NO7A 4NCNA 4PC2A 1G16A 3VX4A 5FI0B 4MRVA 3GJ6A 2PT5A 2O8CB 5AUQA 4PXAA 1YRBA 4ACAA 4DEYA 3FHCB 4ZCIA 4XOIA 3FMFA 2FNAA 1FUUA 2ATVA 2QY9A 2ZRDA 1W1WA 1WBDA 4BE7B 3UANA 4KBFA 3LY5A 3GJ4A 4NDZA 2YWHA 3QXJA 1Z0AA 4PTLA 2O5VA 4URYR 5G40A 1CF4A 2XITA 1W46A 4XWKA 3W3AA 4TL9A 2VF7A 3EWSA 3TW8B 2WWWA 4AKIA 3I73A 3GPLA 1Z63A 3MCAA 4CEIA 2PLRA 3X1DA 1RE0A 3W5JA 1KK0A 2QAGB 3K09C 4TMZA 4C9BA 5FBLB 3A6PC 3CM0A 3CRW1 3NEYA 2VQSA 4FCTA 4IEEA 4Y0AA 1WB9A 2RGCA 1L2TA 1P5ZB 2DHRA 3KQUA 1E1QD 4W5JA 721PA 4WAUA 1ODFA 2QGZA 5FPTA 4YMWA 5BW8A 2HDNB 1KAGA 5CITA 4TQAA 3LWNA 5DNYB 2FF7A 3I92A 4U5XA 4KV9A 2GWHA 4XTRA 1VCMA 3HWSA 1PLKA 5BQ5A 2JJ1A 2OAQ1 2OXCA 4A0RA 4D81A 1G21E 2ZPTX 4JBXA 2XB4A 3CRVA 3Q5EA 4A2QA 4PSKA 2CVFA 1EFUA 2ZRAA 1G291 1KO4A 4C0JA 3IBGA 2JASA 2D4HA 1DG1G 4AURA 1KYIA 1OPXA 3SJCA 1W4CA 2B21A 4CYMA 2JIZA 1JR3D 1D2MA 1JBKA 1XFAA 3ZVMA 1T4GA 4JVMA 5KNBA 2ONJA 3FB4A 1IJFA 4PANA 5AUNB 4DXAA 1KO1A 1GRQA 3EZ9A 2BEJA 4LHVA 3AKCA 4NPHA 4NZYA 2J0QA 2ZI6A 3AF4A 4QJ4A 2XJ9A 3B13B 3PR1A 5JEEA 3IIKA 1NIJA 1KDRA 4NBSA 1E1RA 4EFMA 4I81A 4MDEA 1E9FA 2YWFA 3SI7A 4PO1A 4DCNA 4CF7A 3A8TA 5FTLA 1E2PA 1XTIA 2FZ4A 2IYZA 3VR1A 4M21A 4CIDA 4RFSB 1NVUQ 1Z2CA 5KYKA 3VQTA 5AWFC 2EWWA 2V55B 4IFEA 4JL5A 1G4UR 4GBMA 4OHXA 4RD3A 4A0GA 3GLGA 2BM1A 3IKJA 4IRUB 1LF5A 1ZINA 4DT1B 4TT3A 2E87A 3HU3A 4G5OA 4HAXA 4L15A 4J0QA 4MKFA 1XBTA 5CYOA 1A5TA 1P60A 2EFHB 1JR3E 4LYHA 5M04A 2OBMA 5JCPA 1DE0A 2CE2X 2FG5A 3LBNA 1RYHA 2J0UA 4BGDA 2QI9C 2JLWA 4Q7JB 4RFVA 2ZU6A 5JI2E 2ZS7A 1GDDA 2EW1A 3M0EA 3SJZA 3TSOA 5C46F 3VHXA 2WKRA 5SZHB 1SVLA 4F38A 1G8YA 2VP9A 1ZVQA 4AY2A 2XSZA 4M4SA 2OSBA 4AG6A 4ZIRA 2XB2A 2W6ID 2GCNA 3BAFA 2BKUA 3IEUA 4FWIB 5G41A 2BBWA 2RGGA 2FMXA 2HYDA 2OHFA 4QJ5A 3HJNA 4RD2A 3FPAA 1L7VC 4IDNA 4V0LA 2D2EA 4NP6A 3SE0A 4MGZR 4ZDIA 5F98A 3U3RA 2KB0A 3FKSA 3NKVA 3CZPA 4A8JB 2Q21A 1IY1A 1CR0A 2V1UA 1JQJC 2QM7A 3VHLB 4FI3C 2HCJB 5HPYB 4LJ4A 4KU4A 4MUAA 3UMRA 1ZNZA 2QPAA 3REFA 1MH1A 3BH6A 5JI3E 1KMQA 1IONA 4C2UA 4HAYA 2ANBA 3I8SA 4DLXA 5EJEA 3WY9A 3RC8A 3H0KA 4M9XA 1HYQA 4DLTA 3B78A 3RVBA 2WKQA 2NZ8A 1VG0B 5B30A 1NBMD 3K0FA 4DCSA 2C77A 5F3WB 1Q1ZA 5BN5A 1LS6A 1UF9A 5DI3A 3ADBA 1MABB 1X1RA 2IEYA 2F7SA 3BFXA 4Q48A 2YKGA 1CXZA 4FMBB 2PH1A 1OB5A 2A9KA 4XVUA 4OI4A 2G77B 4JT2A 3QF7A 5CYPA 3P4XA 2W0SA 1CLUA 2GVZC 3QXHA 2XOKD 3K70C 1W2HA 1ZW6A 2C78A 1HE1C 4KVGA 4FN5A 1NMXA 1XJQA 1E2NA 3RRZA 2OCPA 1ANKA 3FMOB 1G8FA 5HTKA 4BZQA 1JAIA 4D0LB 2P3SA 2VSXA 1CJTC 5FTJA 1PUIA 2UVQA 1DAGA 3NEJA 1KO7A 1YZNA 3WHLA 1OSNA 4GL2A 5DN6A 2Z4RA 3K09A 3QKUA 1VG1A 5FUVA 1UDXA 2IYXA 4WXPA 2FN4A 4XIGS 4PHFA 4FMCF 4HAVA 3OIWA 1YR8A 1ZD8A 4C4PA 3AEZA 4UKDA 3I5YA 2CNWD 1KDPA 2DWQA 2WJGA 3EW9A 4BZXA 1XCMA 5TB5A 2ZJ2A 4DLYA 3QEOA 4QOSA 4D26A 4QHTA 5FTMA 2QP9X 4G5QA 2VSFA 1T8TA 3C16C 4NYJR 1G8GA 1PVOA 1N6PA 3KKQA 3SS8A 1E2KA 1W36D 1ZM9A 1B0UA 1ZM2A 2IS1A 2WIBA 4B2PA 4P33A 3W5IA 3KZ1E 4ARZB 1IM2A 4BUJA 3GFTA 2WTUA 3IQXA 2ZU0C 4IDHA 1E9EA 1Z07A 4EQ6B 2QN6A 3W34A 2HV8A 3KFVA 1ZIPA 1U2RA 1Z6AA 1R8QA 4LBWA 1T6NA 3KKNA 1CP2A 1FZQA 4WVFA 4BLTA 3M6AA 5B2ZA 3EA0A 4ON9A 1LTQA 4U02A 1W36B 2EFCB 2FU5C 5BYJA 2ZRLA 1CJVC 5L3RA 1W0KD 4DSUA 2J3EA 1J70A 3GLIB 1ZUNB 1M1YE 1SULA 1R10A 3LX8A 2HJVA 1IOZA 1DARA 1P3JA 2FEOA 5FOTA 4EPRA 4QXAA 1OFTA 4H1UA 4HAWA 1KO5A 1CS4C 2W58A 3EASA 3NWJA 4ZO4A 5J4VA 3VKGA 2G83A 2LKCA 4D25A 1KY2A 2J7PD 2IS4A 4GZLA 1CR2A 5C2JB 4XD7D 1Q0UA 4KJZA 5JJIA 4CRWB 4B71A 1D9XA 3LAWA 3HU1A 1MO3A 1C4OA 4TZ0A 2Z5FA 3UXMA 4Q4HB 4KXFB 5FOSA 1S1MA 4P4UA 3RYTC 1G1MA 2FOLA 3NC0C 5KPDA 1EFRA 2J7KA 3OAAD 2FH5B 1YKSA 3VTKA 1M8PA 4EFLA 1DAMA 1I4DD 1E79A 3QPVA 4TSFA 2GKSA 4OJQA 1U0JA 3MG9A 3CWQA 3AVOA 2QQ0A 5EXTA 4KO8A 1Z08A 3RLFA 3B1YA 4DHEA 5JRZA 1OFIA 1XCGB 3I72A 2ZREA 2QGNA 4W5WA 1AGRA 5EE1A 4DCTA 1RKBA 2VBCA 4F7WA 4KFRA 3TMKA 4IOJA 1UKVY 2F3RA 2IXGA 5TXGA 1II0A 4EFNA 4B3CA 3UWKA 1RJ9A 2WOOA 1G9XA 1H8EA 3PUXA 2J45A 4MQBA 4FMCB 2A5DA 4OQMA 5L3SA 3T15A 1NVWQ 1YZLA 3REGA 1N25A 2OLJA 3IHLA 1XB2A 3K9NA 4PAOA 4TN1A 3OFND 2MSEB 4HZUB 5G53C 3WMGA 1KHTA 3GJXC 3L2OB 4JKYA 4V0NA 1F2UB 2QT0A 3OESA 2H17A 4XWAA 2IYLD 1NI3A 4HLQB 2JLRA 3OEHA 2G9NA 4CW7A 4F91B 2NMVA 3NH9A 1FNNA 4WIAA 2BBTA 2AWOA 2EWVA 2F9MA 4HB2A 4O2LA 1TU3A 1Q3HA 1Z3IX 2ANCA 1IJEA 4KSBA 1BKDR 4U7DA 1P72A 1VHTA 3BWDD 3DDCA 3V9PA 1F48A 1EG7A 4JBYA 1VYUA 4KODA 1S4QA 3W3ZB 5F9HA 1IN5A 2GTPA 4XH9B 821PA 3NBYC 2QNRA 2X2EA 4NYJQ 3ZS9A 2OZEA 3OIUA 5FOUA 1XNJA 2P0EA 5FR2A 3CX8A 1HE8B 2REXB 2AD1A 3AVQA 1WMSA 3LRPA 2F1IA 2RGNC 3BB1A 4P4SB 1G7SA 3EZFA 2A2ZA 2J87A 2H57A 2QQEA 4JYBA 1HH4A 2WMOB 4KI0A 4C7OB 4WZBE 1KGDA 2B8TA 1M74A 1JPNA 1US8A 2AHOA 2I1QA 3ICEA 4PSAA 2QA5A 4ITRC 2QPOA 3TR5A 5A4JA 3K9GA 4LV5B 3EPJA 5LD2C 2CL0X 4A1FA 2PJRA 2QE7D 2H18A 1VPLA 4BFVA 1SQ5A 1OV4A 1XX6A 1OFUX 2YC4C 1OH8A 1TU4A 1HTWA 2B7CA 2ZQ5A 3WMFA 1F60A 1FW6A 4PSVA 1FMLA 1KI7A 4MYCA 1OLOA 4DSTA 5IT5A 2HXSA 4LK2A 2BOVA 1CTQA 3L0OA 4HAZA 4EPWA 1AS3A 1BOFA 3OIYA 2Q3FA 5K8LA 4D82A 5EUMA 1RRPA 1KDOA 3GJ8A 1JI0A 1NKSA 1FTSA 3BFVA 3CRMA 5ANRB 2IHYA 2WSSA 3CF2A 2CJWA 4L9SA 5DI9A 4BRWA 3BB3A 1QHNA 4Q9JA 1SXJC 2PZGA 3EG5A 4PZZA 2ERXA 3TAHA 2B8WA 4JLAA 2BJWA 4R98A 3C5CA 3FOZA 4ZCLA 4LHZA 1I4LD 1HEIA 3AVTA 2FEMA 2QP3A 2W83A 3DHWC 1Q3TA 2YOGA 4Q01A 1GG2A 3SYNA 4RD6A 4JLJA 2ZJ5A 1Z2AA 3BK7A 5K8TA 3ASYA 3RNLA 1A4RA 1WP9A 3AVWA 1GITA 2C99A 1S3SA 4BQSA 2YVUA 2YYZA 3EIQA 3NBFA 4LYAA 4V02A 3X1WA 3P32A 5H1YA 3LNCA 2EFDB 3GQBA 2OEPA 4JT4A 5BN4A 5CLLA 2A78A 4GFDA 1XD2B 4TTPA 3CKLA 2A5GA 2WWIA 1UBGA 2QP4A 4K81B 1IXRC 3B9QA 1VIAA 4YC7A 4GOKA 2ZVPX 1SXJE 1GUAA 3CRRA 2O8BA 4C3ZA 2A5JA 3KXKA 3AM1A 4XVRA 2JDID 3R8FA 1XMJA 4D6PA 2N1BA 3QXXA 1OH5A 2QMUA 4Q47A 2J9RA 4PO8A 3LQQA 3EX7C 2LKDA 4B6EA 1CBUA 2GVDC 1J2JA 2GA8A 1X6VA 2NIPA 2ERYA 3IIJA 2KWIA 1DS6A 1P2VA 1SVKA 4QBGB 2FA9A 4Q9LA 2PMKA 2P5TB 1SVSA 1TAGA 2PZEA 4B44A 2ZRJA 3QF4B 3AUYA 2UZIR 3I1FA 4L4UA 1XXHB 1GKYA 1XTSA 1Z06A 3DKPA 4YMSA 2QRNA 3SQWA 4ZDJA 1T3HA 4DDUA 2ZJ8A 2PX3A 4V0ME 1UKEA 3AUXA 3QY0A 3R8CA 4AKHA 4GOJA 1Z6TA 2OUKA 3NDPA 4D2IA 1RRFA 3GLHB 1GILA 3ZQ6A 1D9ZA 3QVVA 1P4SA 1EWRA 4AD8A 4P3YA 4DSOA 5TY0A 1L4YA 3IBYA 3T1VA 3TAUA 2D7CA 1E99A 3DL0A 1II8B 1H8HD 2WJHA 2RAPA 4AC9A 2BIFA 4JL6A 4HSEA 4BLQA 1KI9A 3P20A 1T0JB 3AKEA 2ZRCA 2OBNA 4I1UA 2E9SA 3RS3A 1KJWA 2RMKA 4G5GA 4X8HA 5EXPA 4A4DA 2N46A 1Z28A 3WRYC 3LQRA 5JWHA 2X8AA 3PG5A 3U4QA 1SKYE 1L8QA 1W4BA 3BJIC 3X1XA 3N5CA 5EP2A 5HKKD 2FGJA 4KVAA 1OKKA 2CCJA 2HYIC 1OXUA 2OILA 2OCAA 3L0PA 2RGNA 4Z8XA 3ZDQA 3U5ZB 2IC5A 4EDHA 2IF2A 3MRSA 4CEIB 3R20A 4LHYA 3TUZC 3K0EA 4TMXA 1NMYA 4JBWA 3QOFA 3TSZA 2XNDA 4KSCA 1XEWX 1OH7A 3ADKA 2QMOA 3FFBA 4A9AA 1XEXA 1KK3A 3I3SR 4RZ2A 3AP1A 1MO6A 2EYUA 3DZDA 2Q0HA 3IO3A 1Q1QA 3S1AA 4B3GA 2X1VA 3DMNA 3SYLA 5HE9A 2IYQA 5SZKB 2YHSA 3C5HA 4TZ6A 1KIMA 4DEXA 3NVAA 3LA6A 2YWGA 1G7CA 1GKUB 2CCKA 1VCNA 4WW0A 3ETLA 2C9OA 3E1SA 1G4AE 4OK3A 4UQOA 1OYYA 1YR9A 4Q4AB 3CPHA 3KJEA 4MITA 4D80A 2WPDA 5G3YA 3GEEA 5TV2A 3KXLA 3MWJA 3BFKA 3CZQA 3MJRA 2WV9A 5E7IA 3OE7D 4DUGD 2V54A 1UPTA 3AB3A 1W5SA 2BVNA 2EFEB 3C41J 1SXJA 3THWA 4BFWA 2WIAA 1IY0A 3ND9A 2W6JA 4Q19A 1KJZA 1U81A 3ASZA 1E9CA 5AUOB 4OQXA 1NN3A 2A30A 3Q5DA 3O8RA 4JYCA 4LDJA 1R2QA 5CIQA 4C0AC 3IGFA 1CULC 2KSQA 4LHWA 3VU9A 2VHQA 2DB3A 2CDNA 2V4ZA 4TYNA 1AQUA 2RGBA 4Z1MA 2VRWA 2FPMA 1G6OA 2R6DA 3T1TA 2IYVA 3GLGB 4B35A 5BXQC 4A0FA 1DAHA 3O8BA 3BH0A 4FIDA 1IAQA 1BS1A 2Q3MA 4EJSC 3TH5A 4F93B 3WXMA 1D5CA 4LC0A 1TQ4A 1R0YA 3SZRA 2WZQA 4B74A 2CL6X 3HU2A 4OL0A 4NCKA 2HT6A 4AWXA 3T61A 4YMUA 1R0ZA 4C0QC 3A58B 5B64A 2FSGA 5AJVB 1GRRA 5CB8A 4JVLA 4TLDA 3GEHA 2QBYA 2ZRGA 3QXCA 4QGHA 2BMFA 2RHDA 3ZLJA 5CLQA 3WNDA 1XTJA 3CX7A 1JJVA 1HURA 4P4TA 3SHWA 1OXXK 2FFQA 2WKPA 1R0XA 4OKSA 4IOKA 2NO6A 1F2TA 3HR8A 4TQUS 1IN8A 4QFMA 1XMVA 1U90A 2WSMA 2W2VA 2WICA 3HDTA 2QAGC 2PL3A 3EZ6A 1GSIA 4H9GA 1XEWY 1R5BA 1KI8A 3UG6A 2WWYA 2W00A 5IK2D 2R62A 3F0TA 2JA1A 4C0KA 2Q9BA 2X19A 5B58C 1Z0IA 4Q1EA 4GMXA 2IL1A 4Q4JA 1YHNA 3IDQA 3K0AA 2OG2A 1AN0A 1G18A 1T91A 2ODEA 4Q7LA 3PJRA 4EAQA 2WAXA 3EWAA 2NPIA 4M1WA 2C9CA 5C4MA 4LI0A 3ND8A 4DLZA 1S9HA 5DI3B 3GP8A 1KK2A 1CR1A 2EYQA 1N6NA 3JZAA 1N0WA 2GXAA 2DFLA 2W0MA 1XD9A 1IHUA 4GP7A 5LDDC 1J90A 4NYMR 1E2IA 4QGAA 3MFYA 2PLFA 1TQ6A 1UEJA 4GPTA 5JS8A 1DO0A 1F6BA 2LCFA 2KBEA 3TQFA 4RVCA 4LYFA 3I8XA 4KBGA 4TTRA 5DN6D 2IS2A 2O0JA 5FUWA 4O25A 3EPKA 1XZQA 2IWHA 1QHSA 1XTQA 3PUWA 4OI2A 1Z0DA 2GRJA 3KQHA 4CDGA 4B48A 5E7MA 1Z29A 2GZAA 3GJ5A 3E2IA 1U8ZA 4OHYA 4BFSA 1TEXA 3AF3A 1GWNA 1Q21A 3MMPA 3L43A 1MRSA 2NO1A 4US0R 2ZYTX 3BERA 4TL6A 2OCBA 2BCGY 3D31A 5J47A 1WCV1 5IHPA 4DKXA 4S2EA 1OFHA 2J41A 3BGWA 5FBWB 3L82B 1M2OB 1QF9A 1VYVA 1IY2A 1WA5A 1E9SA 3DPUA 4TYYA 2QRZA 3ZYCA 4BFTA 1GAJA 2F1JA 1M7HA 1LB1B 3P26A 4MKGA 4DLRA 5HZKA 2ZR7A 4JLKA 2P6NA 2HLDA 1S0UA 3C4JA 1W4AA 4DIDA 4B75A 4DIEA 1KSJA 2ZUCA 4PPGA 3QSYA 4UXHA 4A6XA 2V9PA 2ZTSA 3RRMA 4WXRA 1NN1A 2Q6TA 3CPJB 2Z83A 4I1VA 1COWA 2IXEA 5AJYA 3LBIA 1GOTA 2NO9A 4M53A 3PEUA 5FL7A 4C0BA 3AP2A 1KKMA 1P61B 2A3RA 1ZCBA 4AYTA 3WRXC 2CLCX 2UKDA 3A4NA 1YZQA 2WWFA 3B6EA 3FTQA 1A2KC 2ZRIA 4HUQB 2QPTA 3IHWA 3P1JA 4OK5A 4YMVA 3Q72A 3WNCA 2PX0A 5JCZA 5CJ2A 3WP0A 3ZIAD 1IBRA 1K5GA 4A8JC 1KOFA 2IT1A 3SFVA 2RCNA 2PEYA 3HP1A 5FR1A 1CJKC 2EU8A 3G0HA 2VP0A 4FWTA 5A5GA 1KTVA 3R9IA 3EAQA 2VL7A 4JIMA 1TPZA 5GJBA 1YE8A 2VHCA 5EP4A 3DEFA 4EPTA 3HYTA 3B7GA 5KSPA 4ASUA 2FFBA 5LB2A 4FD2A 1E9BA 1P9WA 3LLMA 3ZGXA 3CBQA 2PCLA 4UNSA 2HUPA 5E4FA 3RABA 4POAA 3VR5A 2GAAA 4HB4A 1WQ1R 4LBVA 4BWYA 2OAP1 2ODNA 4FMDB 4BLRA 4HDCA 1XD8A 4GOXA 1E4YA 2QMEA 1LS1A 3TLXA 4D0NA 4NYMQ 2AK3A 2BM0A 1BMFA 1OHHA 3SC3A 2Q3HA 1E2LA 1XRJA 3M4YA 4NL4H 2WBLC 2O0KA 1RJ9B 4M9ZA 4IJMA 4W9MC 1EFHA 1G7TA 2BHRA 5L3SB 2WM9B 3KJHA 4Q1CA 3RSLA 3KQKA 2C9YA 5KNDA 4G1UC 3CUEF 3AVUA 4LPKA 3AF0A 4OI0A 2WWHA 4IEIA 1E98A 3AVYA 1UFQA 4X8LA 5B57C 2QT1A 4DJTA 1OH6A 2V6JA 5AK0A 3GCGA 3AKYA 5EZ5A 1NVVR 2MSCB 3DMDA 1XCPA 1RFLA 3NBXX 4DLVA 4CEJB 4HLUC 2ORWA 2G0NA 4IXMA 1U8AA 4TLAA 1X1SA 3C7KA 3M1IA 1OIWA 2YJTD 1T3SA 3SJBA 3T5DA 1OXVA 3THXA 1EX7A 1HT2E 2QMHA 4DC9A 2WVJA 4QL3A 2L0XA 1NBME 2GEVA 5JJLA 2AFHE 5C18A 5EE9A 1N0VC 1YU9A 1QHIA 2GZHA 4JKIA 2GHIA 2W2TA 2JATA 3OZXA 1TMKA 5DHFA 2QENA 3ADCA 1JEDA 1E1QA 4JZKA 2ZS9A 5CK5A 3GJ0A 3LO5A 5HCNA 2PCJA 4PHGA 5EE5B 1XF9A 2XNSA 1K5DA 3FMPB 1US8B 2XTNA 1Z6YA 3AKDA 221PA 4HAUA 3VMFA 1W36C 2ZJOA 3UK6A 1R5NA 3KFXA 3MSXA 4LRWA 5D3MA 1G3QA 4NONA 1AS2A 5JLJA 1ZIOA 1Q57A 5DO9A 4DZZA 1S9DA 1FX0A 4EKDA 1DAKA 3QIAA 2YOFA 4YXWD 1HUQA 4LC1A 1AIPA 1G6HA 1R0WA 3JVUA 4G3XA 3SNHA 1G3MA 2GAOA 1JR3A 1ZU4A 1G3IA 2AL7A 2P6RA 1VDZA 1XPOA 5KOYA 4EUNA 1J7KA 1NSFA 3MWYW 3OEED 3QKSA 4NH0A 5FH9A 5F9FA 5FL3A 2QTHA 3FHOA 2CXXA 4FCVA 4TLEA 3O8DA 2GXSA 5K8UA 2PJZA 2GCPA 6Q21A 2W2XA 1NG1A 3I4LA 3RSOA 2OLKA 4YDHB 5FPHA 1Z0FA 3TVDA 3KKPA 5FPSA 2V7QD 2CMKA 2R6FA 4PO9A 4TTQA 2HXYA 1F5NA 3MJHA 2DWPA 3GLIE 2ZITA 4M22A 1EX6A 5G3ZA 1J8MF 1WF3A 1V5WA 5SZJA 4R71A 1KNQA 2ZRBA 4LBZA 2O8DA 1N2CE 121PA 4PAQA 3TBKA 1ZD1A 4QKQA 3IUYA 4P31A 2V8OA 4OHZA 4C2TA 4QNMA 1SZPA 1Y63A 3U7HB 1WRBA 2VP5A 4FW9A 1JEEA 5FPYA 1W47A 3EC1A 2YZ2A 2YNMA 4GP6A 4IW3B 5D3QA 4DCVA 2FE4A 3L8ZA 1P9RA 2ZEJA 1XP8A 3IO5A 5FBVB 2KE5A 2FDCA 4GMDA 1PUJA 1LV7A 3OF5A 5FI1B 4DDWA 2A5YB 3PVSA 3P27A 2ZJYA 2HF9A 3AP3A 3CWZA 4LHXA 2C96A 2W6IA 4TMTA 2O8BB 1NVVQ 2ZIAA 4HYYA 2GJKA 4UXJA 4LJAA 3VNVA 1C1YA 1IXSB 1E9AA 2BWJA 3ZZTA 1O87A 2F6RA 4E09A 3IIMA 4PZLA 2C2HA 3WP1B 2AKYA 2YWEA 4L9WA 4M1SA 3NH6A 2ZETA 1MABA 1MO5A 2CK3A 4P32A 4RZ3A 2ZAOA 5LPNA 3EC2A 1D8TA 3I61A 3U6BA 3JZMA 2ZE5A 1OT3A 621PA 1GVNB 3SDZA 2CEAA 1NBMA 3SOPA 4HDQB 2ONKA 4IDOA 4LJ5A 5GVRA 3W6NA 4RJLA 3RS4A 4DCUA 2ZE8A 3B82A 1U9IC 1QHGA 3SEAA 2XJ4A 3LFUA 2JJ8A 1VG9B 5CDFE 4DLWA 1W0JD 3E70C 3F3YA
chains in the Genus database with same CATH superfamily
1ZMBA 4TT8A 1GRCA 1PJTA 3VPDA 1GLNA 3H2KA 4QBKA 1E2FA 5K99A 2F8SA 2ZRQA 3MRVA 3O0DA 3RWMB 4OQDA 3JQBC 5JHHB 1D2EA 1XOIA 3MB5A 2BJHA 3HO6A 2HQRA 1NP3A 2VLIA 1FUKA 1FTWA 2A0KA 5DTJA 1G8PA 2JZNA 3KC2A 1QGUB 5C32A 1GM5A 3CPEA 1JMKC 2FPRA 5LVAA 1V7ZA 2JGLA 1OU4A 5M5BA 3IDZA 1V8PA 1TA0A 3H5OA 2OHGA 2ISCA 1TTHA 4MWOA 1VPEA 4LVOA 3SF8B 1E0DA 3MTAA 2VP3A 5JHGB 3DQZA 3KVOA 3NYWA 1JG2A 4L9RA 3IFSA 2XKKA 1VE7A 3M4ZA 2QN9A 2ZW9A 4OIFA 1CRPA 1UBSB 2CL7X 3N07A 2PG3A 1QZUA 2NU7B 2IY8A 3OUZA 4RKEA 3TOSA 4F97A 4GQAA 2X7XA 2CNWA 4BNMA 2B7LA 3FMVA 4EYOA 1REQA 3BIJA 1ZXBA 1PLLA 1LDBA 3DYBA 3TLGB 4A8HA 5LNK1 3UATA 2E89A 4OGLA 3W7AA 3Q9UA 3RVSA 4BQIA 5LP6B 5LA6A 1XC7A 1KI6A 4WEOA 3QU9A 3PEYA 3ZU2A 2I62A 3EGEA 3FI0A 1YNSA 4M1OA 2ZDQA 4INOA 4TKMA 4Q7KA 5H80A 1H2ZA 2COEA 4HMOA 5BSFA 2DPXA 1TTTA 2PX8A 3P9NA 1VJ0A 1ZCAA 3K2BA 5WRFA 4ZYWA 1XLTC 1JLMA 1NQXA 1PZMA 4XW2A 3VHQA 4BFYA 3TZEA 2PUCA 3H9JA 3VJRA 2ZROA 2JJ2D 1SUPA 4N5NA 1FJ2A 1FNMA 4HPJB 1W0KA 1XCOA 1YQUA 3ZXXA 1GIAA 4M8SA 4GKBA 4KXXA 5E1MA 4PHHA 3RJMA 3EFHA 3AJDA 3DHVA 1TEHA 2V03A 2JLCA 4GPD1 4KYUA 2PWAA 1WDKA 1NIPA 1RLOA 4D3SA 4LY6A 2AWNA 1YBAA 2BN4A 4W82A 4DILA 2J7PA 1R4MA 3THWB 3D3QA 2O06A 2X5NA 4A8TA 5JJ5A 4G5RA 4GOLD 4DARA 4DM3A 4E08A 2DR3A 2R1TB 4CG1A 1U1FA 4LJRA 1U0GA 4PS1A 3AHEA 3MPOA 4KXWA 2X8WA 2VF5X 4OQNA 1QRAA 2L17A 4AY6A 1D1TA 3AGPA 2EP8A 3TUIC 2QRVB 4HC4A 3D8NA 1I5OA 3B6IA 5G0WA 3ZC3A 1QSGA 3DO8A 5CCBA 1QV7A 2OESA 3L6BA 1JEQB 4DLNA 2YYAA 4H27A 1QHHB 2G06A 1BYIA 1KL7A 5DYYA 3KV3O 3CH5A 1BN6A 2YW9A 4Z86A 4LGMA 2DU8A 4K8RB 3RC7A 2KLBA 4B3MB 1KP2A 3WWPA 5JRDS 3DWIA 1NUUA 3FA2A 1PLJA 3F9RA 2FW0A 1T24A 3PP8A 4UNPA 5DLDA 3U13A 4C0HA 4PHTA 4KE8A 4MCAA 4RA6A 3TCNA 2E0IA 4PG6A 4MS1B 2V96A 3LPLA 4R9SA 4DQLA 1SXIA 2X7JA 3AILA 3S2UA 2IK8A 3OZAA 1N2HA 2WJYA 4IH1A 4JJKA 4DRYA 4IHJF 1OUMA 3WX0A 4AFNA 2RKWA 5BUQA 3JV7A 1KSGA 3QFRA 1MT3A 4WZBA 2GKOA 3A1EA 2IYEA 2XVXA 4OFWA 3S2SA 5CDFA 5T3YA 1ZISA 3U37A 3H0CA 4G4IA 1RTKA 4OO3A 1HF3A 1GUYA 1SVMA 3D8UA 1MTZA 1XSEA 2B83A 3FDJA 3GFBA 2O0MA 2VZ8A 3N8GA 1N0IA 3H99A 4RJJA 1XTBA 5LLSA 2I1VB 3IQEA 3DWEX 2DY1A 1LTKA 3CPSA 4JLVA 4N5LA 4OP3A 3V6LA 1U6KA 5KAPA 3RKRA 5BV1A 3ND5A 2AMVA 2FMIA 4G5FA 2HFJA 4EG1A 5JRJA 1X9GA 4UNIA 4O0LA 4LVNA 2QTTA 4OSOA 1YJ5A 4R1LA 4HNVA 3LV8A 3GEIA 5ES4B 5CX1B 2PYZA 4CBVA 3ORQA 4C1BA 4LF6B 3MLAA 4LJ7A 1JHRA 2O8NA 4YJHB 5FHQA 3TQCA 3K0CC 2QZZA 2XWBF 3DOCA 3U26A 3IS3A 2ST1A 1Y3AA 5AHRA 4Q4JB 3H65A 5IC4A 3OX3A 1TZBA 1A4XA 3RODA 3B2EA 4QHSA 3V4ZA 1BD3A 3A6HA 3R3VA 3QWFA 4BNDA 4DDTA 2HUNA 3S1LA 2C3YA 2BM8A 2O3RA 2YHIA 4G84A 1N2IA 5LC1A 3STWA 1V8FA 2A5FA 4HWSA 1WCXA 1SHJA 5TS2A 1SUDA 4G2TA 2Z9BA 1F3LA 5EEGA 1EK0A 2VTEA 1GKKA 1RZ3A 3R3WA 4AMVA 2FSHA 4BO3A 1EFTA 4TMWA 4WE3A 2JKVA 2BMWA 2QX9A 4K88A 3RV4A 2G5TA 3S3TA 1ZOSA 2I5PO 1GNRA 2QE7A 4UPDA 2OG1A 1K6EA 1N92A 2HIHA 3ILYA 3PYXA 4MYTA 5T5QA 4B2LA 1CUIA 3GXOA 1FSZA 2PO7A 1QAOA 3IUSA 4MLPA 3P0IA 3GFVA 2ZI9A 2IPMA 5HJ5A 1BW9B 5BSHA 1YZTA 4KYIB 5HKOA 1AMNA 1ZSYA 3A1DA 4J3JA 1R4NA 4HVCA 3SYTA 1I7DA 3ZIUA 1E8MA 1AKYA 3L7CA 3PHHA 2Q5FA 3SQMA 2VZ0A 3DB1A 2UXDB 1T4DA 2GJAA 2ODWA 3QMWA 1PG0A 1R0SA 5F1OA 2P3LA 4P86A 4XUEA 5CAEB 3UHFA 3COJA 2ZBFA 2PXCA 3H2IA 3ZU4A 4EH1A 4MR8A 3SP1A 4LJYA 3QENA 1CUEA 2WF6A 3L1VA 5NULA 4ZT3A 2P75A 1BHQ1 1D6JA 4MEBA 1W48A 5BW6B 1RWOA 3E0QA 3L0YA 3SLKA 4PX2A 1GCAA 1IB6A 3MWEA 1Z4LA 4C6SA 3Q7QA 3KG2A 4H31A 4HN2A 4FOTA 3AEKA 4BCCA 3JQGA 1PGNA 1PZFA 3DEJA 2IW3A 3H9EO 1XQWA 4IHJB 2PA3A 5C4GB 5BSGA 1X14A 3ICOA 2GOYA 4R2HA 4UTOA 1SEVA 3REQB 2OV8A 4R8VA 4Z51A 5I51A 5J2UA 1QYDA 1MAUA 2IOHA 2X3YA 4NENB 3Q1KA 4I5GA 5A9RA 2Q1XA 3ZLBA 3K8YA 4UE6A 2COKA 4UEJA 5DX1A 3T4PA 4DGSA 1KVQA 1YZFA 4PX9A 3KQSA 5J40A 1EXVA 1SUAA 4QM6A 2W8BB 5IU6A 3O8QA 4HX2A 4HVTA 3V4LA 4UDYX 3T9DA 4I99A 3F5FA 5EHZA 4BECA 2JLQA 1X92A 2HXGA 2JC3A 3IAUA 2OCXA 3PR3A 4HNSA 1LV8A 4YYEA 2XSZD 2EQBA 5TPZD 3LM8A 5B4VA 4YV2A 4BX9A 2WQ7A 1JEAA 2GNAA 4B33A 4X0EA 1EWYA 2IUFA 2ADFA 2BHSA 2UZ3A 3ONDA 4KAAA 5AM4A 2FX3A 1UBFA 4H2DA 1QRDA 4PPQA 4GICA 3FKSD 2JFZA 4RV5A 4YDSA 3ZWCA 4WHMA 4M89A 6YASA 5LQCA 2DTXA 3DAYA 2C2BA 2O2IA 1KE2A 2JLXA 1ORRA 4IGFA 1F1BA 4QAQA 4S1PA 5A0TA 3KUDA 2H2DA 3Q8LA 2IFTA 3ENNA 2JDIA 3AL3A 1L5MA 4OHVA 3AF6A 1TCBA 1D1QA 3L41A 1Z4PX 2QLJA 1QKKA 1NBOA 3A2NA 3KX2A 4ZPJA 1TVKB 3RI3A 2LGJA 3VUFA 1HMYA 4YBZA 2ETXA 4DRZA 3LCJA 1XE3A 3MBOA 3ZNQA 4S05A 1UBLS 2YYSA 1TJYA 3B1JA 4FJ0A 3WIUA 3TINA 2C7PA 4BMZA 2G1PA 3O1HB 2WC1A 1E0AA 4R81A 3WS7A 4BJ1A 4N0PA 3O82A 4PRLA 4LW8A 1Q14A 2A88A 1BYUA 2WTNA 3EQ7A 3CCFA 3MD9A 4OL9A 4Y2TA 3DLBA 3LP8A 5GJVC 3P0RA 3ASUA 4J1TC 3DA8A 2UYOA 4UJ3A 2G4CA 5F7OA 1DUSA 5CB0A 3RUEA 4Z4IA 3R7SA 3PT9A 5T64A 4W5QA 3ZZUA 2MYNA 3LY9A 1NFFA 3EXAA 3DOEA 3FDZB 1KZ7B 4RSHA 1TKRA 1OYVA 1FRNA 3LZ6A 4WOBA 1K8QA 4UTRA 5KQGA 3ICQB 1G4HA 3JPYA 5BN5B 1NRWA 4GI7A 3CVUA 1U4SA 1JHAA 2Q3JA 4QOJA 4PLYA 3Q3HA 3A6ZA 3T7AA 1GPWB 3DUFB 2XZDA 4Z3DA 4R8RA 3P97A 5C1DA 1H8HA 1L1RA 1WXEA 3CG0A 3DR5A 3PZRA 5L3QA 3TL2A 1ODCA 3VAZA 4DCOA 1N1MA 3ZK8A 1QUEA 3QEJA 4OUKX 5EJAA 3WB9A 1I3NA 3WYCA 1VYHA 5GP1A 1TA9A 2RHRA 2IZ6A 1A2BA 3I34X 2RKOA 3IVXA 3KDSE 3A31A 3T9EA 4PFSA 1C7IA 3VR3A 5J9FA 3T52A 3OWHA 5JXGA 3WLPA 3PICA 4R3WA 2NP6A 2JBAA 5CH3A 5MGNA 2FMHA 1W87A 2H85A 1RRVA 4XQGA 2M6KA 1SOAA 4EO7A 5HCIA 4K87A 4LYYA 1D03A 1DTEA 1FSSA 2PLWA 5CJPA 5C8YA 2BP7A 3KT0A 2QV0A 4ZVMA 1FTGA 3OJOA 3RSFA 2O52A 3TD9A 1IUPA 4W63A 5B3JA 5A4MS 4AF6A 1D6NA 2IEZA 4YQEA 4AT1A 5H68A 2XX3A 1FFYA 2F43A 1D0IA 5IT0A 1NF2A 2FSFA 2H4ZA 2FPPA 2R6GA 1R6XA 4V0OA 1MKYA 1XA0A 1XZAA 2YQZA 5AXDA 3FSJX 5SY4A 3TECE 3CZ4A 3IKVA 1T5LA 3ECCA 3QGMA 2UYQA 2VDWB 4I8XA 5BSKA 1K97A 3HEAA 3OX2A 4OVKA 5AJUA 4F11A 2I9PA 5DBGA 1J2YA 1HBJA 3L0BA 3VDQA 2WJJA 3BMNB 1KSHA 4RPCA 1GTMA 2WMYA 2XMBA 2FN7A 3QTBA 3RE1A 3UIEA 1S2MA 1W96A 3A0RB 2VRBA 2YJ5A 2AJBA 1AO0A 3A26A 4JI1B 1O58A 2G88A 3NG1A 1QG2A 3F5DA 2AR0A 4L5YA 2MCFA 1PG2A 1RWBA 3NHMA 4WLNA 5IJZA 1F4LA 1SG6A 2XZOA 1ZH0A 1O94A 3FPHA 4O2AA 4GMFA 2VTKA 4HQLA 1VP9A 2R00A 4TV9F 4EHFA 5JWRA 3SXUA 4IP0A 4L28A 1BWSA 2XMCA 3U4CA 2P67A 2O2GA 1FNDA 5I7HA 1N1EA 1L4BA 4GL4A 3HPRA 4LGVA 4QE3A 3ZLTA 2JLVA 4YT2A 3OT4A 3OE7A 3WHPA 3Q4GA 4M0LA 3NTXA 3EZ7A 3OOWA 3MIZA 3QKSB 4C6HA 2E1PA 1ZK4A 4CVNA 2L82A 2NU8A 1K68A 3R0ZA 1APBA 2XTMA 2NZJA 1E2QA 2ZLBA 5EINA 4KG7A 2E1RA 3G0CA 2OV2A 2GETA 3CA8A 3R0VA 4BEJA 4JYMA 3LHSA 1RHRA 4BNGA 3H6KA 4DA4A 4D9IA 3IA7A 3HM2A 4GX1A 1A2OA 1TVCA 1WJGA 1L5RA 1U3UA 3HY6A 2WYIA 2I22A 2RC6A 2P0AA 3ZY3A 5MDHA 1U5AA 2VAMA 1W9MA 2VYVD 2EHJA 1GUBA 4K03A 1LW6E 4MPTA 1VIVA 3HKDB 1SFRA 1YL5A 4OBBA 1FPQA 2Q4EA 2V74B 3W8RA 3B1KA 3QVOA 3OM1A 4EJSA 4WJLA 5IAOA 3OLQA 1IZ0A 2QJOA 1AX9A 4GNRA 4LRXA 1ADBA 4I19A 1LXCA 1YJBA 4PLHA 3UJHA 3B6JA 5KSZA 4QQRA 1WD7A 3LTEA 3BDIA 1RC1A 4AJLA 2I76A 5ARCA 2W2MA 3CVJA 3KOXA 3PEVA 1M2HA 4PG8A 5JO0A 3DE5X 4X6LA 2C59A 5LNK6 3TRJA 2PLAA 4R0MA 1YRLA 1U6IA 3ZH9B 4PSUA 1QZ3A 2BI7A 1FLAA 1NDUA 1SNYA 3AUUA 3U4HA 1EDDA 2HMUA 3R5SA 5HS6A 1Y7LA 2N42A 1OI4A 3LKBA 3LVQE 3R5TA 1Z0JA 4UHEA 1P1JA 3WL6A 4EDFA 1CDZA 1N6OA 2XCUA 5IAAA 3TTUA 4P0PB 1KARA 1Q1AA 1HTTA 1LW7A 3PQCA 5EP3A 1ESZA 2HT1A 2I4TA 2VNSA 5CDUA 2VP2A 1U3FA 1D0VA 3BMQB 1Y80A 4FGKA 2QAGA 4I4IA 1BCSA 3ZJ4A 3B53X 4UJ5A 2O48X 1N2JA 1S96A 1E5TA 4A6PA 4UHJA 1JDSA 3LHIA 4X8MA 1Z5VA 5IK2A 5BYAA 3GRKA 3BSYA 1RI3A 3WWCA 2K6GA 4LQ4A 3JQFC 5EJ2A 2XEDA 3KEGA 4J2HA 8ADHA 4G5HA 1RBZA 4K8OA 1N9KA 1NI4A 2BLLA 2DHDA 2ICAA 4I0WB 3EUWA 3PGKA 4IZ6A 4MWZA 1U94A 4YK7A 3ZBUA 4DA7A 1G38A 2VRNA 3CLVA 2E48A 4KX5A 3TGWA 4L3WA 5I7RA 4EB8A 2NXJA 1U0HC 3ETJA 4EF4A 3K70D 2Q9UA 3EBOA 1CEQA 3HU5A 8MHTA 4G26A 3I23A 4YJFA 1QCCA 1X19A 4F71A 1E3JA 1CUWA 2V6GA 4V24A 4JUCA 1N6IA 3EIHA 4LWQA 3UHAA 1S3FA 5AFSA 1B1CA 7ADHA 1VLHA 5AVYA 1BRTA 1OQAA 3IX7A 1CZNA 4B1FA 3PCRB 3W06A 4YUWA 1E2DA 3GJ7A 1IY9A 1U0RA 1YFKA 2J0VA 3JQEA 5EFOA 5EXDA 1N0HA 2CMDA 4KGVA 5EJ9A 4IMRA 1OAOA 4MRRA 3ZQJA 3IEMA 3DBRB 3K70B 3OU6A 2RB4A 3GH1A 3P9RA 3NV9A 3A10A 3A37A 4CZ2A 2C2KA 5FUMA 3AU9A 1UP7A 3KB2A 4H0NA 2XMDA 2C84A 3RVDA 1M33A 1P2SA 1FNBA 1RWMA 1T43A 4OQ4A 3IBSA 5EXSA 5I7OA 2LE0A 1FL9A 1W52X 1LC0A 2YMLA 2CVHA 5JZVA 1OZAA 2FZLA 1PL7A 4C4YA 2A7XA 2H1HA 1E2EA 3TE6A 2J3QA 3NMUF 1AKEA 2PS0A 2FUNB 1DKPA 2XMQA 1RRKA 4MVJM 5IABA 2HNBA 2JF0A 5ADHA 2W2NA 1DC7A 1PTJC 1M1YB 3CKKA 2VXCA 3CLRC 2NGRA 5HKBA 2AYZA 2JGNA 2XE6A 3N0RA 2W90A 2WMNB 3PNLA 3CR8A 4KQGA 4PXAA 5JCJD 3E22B 2ZDHA 2R48A 2GK6A 3CO5A 3VZCA 1C9DB 2ZP1A 4U2EA 4RY9A 3GDOA 5A3VA 3IHKA 4DZTA 4DT1A 5HW0A 3GRPA 4ZI3A 3H4IA 3AEQA 3LX4A 3WGVA 4IJUA 2CD9A 1VL6A 4M1YA 1I4WA 1M5RA 2OXRA 4UQPA 4N12A 2Z43A 3HUEA 1P8AA 1JTVA 2MMCA 4OMCA 2Y1GA 3LHDA 2P5UA 5AOAA 3K6SA 3RVRA 1DHRA 2BR5A 3EEBA 3QXSA 2CGEA 3SN6A 4K40A 4UBJA 5EZ6B 2AEFA 3F6RA 3HWWA 3G5MA 2CWWA 2I2FA 3F5SA 1M83A 4R7ZA 3IQWA 5JXJA 5ISMA 1Z2NX 1ZCFA 1P18A 2PX2A 1KAOA 1ZGZA 3N8IA 5F64A 3D7MA 2XW6A 1ESDA 2WINI 1VE1A 5KO2A 1KRHA 4YRBA 1CY1A 2O3TA 4OV6B 3VR4A 4B87A 3NZEA 4NDNE 3V2IA 1P0CA 3IEPA 5TE9A 4EJ2A 1KEZA 3EVTA 5INTA 2OT3B 3WMEA 3R3HA 5LOVB 4K28A 4A8JA 4JC4A 2A1IA 4IH9A 3TQHA 4Z7OB 3ZOZA 1NWCA 4BB6A 3D5TA 2D5AA 1XWFA 5CVEA 1GPUA 1KYXA 4ZT4A 2W6PA 5C8ZA 6GPBA 5MHTA 3NDBB 3ZU5A 3ZTYA 2R44A 3COZA 4V1CB 4C04A 2TMGA 3FCEA 1UFRA 3OZBA 3ROQA 4B3JA 2ID9A 3WGMA 4D8TA 4HP8A 4MR9B 1CDDA 4B7ZA 1RYNA 4LZZA 1CIVA 1ATZA 4NE7A 2AE1A 1DQNA 2SCUB 4DXDA 2YWDA 2Q29A 5FUBA 1R6UA 4GR5A 4E15A 4URZR 4V3CA 1XTUA 2J5QA 1GYPA 2SBTA 3OD5A 2CHVA 1IXZA 1T2AA 2BMEA 3BD9A 3JYHA 3U9TA 4Z9YA 2ZVJA 1U8XX 3OUTA 3RH0A 5ITVA 1T0HB 3D8SA 1PJ2A 5JOQA 4CT0A 5LLDA 3I6ZA 3UT6A 2P6PA 1SWWA 4Q1FA 3RSSA 1UADA 3DM9B 3UJPA 4YT8A 3LQ4A 3X1KA 5K20A 2XXAB 1CY2A 3QVLA 4CDRA 2G7MC 5TLSA 4KOAA 4NU0A 5TT1A 5TF4A 3ZQUA 3COPA 1KOJA 2CZGA 2O14A 3K9BA 4QYTA 1ZMXA 3B9BA 4F8YA 4MGIR 4C4XA 5H0IA 2Y0CA 3O3MB 5KKAA 3CZ5A 4RSGA 3V8QA 5C52B 3SVTA 3B9PA 2AK2A 3VVCA 1D2GA 1IPFA 2QAJA 3PNBA 3U7EB 1PW5A 4F5WA 2QZ4A 2F48A 4V03A 5AH0A 4CEJA 3X43A 3GPDG 2E2WA 1WTAA 4CMCA 4ZI7F 2Q6IA 5HR5A 2JAUA 5FEUA 1A95A 5IJWA 2VKTA 2HNKA 2BMJA 4K6CA 2H7XA 5GONA 4EHIA 1YS7A 3ZKAA 4Z7NB 2XF2A 3VYTB 1GP2A 2JD1A 2HWUA 3DDWA 4X1YB 5JU6A 4TWZA 2B1RA 2ZJZA 3VO8A 5EI5A 2YZ7A 1KQ3A 4JSTA 1UPUA 2XT9A 2AVNA 5CNKA 4AIRA 3GJ3A 4D9GA 1IQPA 4X45A 4DUYB 4M36A 5BP7A 4B6RA 3C6KA 1RLUA 5KDOA 2Z0MA 3JQ7A 1C30A 3QM1A 2BHTA 2AOUA 3DFUA 3MWDB 1EUCB 2C61A 3E4DA 4B4WA 5HUHA 3BDAA 4CU5A 1Z17A 3BDVA 3KCNA 4P0TA 4W7IA 5JS7A 2D1SA 1QYRA 1QVAA 1WAMA 3Q87B 1XRNA 3NOOA 1K6JA 3QVTA 1JDPA 4J0GA 2OVBA 1KZHA 3U3OA 5KWSA 4FFBB 1OH7A 4EUHA 1XGKA 4DDMA 5GADl 4BQPA 4RENA 1J2TA 4RZHA 8ABPA 2OR3A 2H54A 5I47A 1ZM7A 1TADA 4XYEA 3F6EX 4FDVA 1RPTA 2C42A 4NAUA 2CVOA 1Q7CA 5ALNA 3N2KB 3V9AA 3P0FA 3KKEA 3NAQA 1JDJA 1VKRA 1NUSA 2F3PA 1TYCA 2J30A 1ZUNA 1NVXQ 4DYHA 3QLVC 5I7UA 1A9RA 1N2CA 1OF1A 2E5WA 2W2KB 5TQ2B 1TW3A 2CLHB 3LRXA 4BASA 1K3UB 1RBYA 4BC0A 3BMCB 4F6RA 1WKCA 4JJEA 4K6HA 3S8MA 1NX9A 1EFCA 4CQMD 2V45A 5FADA 3HJFA 4FJ1A 1U2ZA 1U1CA 4HEJA 3EYWA 1OX6A 5ICEA 2W6JD 5JAQA 2IDMA 3T0IA 3NOVA 3N2EA 1E2GA 4OBXA 1ZRNA 5CVTA 2VDUE 4TXJA 1DAIA 1GO2A 2HBYA 2JHPA 2Z3WA 1KKLA 3LVBA 1WHTB 3MOIA 1Z0SA 1J0EA 2ZRPA 3H8WA 3HABA 2PWBA 1T5HX 2QZJA 1YR6A 4MVYA 3H4MA 2HIGA 2LRHA 1JJAA 4Q4CA 3SIRA 3TKLA 5F5NA 4MVJP 5F21A 1KIAA 5KSOA 1NM5A 1EAYA 1IEWA 4TV8F 3ROMA 1A9SA 1LK5A 2QSZA 5CIWA 1T29A 4PQGA 2ACWA 4CG2A 1E2HA 1Y82A 2PSHA 1UIRA 2BSXA 2OM2A 4DCCA 2E4VA 1JSXA 1UKZA 1FSPA 4M1TA 1KEEB 2JK0A 4N7RA 1J22A 4CXMA 3SPXA 1UH5A 4HXGA 3WFJA 4K2AA 4UUQA 1NLYA 1VIMA 2MJLA 4ZI2A 4F92B 3FROA 1FMJA 1U0NA 4OMFG 1V5EA 4LRQA 4QBHA 5E1OA 3U7QB 1U4OA 4U6NA 4RKRA 2IPAB 4U2BA 3S40A 3RYIA 1POXA 4Q66C 2IYTA 2Q6VA 5EYPA 3L4BA 3S5JA 2C4UA 4WN9B 2GF9A 3QG1A 2HCBA 1F8XA 1GXSB 5CNJA 1RYDA 1G8KA 2J5XA 1UOPA 3RSCA 4QFDA 3EPLA 2WFLB 3CUKA 3AUSA 4HZUA 3GOQA 2I3GA 4URVR 3L18A 2WAYA 1ZR2A 2PY6A 2O8FB 1O57A 4HTFB 3RVOA 1CY8A 2GA9A 4D92A 1X1EA 1GL6A 3ZQKA 1YRQA 1VE5A 1NFQA 4KQ2A 3F78A 4F2WA 1YH3A 4MPJA 3TG8A 4IYJA 1HE4A 2X2FA 4J16C 3ZWOA 3CNHA 3OURA 5AXAA 2IH4A 4MV4A 2W2OA 1O6CA 3A1VA 3ZS8A 2GHQA 4FINA 3KYBA 1Q84A 2DKFA 2ZZMA 3SC6A 5IZCC 3HE3A 3ZGNA 4GC5A 3WSVA 3E3NA 1I1HA 3N8HA 3FNBA 3NHUA 1VPTA 4MV9A 2Y6VA 5C3UA 4LQLA 3WLEA 1H0RA 2Y4OA 1LGYA 2NPOA 3CF0A 3IJRA 2E3JA 3QSGA 4XSHA 5FLYA 2PKXA 4J91A 4AKEA 4F93B 1FNCA 2ZSFA 3A32A 1SD2A 2E4YA 4O1MA 3PQ8A 4A7PA 4FS3A 2ODQA 3D8BA 3C3EA 4IDFA 4OQFA 4A0HA 4ETMA 4M1KA 4XE5A 1IEQA 2C83A 1T9HA 2AI2A 2HY7A 2LWIA 5KYWA 1M6NA 5AW7A 5EHGA 2ZB3A 4N1AA 4TLCA 1NLFA 1ACJA 4F3RA 5JZMA 4U00A 2H5LA 1ZI6A 1DTSA 5BMOA 2PPLA 4WFJA 2Y66A 4K2HA 2CLEB 4HRYA 5ALJA 4MS4A 5HHTA 5TMPA 4AP5A 3SBOA 4E5UA 1YTLA 3P2KA 4TYWA 4BQRA 3X2EA 4EW3A 1KEVA 5TPWB 4I9NA 4LBYA 1IH8A 3AEYA 4TLMB 1G17A 3GARA 5LKAA 1TVEA 1KQOA 4BO0A 4IJQA 4XTCS 3ESDA 1ZI9A 3HJAA 1A5ZA 4H4CA 1UK8A 4GSYA 4JA0A 4TV8B 4TUYF 4XGIA 5JC1A 3FOFC 2VHEA 3HLYA 3UC5A 4BX2A 1QZXA 2O1SA 5KSYA 1A98A 1U0OC 2ZRNA 3F49S 1JXOA 4QRHA 5IRCD 1UBJS 2NU7A 3HC7A 3NHAA 1AM4D 3H8SA 1I80A 4PIPA 3KWLA 3R7AA 3VPGA 3AETA 4DVGA 3OHSX 2IX3A 3LGSA 2RIPA 3G49A 1YR7A 4GKJB 1W44A 4B9AA 2N3ZA 2Q0SA 3AV3A 5IDQA 1ZC4A 1GTJ1 3VU8A 2V9CA 3QFHA 5ETJA 1DUIA 1HYEA 2Q2WA 3FRIA 2VP4A 4LCJA 4YUXA 1PSZA 2ZR9A 1NF3A 4XJSA 4QGFA 2G72A 3IQDB 4G37A 1T8RA 4MUIA 4M9QA 3E53A 4GI5A 3HP7A 5HQJA 1CUUA 4D7AA 1OGJA 4RMIA 2P8JA 1HLDA 4ANFA 3GP5A 5BMVF 3D81A 3R5KA 2ZIWB 3IOCA 4RS3A 2XMSA 3ONWA 1OA0A 1UJ5A 2K2QB 1CCWA 4FFLA 4LOAA 4U2KA 4XJVA 3NJRA 1MQ8B 1DIOB 2M1XA 2ZUBA 4F5YA 1RXWA 1SHKA 4KQKA 1N8TA 1V48A 2DPHA 3QBTA 4M6WB 4PFKA 3HM9A 1QVVA 3FLAA 1GTL1 5FL7D 4JJZA 3CX4A 4TL7A 1E6WA 2RCYA 4LY0A 5CXSA 5BVGA 2Y3IA 3L0CA 3OHPA 4J0DA 1XD2A 4LCBA 1SRRA 1V8BA 1A8HA 2XADA 1QQBA 2JFHA 2X14A 3D4NA 3ZVLA 4XVQA 1A8PA 2KJQA 3NM5A 1OT5A 3Q6NA 2DPLA 3RYFA 1I36A 3KJXA 4Q18A 3TNFA 1KY3A 3CUTA 5CRIA 2E6UX 1T8WA 1TRKA 2ZQZA 4PVCA 1MX5A 2GN1A 4JEIA 1UKCA 2CD7A 1WUIS 4MX8A 1ZOLA 4O4IB 3DFMA 2JJ2A 4DG9A 4YONB 4Y9RA 2CE7A 2F62A 2R1TA 1T1EA 2GZ2A 2IXAA 3IT2A 3KB6A 3P4YA 1E0KA 2OBFA 1IN1A 5AHOA 1JHVA 2UYYA 1AK1A 2F64A 4XPIB 2P2ZA 1E4VA 1Z47A 2LTAA 2ZB8A 3ZE8A 3CE6A 4ZOLB 2FKNA 4ZDWA 4CL8A 1B41A 3HVHA 5CFQA 4PZUA 4YT5A 4ZT5A 3PJDA 5FFMA 1JXMA 4MUHA 4N0DA 3HV0A 2JAQA 4R3UC 1QHHA 2EF0A 2RC5A 3PIIA 5I9SA 1MGOA 2OAGA 1P1KA 1A9ZA 3JTEA 4ZAYA 3T7EA 5HZHA 5JSQA 1ZEJA 2VAPA 3QF4A 2GBLA 1I6KA 1TX4B 1R1DA 2OE2A 4RYLA 5BW4A 3DZKA 3KWFA 5DLEA 1G8HA 2I2CA 3RAGA 5ALTA 4YB8A 5E4JA 4WBSA 4XCVA 2ORIA 2EKLA 3ZCVA 4EVSA 1NSYA 2J9FB 5CHYA 5HGXA 5KYYB 1BU5A 1DWQA 2SKCA 3O2NA 3OJXA 4TXMA 4AUKA 1GL9B 1UBHS 3DZ8A 3MW8A 4HH4A 4TUYB 4X60A 3LPAA 4EJ0A 3MELA 2XUKA 2ZTVA 4KUEA 4EI8A 3N2IA 1J23A 1Z6PA 2HMTA 3HSYA 2HX1A 2X0IA 5EE3A 3ZHCA 1GZVA 1OW3B 2YN4A 2VHTA 5G4LA 4FFDA 4JHLA 4RKFA 4RH0A 5L7WA 3HACA 1KKUA 1U7DA 1H69A 3PDUA 5A5DA 2GJSA 3R23A 4UFNA 3U7FB 4MH0R 1II8A 1DQRA 1K06A 2EDAA 2Q5CA 3OT1A 4EX6A 1Y3HA 1XJ0A 2DP4E 4ENQA 4EA8A 3DDSA 4PC2A 1G16A 4MRVA 2X9LA 1DZ3A 2ORED 5BSMA 3T3OA 2HSGA 1CD5A 4HQ0A 4JJGA 3UWMA 5IKEA 4DEYA 3FHCB 4ZCIA 1AUPA 4XOIA 2C8KA 4NXMB 1IHOA 1FUUA 4A3SA 1U6JA 4KQ9A 1AH2A 3UANA 5CXUA 1CV2A 3EXFB 3GJ4A 1KJJA 2JGAA 1E89A 4PBSA 1CF4A 4KNWA 2HH9A 5F2OA 3M83A 4V2UA 3I73A 3DBVO 3UW3A 1OLSB 4CEIA 1RE0A 3L06A 2R1VA 3AJEA 4OMDA 4TMZA 5ENDA 1AF7A 4K9DA 3W5JA 1PS0A 3ZHBA 4EJMA 2WNSA 3CM0A 5KTSA 2I71A 4L0QA 4YT4A 1UQRA 1IDN1 4IEEA 4JGBA 2HAEA 4Y0AA 2WIKA 4ZJZA 2RGCA 1MZPA 1L2TA 1U7WA 2DHRA 1XMXA 2QY6A 4WAUA 2NU6A 4BIIA 1LU9A 2AJ8A 4O4HB 4RX1A 3WLSA 721PA 5KZMB 5CITA 5D8DA 3PNQA 1DMSA 5ESRA 1CJCA 3I92A 4NV0A 1HDEA 1I32A 4P80A 4C01A 4EI7A 4H17A 2HOQA 1ZIYA 3OTQA 4E6PA 1VCMA 3SX2A 4CUJA 4WN3A 1PLKA 5BQ5A 3FSRA 2WHPB 3BJRA 4D81A 2H51A 3ESXA 3OG9A 4K3UA 3WLAA 4ENTA 5K45A 2WFMA 4EYQA 2C57A 3NKFA 4L0MA 1KO4A 1XDWA 3IBGA 2JASA 1DG1G 3K6RA 3SJCA 2AQ8A 4YCBA 1E61A 1QH8A 2B2XA 1RHQA 1JBKA 1XFAA 1INLA 5LJIA 4D3YA 1T4GA 1WTCA 2I4OA 1IJFA 1VJCA 5L4NA 1KO1A 3C1AA 2A57A 4I66A 2AW5A 1WDLA 3DWGA 4J0CA 4Q6WA 1Q0RA 2D0DA 5KIAA 4EECA 4PYRA 4OKNA 4BP9A 2Q6KA 3OCZA 2NTEA 3AF4A 3DE6X 2WJWA 2XJ9A 4QJ4A 3B13B 4F6CA 3RTAA 1QOPB 1SBZA 3M1AA 2A84A 1NW4A 5KYTA 1YL6A 3IIKA 3F47A 5E4TA 3VR0A 1IAVA 2WNIA 3IQFA 1E9FA 1SC6A 3CUYA 4NENA 4HH1A 3SI7A 3HS3A 4EZIA 1XRRA 3MJ4A 4CF7A 3A8TA 1XTIA 2FZ4A 4CIDA 1L0BA 3K9CA 4HDMB 4RFSB 2A35A 3NOQA 2V7PA 3WWEA 4HGZA 4CM9D 4YYZA 2DBRA 3BHIA 5MN4A 1TFRA 4YIKA 4DNQA 1USIA 1FFAA 4OHXA 2R97A 3RU7A 3GU3A 1KEKA 1M8FA 1MIOB 4GBMA 4RD3A 4A0GA 3BXXA 3IKJA 4IRUB 2NP7A 2RK3A 3TZCA 3TF5A 3ZHUA 5K0FA 3DMPA 4G5OA 4L15A 1JSLA 2B3DA 2PSJA 1XBTA 4MKFA 5ELMA 3TI7A 4CFSA 1PDVA 3KVYA 1VKOA 2J48A 4PE5B 1Y8RB 1JQBA 4NCAA 4UUAA 4WCFB 1RTTA 3HYNA 4DCMA 3OOHA 3GWZA 1V25A 4HG2A 2ET6A 5C5IA 4BGDA 2EJTA 4HNGA 5KOIA 2RBKA 2ZU6A 2ASVA 1XZ8A 1NBHA 1OXBB 1PL8A 3M0EA 3QOYA 5C46F 5CFOA 1NQAO 3NFRA 3H97A 4JENA 4BMSA 1G8YA 2VP9A 2JFUA 2XSZA 4M4SA 2OSBA 1WWKA 5TPZA 2W6ID 2EARA 4S12A 3WMXA 1JILA 1JVBA 1FMFA 2O3QA 2X0NA 1H9AA 3OLXA 4H7JA 4IGAA 3G59A 4IDNA 4OB7A 4UE3S 4V0LA 1R0KA 4WNYA 4MUJA 4QSHA 3SE0A 4JOSA 4QLAA 3FKSA 3H5RA 4ZEOA 1B73A 3EMVA 2E6KA 2OGWA 5KI6A 2Q21A 4L8VA 2NW6A 3O8NA 4Z3OA 1CR0A 2JCVA 2FB9A 1JQJC 1ZN8A 2WW8A 4M38A 3IB6A 5CVDA 2GVNA 2CEKA 1I94B 2AOXA 3BTVA 1GDHA 4XR9A 2PBLA 3V48A 3Q1LA 1DRWA 1PR4A 3VPCA 5B12A 2AB0A 3BH6A 4IAOA 4C6TB 1KE1A 2ODTX 3V8RA 3OJWA 3ZDXB 4MYDA 4AMYA 4E30A 1DCTA 2O3SA 3B78A 3ERCA 3PWKA 4C07A 1NURA 2WKQA 2NZ8A 4TWIA 2F8MA 3FDZA 2HBRA 1DXQA 4QQNA 1NU6A 3W2EA 1P0QA 1Q1ZA 3CTMA 3KLOA 5BN5A 2JFBA 3FSGD 3MS7A 2FUEA 3TPZA 4D4IA 1BMTA 2FW9A 1GAQA 2F7SA 2J6CA 4WNAA 2HNAA 1X80B 4RQUA 5BV2P 2EZ9A 2LV8A 3GG2A 1X70A 4HDNB 3DUFA 4ZT7A 2A9KA 4AZ0B 5ALZA 2G7ZA 2G77B 2BFCB 2Q2NA 3A3NA 3ABIA 3PEEA 4QUIA 2HU8A 1CLUA 2GVZC 2V7VA 2W0SA 4U3JB 5D87A 5CCDA 5L4LA 3Q15C 1VOTA 3VVMA 2COUA 1FDOA 1XQVA 3OP1A 3OVMA 4FKMA 5F35A 3T7JA 1W2HA 1FS5A 2ZT6A 4NU8X 3G8YA 4RK4A 4DM4A 4DIOA 2C78A 1HE1C 2CMGA 3IURA 3EVEA 4MVJI 1E2NA 2FHPA 4YUVA 3JWJA 4C2AA 2CL5A 2PJUA 4IF4A