2CLCX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gtp (2)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide-binding protein
molecule keywords GTPASE HRAS
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2clcX00
2HT1A 2A5JA 1SXJA 1OE0A 2ZJBA 3VKWA 1ANKA 3IHWA 5FBVB 1KNXA 2P6UA 4LJYA 4ACBA 1KGDA 3ZD6A 1GWNA 1C4OA 1WA5A 2PJZA 3AF0A 3VR6A 4QM6A 2O0JA 2E9SA 4GMXA 5KUTA 4MDEA 1KAGA 4XVUA 1GILA 2V4ZA 1MO3A 4HB4A 2J7PA 3VNVA 4OQLA 1W49A 2C5LA 3OFND 4IOKA 2NO6A 4AKIA 2A7QA 3VHLB 3REFA 4LBZA 4ZDWA 5BN5A 1TEVA 1L8QA 3U3OA 2G3YA 4NONA 3UWKA 2FSIA 4QJ5A 3CPHA 1M34E 4KLZA 2QMEA 2BMEA 3AVTA 1JI0A 3D8BA 1OT3A 1W0KA 3BFKA 5JWHA 2W6IA 4F38A 2ANCA 4WZBE 2CBZA 2YYZA 2NIPA 2RMKA 3QBTA 1NMXA 1HUQA 3JZAA 5BYJA 4DDTA 4TLDA 2HV8A 2DFKB 3PFIA 2GXSA 3OF5A 1UKYA 4WW0A 2EVWX 1CR2A 4Q4AB 2ZITA 1VYVA 2ZYTX 3IHLA 1VIAA 1Q3TA 3BB3A 1KSFX 4L8GA 3W6PA 1JJ7A 4CW7A 4DSOA 2RGCA 4JVNA 2R6AA 3AVQA 4MRSA 3UK6A 1LW7A 2KE5A 3ZS8A 3KQUA 5F98A 1ZC3A 5K8UA 3VX4A 3TIFA 4WAUA 4LYJA 1XD2B 1QZXA 2VP6A 4YQFA 2GILA 2O5VA 2ZETA 1XJ0A 2Z43A 3SJZA 4DIEA 2GDJA 2BWJA 2Z6VA 3HU2A 4HLQB 4QXAA 1AJEA 1G1MA 2D06A 3U7HB 3BH7A 5KNBA 1H8HD 1FPMA 4O2LA 3Q9LA 1W2GA 2QSZA 4IDPA 4JLAA 1R0WA 3WP1B 1Q1BA 5DNYB 2A5GA 2CMKA 3P20A 4OQFA 1W4RA 3ND9A 3ZIAA 4JLNA 1TNDA 2ZRLA 2F43A 5DISB 2OE2A 2A5DA 2CL7X 1UBFA 4HAWA 1CLUA 3DDCA 3SR0A 4U00A 3ZZTA 1GL6A 4A92A 2FPLA 4LC1A 4EAQA 4BQSA 4YMUA 3T12A 4I1VA 4NMMA 4DT1A 1XJCA 3RRMA 3O8RA 1ZIOA 1S9HA 1CIPA 1DBSA 3D6TB 2DBYA 4M9QA 3SS8A 1RFLA 4I1SA 1IY1A 3LBHA 5E7IA 1M7BA 2RGDA 2VBCA 2ZSAA 5F3WB 3AB3A 3RWOA 1NF3A 3LA6A 5TDHA 4HYYA 2BOVA 2BBSA 4PQYA 5L3RA 3U61B 2VSOA 3U60B 4BFVA 3FDIA 3KUCA 2LWIA 4DCUA 4IDQA 4ZDKA 4UQOA 4P4TA 1RIFA 2IUUA 2YHSA 2F55A 1OXTA 1W44A 1JB1A 1TF2A 4EDHA 4OYHA 1XBTA 1TQ2A 4JKIA 1TQ4A 5KU1A 4PZZA 1E1QA 3U6BA 1XD2A 1RJ9B 1NG1A 3G5UA 2IWHA 2MSCB 5HE9A 5J40A 4EUNA 5BXQC 2W2TA 1FUKA 5IK2D 4PHFA 2EFDB 3KFXA 3AGQA 1XXHE 2VHCA 5AWFC 3NXSA 2W0SA 4M9SA 1P7CA 2A30A 4HSEA 3THYB 1ZD1A 5EE0A 1UFQA 4JL6A 4DB4A 2XOKA 2C98A 2XSZA 2IC5A 1SKQA 1KO5A 3U44B 2VHTA 1E79D 1ODFA 4MKFA 4YMWA 1U9IA 3T34A 1KZGB 2IYQA 4NCNA 1N3BA 3FMIA 3B60A 4PAOA 1P2TA 4BPBA 2VP0A 4TLBA 3WHLA 5DYIA 3CIOA 2QQEA 5FOXA 2ZRNA 5KOYA 3VKHA 3ZYCA 2O8EB 4Z54A 3EG5A 2FH5B 3GJ0A 1PVOA 3PUXA 4UNQA 3ZVMA 4F7WA 4DIDA 4TT3A 2C99A 5JRJA 1A2KC 2J3EA 1AN0A 2CE2X 3AF1A 3ASZA 4P31A 1RC8A 1EFTA 2OZEA 3BFVA 2G9NA 1WBBA 3A36A 2H8KA 5FOWA 4KVGA 1NLYA 2ZE7A 1D8TA 1W1WA 4BFZA 1OIWA 2WHXA 4H1UA 3SEAA 4Q9LA 1A82A 5D3MA 3ECCA 4YMVA 5H1YA 3RYTC 5JECA 1SXJE 1ZNXA 1ZU4A 5K8IA 1E96A 1OW3B 1GAJA 2ORWA 2ZQ5A 4ILEA 4XD7A 1E4VA 3TH5A 5DH9A 2FWRA 3RS5A 3MGCA 1W5TA 2DCUA 1Q0UA 5KO2A 3W5JA 5LB2A 4K8OA 4Q1FA 1RKBA 2AL7A 4I4LA 3IDQA 2QQ0A 2IBMA 4WOPA 1KTVA 2GK7A 4OJQA 4QFMA 4TYWA 4B33A 1FQKA 2D74A 4DC9A 4ZIRB 2PBRA 4PC7A 3PXGA 2ANBA 3C5HA 1A7JA 4LYAA 3GEHA 2WMNB 4YMSA 4IXNA 3WMGA 1M7GA 3I32A 4DDWA 2P65A 1XCMA 3ZH9B 3R7WA 1OXVA 3RVBA 3PIRA 4B3BA 3CKLA 1WXQA 3ZQ6A 1X86B 3ADCA 4FCVA 4RZ2A 4B2PA 4BLTA 1T8UA 2WJJA 3K0FB 2O0KA 2XOKD 2XSZD 3Q85A 4B71A 3I5YA 1IJFA 2UZ3A 1T3LA 2JJ8A 1PUIA 5J4KA 1DAGA 221PA 1G6HA 4M0LA 3C14C 4P4SB 1W36D 2I1QA 4Q21A 3LRPA 1H8ED 4R98A 4C3ZA 2G0TA 3R8FA 1W7AA 3PCRB 4LC0A 2V7QD 1PLKA 4JMPA 4HAZA 4JVMA 1I4DD 4B3GA 4NYJQ 4DLSA 1ZCBA 3RLFA 3W5IA 4PSKA 3WHKA 3K0SA 3BH6A 4LJAA 4DDVA 3BJIC 2CHQA 4V0KA 1ZD9A 4HDQB 1E9FA 2WTUA 4EPVA 1M1YE 1P3JA 3V4FA 1IN5A 1TU3A 2JGNA 4W5WA 2B6HA 4OQNA 1E2JA 2IYRA 1KI4A 5CIWA 2QE7D 2WWHA 4B6EA 1W0KD 2MSEB 2IS4A 3PV0A 3QE0A 3W8NA 5JEDA 3CWQA 2ZS8A 4AG5A 1P72A 4O0MA 4WZAE 5GADl 5BW8A 1SQ5A 1ESMA 3ND8A 4BRWA 1N5JA 4IDNA 2XGJA 3SYKA 4GOXA 2VH5R 3W90A 1RRCA 4L9WA 2IEZA 1T91A 3A4NA 4M9XA 4CT4B 5DI9A 3BORA 2RGEA 4MUAA 4URWR 4MRVA 2HJGA 2YOFA 1KOFA 1P61B 5SZHB 1IN4A 5KPJA 3GLGE 5C46F 5JI3E 2E1RA 2HYDA 2ZR9A 3TUIC 4P3YA 2OEPA 2PCJA 4JT2A 5L3QA 1Z63A 2C77A 1G17A 3B9PA 2X2EA 1E9EA 5TXGA 1M2OB 1ZUIA 1N6HA 1JQJC 3HYRA 1JAHA 2O8BB 5F9FA 5JEEA 3IO3A 1XRJA 1ZAKA 3MFYA 4PSVA 5E3HA 2BM1A 4D4KA 2OT3B 3U7GA 2IS1A 1LV7A 2O8FB 2FZ4A 4S2EA 1V43A 2OAP1 4B2IA 1US8B 1BH2A 4LV8B 1WE2A 4B47A 2GJ8A 4JLPA 2A5YB 1ZBDA 4JLJA 4OL0A 1SKYE 5EQTA 2JCSA 4EQ6B 1E0SA 3LO5A 4QHSA 3TVTA 2VTKA 3TAHA 1OH7A 3HP1A 3N70A 2R44A 4Q4JA 2XAUA 4Q48A 1SKYB 2OCPA 3U7EB 3QKTA 1PUJA 1IHUA 2IUTA 1SVLA 2O52A 2EFEB 2WOOA 3P1JA 4AYXA 1II9A 2CCJA 3NWJA 1Z6AA 3MSXA 4US1R 1MO5A 2ZREA 1ZYUA 4M9ZA 3QKSB 1E9AA 1ZC4A 2BMJA 2L0XA 3SYLA 2JLZA 3I4LA 4DVGA 2AHOA 4PO8A 3GJXC 5EE3A 3MAAC 3FKQA 5FBWB 3IO5A 2O8CB 1ZU5A 1AS2A 3TNFA 2WIBA 1US8A 4BLSA 4DJTA 1YR6A 2LKCA 2IYTA 3FVQA 3LLMA 5FPHA 3SN6A 4LPSA 4Q00A 5D3QA 1KI2A 1XU4A 2G1KA 3KFVA 4CEJB 3TAUA 1EESA 1E1QD 2X19A 3VU9B 3QF4A 4LBVA 1Z6XA 2GCPA 1EFRA 2P6NA 2ZJ5A 5L3QB 1QVAA 3EPKA 1DE0A 2VSXA 4NPHA 1IJEA 2PL3A 2VP4A 2NPFA 1CBUA 2EYUA 4LYFA 4AY2A 2VSFA 1NIJA 4YLGA 3OEED 1E2GA 2HF9A 2JIZA 4A4DA 1M7HA 1KI7A 1AKEA 4ZO4A 2QP3A 3SBDA 2R6GA 3THXA 3SNHA 1E79A 1GUAA 1E6CA 1D2MA 3EARA 3QIAA 1MT0A 4OJKA 4LJ8A 1BIFA 2AKAB 2REXB 2Q9BA 2IL1A 1LTQA 1OXUA 2GNOA 1KDOA 1T9HA 1XTQA 3A58B 3O8BA 1RYFA 4FMDB 4JLVA 3X1ZA 4EFNA 1X8LA 4P4UA 3SHFA 5A5GA 3ADKA 4D4MA 2JA1A 2NGRA 4XWOA 4H1VA 2GBLC 1JNYA 4JLBA 4M1KA 1SXJD 1CS4C 2ZROA 4B3CA 2QL6A 2OFOA 3R9IA 4UKDA 1XPOA 1NNEA 2PZEA 4UJ3A 4DLWA 4PPNA 4A8JA 1A4RA 3EA5A 1A2BA 2JDID 2X77A 3QKRB 4NCIA 1RRFA 2FU5C 3GLHB 1MOZA 4RFSA 4XVRA 4BLPA 5CB8A 1GSIA 4MGZR 2OV2A 3U3RA 3N5CA 2OM2A 2ZYUX 5LB4A 2RGNA 3PEWA 3EPJA 1CEEA 3MWLA 1N6OA 4YXWD 5L8VA 1LY1A 3GJ3A 1EK0A 2FF7A 3GJ5A 1G19A 2OLKA 2QMHA 2IYLD 1ZNWA 3BE4A 4FCTA 5CJPA 4TL7A 3CM0A 2X8AA 1E9DA 4XTRA 1XZQA 4KAXA 3B2EA 4DWJA 4Q4HA 2YVUA 4XD7D 2AK2A 4GT1A 1DOAA 3OZXA 4Q18A 4TYQA 4HZUA 5KSYA 1WF3A 1I4LD 2MMCA 3QQ5A 5TMPA 2A78A 3BB4A 4PR0A 2B7CA 5E95A 2F9MA 3C8UA 4AI6A 4D80A 4FWTA 1S3SA 4UXJA 3WYFA 4XIGS 4UXHA 4NCKA 5AUOB 4QGFA 1JPJA 3VR3A 4A6PA 3QXCA 1VHLA 1VTKA 3EAQA 3TW8B 3CR8A 3HPQA 3RS4A 1GIAA 1RZ3A 3IPYA 3AM1A 5A0FA 3ZQJA 5BN3A 4Q1EA 1COWA 1NY5A 2BVNA 2GJAA 4BLQA 3AVYA 1KI6A 4BFYA 3NC0C 2UVQA 4AIIA 2Z0MA 2WSSA 5CK4A 3UPUA 4X8HA 4MKIA 1J8YF 5C2JB 4FINA 2EW1A 3ZDQA 3NHAA 2BMFA 2JIZD 4KBFA 1NMZA 3EWSA 2GVZC 4PO1A 4Q1CA 3N2EA 1TUIA 2YZ2A 4E09A 2FX3A 4CRWB 1JBKA 1KSHA 3IBYA 4NBSA 2Q3MA 4PO9A 4URZR 2V3CC 3LFUA 3R8CA 3RNLA 4WXRA 1S3GA 4FMCF 1Z3IX 2GEUA 1CP2A 3GFOA 4HAXA 4CT5A 5EJEA 4U5XA 1W36C 5AUQA 1F2UB 2R62A 1GNQA 1ZM4A 3U4QA 2BKEA 1U8ZA 3UMRA 1MO4A 2VP9A 1OFUX 2ZUDA 1ZNZA 1SHKA 2CJWB 3DVLA 6Q21A 3DOEA 2O8DB 5FPKA 1R7RA 1TU4A 2MMGA 1R5BA 3BERA 1A5TA 4QNRA 1AGPA 3GJ7A 1J70A 3CRQA 1AIPA 4C0BA 4Q01A 1ZM9A 3KQLA 2BM0A 4RJLA 3PUZA 1G3UA 1E0JA 3A8TA 2G83A 2JJ2A 2QTFA 1UADA 1X1RA 2AWOA 2AXNA 2RGAA 4JIMA 5EXSA 3RANA 4EFMA 3QPUA 1GOTA 4IKEA 4RZXA 2AD1A 5JCPA 3KQNA 2FDCA 3GLIB 2NO0A 3FHTA 2IHBA 1LS6A 3KJIA 1IAQA 4QBHA 2F1IA 3LXRA 1R10A 1IQPA 3LX8A 3B9QA 3K0CC 3C16C 4ESVA 4Q9KA 3A1UA 4BE7B 1Z0FA 5HCNA 5HTKA 5G40A 1SVMA 1DAEA 2C78A 3K9NA 1N6KA 4TQAA 2FEOA 1BYUA 1DPFA 1N2CE 2B7BA 1YR8A 4MUBA 3RRNA 4E22A 1DAKA 1NVUQ 4CEHA 2YWEA 3AVPA 4M1SA 4IDHA 1Z0DA 3PJRA 3CUEF 3G82C 2WVJA 1F5NA 1T5LA 4TWZA 5E7JA 2ZIAA 1XEWX 1W0JD 2OCBA 3FMPB 3JVVA 3L0IB 3QPWA 1VG8A 4N0DA 1JR3A 2Z5FA 1P73A 2CNWD 2WBLC 2QORA 4IXMA 5BWMA 5JS8A 2YWHA 4AK9A 5JJIA 2J45A 3FHCB 1YRAA 3PVSA 5E4FA 1W46A 3CF6R 3CX8A 2ORVA 4Q7MB 4QBIA 4EPTA 5J47A 1R0YA 5DE3A 1HYQA 1TPZA 2OLJA 3KX2A 1KJYA 1X1SA 3DOFA 5FPTA 1RJ9A 1EWQA 3RSOA 1YHNA 1FMJA 3EA0A 3SZRA 1Z6TA 2IYVA 4R2IA 1KI3A 3HYTA 4N1AA 5H70A 3AKCA 1NBMA 1U8AA 4V0ME 3WP0A 2ZM5A 4PC6A 3CX6A 3MWYW 1QDEA 2R6DA 4FIDA 3K9LA 1D2EA 4LHYA 4NCHA 2R9VA 4XTCS 1GRNA 1U94A 4PPGA 3EZ7A 3DKVA 1OFIA 3W9YA 2ZSEA 3BBPA 3C41J 4QC2A 1UJ2A 3TJZA 2F3TA 2QU8A 4RFVA 3X1WA 4URVR 4HAUA 4PC1A 4BGDA 5G41A 4MGKR 1ZM7A 4EPXA 1U9IC 2EWVA 2ZRJA 3QENA 2YV5A 3EXAA 3M4YA 1KSGA 4ESHA 1VG1A 4CEHB 4KCGA 1II8B 5K8LA 4G01B 4Z8XA 3B85A 4C0AC 2QM8A 2CXXA 4UXIA 2QA5A 3L82B 2GK6A 3NBZC 4DZZA 2OESA 4TQUS 1U0LA 3TSZA 4GP6A 5AUPB 3DHWC 5IT5A 5DN6D 3GEEA 4US2R 1BOFA 3GLIA 2X2FA 2CLDX 2IXEA 3X2SA 4DKXA 2QBYB 3NTUA 3KKMA 3T1QA 5HZKA 2CVFA 1CJUC 5G3YA 1G3MA 2GEVA 5H8WA 2CNWA 1ZIPA 3TBKA 1JALA 2QAGC 1W4BA 2W58A 5FR2A 3W6NA 4A1FA 1MABB 5HE8A 2DYKA 1CTQA 1KK2A 4W5HA 2QZ4A 3FFBA 4HLDA 2D4HA 3QPVA 2FGJA 2RCNA 4JSYA 1WMSA 1JJVA 4C0JA 3B8HA 4NYMR 1R8QA 2QT0A 1XB2A 1VYTA 2N1BA 4PZYA 3K9GA 4CIDA 2O8DA 1FX0A 2YOHA 4DLXA 4LGMA 3LX5A 1AQUA 5DLQC 1LNZA 1XTSA 1R0XA 1N6NA 3T15A 1NVVQ 2QI9C 4A6XA 1HH4A 2UKDA 2EFCB 3DZDA 5TVKA 2HCBA 2IS2A 1OHHA 3WXMA 3U6KA 4TMTA 3G0HA 4DRZA 1XEXA 1TL7C 2PLRA 3Q72A 4RD3A 4OK5A 4V03A 3TK1A 4URUR 4IOJA 4LOAA 1W4AA 5KNCA 4DSTA 4CDGA 4FWIB 4HAYA 3P4YA 3K0CA 4MYTA 1UBGA 3LVQE 1GITA 1Z29A 2XNDA 3ZVNA 5GVSA 3F5FA 3REGA 1JEEA 1XXHB 2C04A 2CDNA 4X8LA 3SJAA 3CNOA 2ZRHA 2C8VA 4PFSA 5TV2A 4B76A 1NVVR 1KI6B 1Z2AA 2GCOA 2RKOA 4OI4A 4BFSA 3EZ9A 2WPDA 3L0PA 3CR7A 5JLJA 1VKJA 2OO7A 2K5UA 3NEYA 3W3AA 4Q66C 4Q4HB 3OESA 4ON9A 1N0WA 3M1IA 2LKDA 3KUDA 5LBIA 4B3FX 1ZJ6A 3B1YA 2IF2A 4BLOA 3LNCA 3P26A 1KNQA 2NZ8A 5EUMA 4M21A 1B23P 2XNSA 1E2LA 1NY6A 1CJKC 1F6BA 1OV4A 4NYJR 5FL3A 1ZRHA 4HAVA 1S9DA 3K0AB 1CKEA 4G5SA 1XEFA 2J0UA 1R8SA 2QRNA 1MKYA 2QP4A 3GPLA 2QRZA 2J59A 3QKRA 5FFMA 4GPTA 5B64A 2G77B 4EFLA 3KB1A 3KQHA 1Z22A 5EP2A 1IBRA 2AWNA 2QGNA 2NMVA 1G4AE 4R2HA 1GVNB 3IIKA 1L2TA 1Z47A 4GNKA 2VYFA 1Z28A 5DHFA 4B43A 5H68A 2FJUA 2QN6A 3DM9B 421PA 1QHNA 3GLFA 5C4GB 1O3YA 4TTRA 721PA 4LYHA 2Z83A 3QSYA 2WWFA 5EE9A 4A8JB 4QOSA 1WB9A 3CPEA 1KDPA 5FI1B 4JJKA 2ZRPA 3AP2A 2IYSA 2CK3A 1ZM3A 1YQTA 2WV9A 4BUJA 1QG2A 2LCFA 4TYYA 2REOA 3MCAA 4C0LA 1NKSA 2JLXA 4Q7LA 3C7KA 5DSZA 4JLKA 3BRWD 1RW4A 4FN5A 2AXPA 2J87A 4AKEA 2C95A 2EU8A 1NJGA 1J8MF 2AN9A 4B2LA 4C2UA 1E2NA 1F2TB 4L16A 1XPUA 121PA 4PQFA 2R2AA 5DGXA 3K8YA 1HQCA 4B44A 4FI3C 3RRZA 3PUVA 2IW3A 5DI3A 5P21A 1PZNA 3HDTA 5EUQB 3A6PC 4JT4A 4PQRA 4WVFA 3OFNA 5FPYA 3QF4B 3K09C 1XCGB 5BN4A 2RAPA 3EIEA 4K81B 1NJFA 2IYXA 3VR2A 2HCJB 2P0EA 4A82A 4A0GA 1RRGA 3ZGXA 3L0SA 2JLWA 1P60A 2XITA 4KODA 3AQ4A 3K70B 4JJZA 5LD2C 4QHTA 4EJSA 1FQJA 3DL0A 1KYIA 3IQWA 2ZI9A 4OI1A 3K09A 3P27A 3IUYA 4LJ5A 4LWZA 4Q4LA 1GP2A 3A1SA 3L2OB 3H2YA 2QPOA 1VPLA 1KZ7B 2NO1A 2Q9AA 1AS0A 4TMVA 1RYHA 3AKEA 3B5JA 1ZCAA 3Q3JB 5TY0A 2V54A 1GRRA 4K46A 4M2LA 5IDVA 3QKSA 3BH0A 4DUGD 4Y0VA 3KB2A 3IKJA 4OQXA 2B21A 1XTJA 3DZ8A 5JJKA 4JL8A 3THOA 1S1MA 4CZ2A 4YMTA 4HLUA 1VCIA 3A4MA 3QVUA 1XEWY 3T5GA 3I5XA 3B1WA 1T3SA 3H84A 3WNCA 5CB6A 5EE5B 4B32A 2OCYC 2QPTA 2G0NA 2GZAA 4RD6A 2P3SA 3UG6A 3P4XA 5FOTA 3OIUA 1SXJC 3BIFA 2BEJA 2G1JA 3Q5DA 1ONBA 2CK3D 2DPXA 1D9ZA 1EFRD 3FMFA 1VCOA 3A4LA 3PEYA 4B48A 2HYIC 2CLSA 3K70C 1E2EA 2ZVPX 1QHHA 2J0VA 3NH6A 3CF0A 5F9HA 1F60A 3BOSA 3UMFA 4RZ3A 2ZVQX 4AD8A 3WBJA 3T06B 1AKYA 2W6JA 4RCZA 4MH0R 4MYHA 1H8HA 1FMLA 3A37A 2QTVB 4L5BA 3TGPA 2XB4A 4CYMA 3FKSA 4LHWA 3J81k 4S35A 4A2QA 3CH4B 5FBQB 2OFXA 2H1LA 5HPYB 1G3QA 2B8WA 4FXPA 1HQYE 1XMVA 4GL2A 2O8BA 3M6AA 2D62A 3CO5A 4IVRA 3K9HA 2B8TA 2EQBA 3AF3A 3GJ8A 4C0HA 2TMKA 2FN4A 3Q7PA 3V00A 5CITA 3AH8A 4DXAA 3D7MA 2QGZA 2ZANA 4GRAA 3EIHA 4Q7KA 5TARA 1OSNA 2WKRA 3QXJA 3LXXA 2WAXA 3K53A 3UMSA 4D0GA 2QAGA 5HKKA 4I1UA 2ZEJA 4LRWA 1W2HA 1LFDB 1VMAA 1N5IA 4C0KA 2FV8A 4TLCA 1RPZA 1N6PA 4URYR 2KBEA 3MJHA 4RD2A 1KMQA 4LSGA 5DO9A 1H65A 2JATA 1E2KA 1W4CA 4D81A 3IEVA 2VA8A 4KHZA 1BMFD 1WP9A 4M22A 2VP2A 4JVSB 1G6OA 5LPNA 1DG3A 1KKLA 5CJ2A 3LW7A 2DWQA 3KXLA 1EFHA 2ASEA 1E1RA 1Y63A 2FFHA 2GAOA 3EASA 4UNNA 2RGBA 4EJSB 2DWPA 1ZUNB 4ZKDA 2IF0A 2ZJZA 2J46A 3K0AA 4JS0A 5HCIA 2J0QA 5L3SB 4NDZA 4OHVA 3DMNA 3HU3A 4FD2A 3TUZC 4JLDA 1KK3A 1GL9B 3ETLA 1G18A 1ZMXA 2HUPA 3W3ZB 3W34A 2XXAB 4KO8A 4PZLA 3ZZUA 1JEDA 1OKKD 5DI3B 5J4VA 2V8OA 3PQCA 4TMWA 4P4SA 1NN3A 4XJXA 3BB1A 4HLUC 2WWYA 3TR0A 2C9CA 1F2TA 1OH5A 4OHYA 1E0AA 1NBME 4V0MA 2ZR0A 4CEIA 2ZAMA 1AGRA 1SVIA 2ZXUA 1Q3HA 3FKSD 2NO9A 1S4QA 1QHGA 2D7CA 3F8TA 3GMTA 3PUWA 2AFIE 5CYOA 5EP1A 4C0SA 1XNJA 1XZPA 2OHFA 4TTPA 5K8TA 2PLFA 3CBQA 3KZ1E 5FOUA 2GJSA 3NG1A 4U02A 5FPSA 2FSHA 2ZJAA 4RD0A 4JLOA 3R20A 2XTNA 2H17A 1G8FA 1K5GA 1P9RA 2I3BA 2XNDD 1DG1G 4YONB 1YR9A 1JR6A 1D6JA 4Q9IA 3TE6A 2F7SA 4HZIA 2XTMA 3KKNA 2FG5A 2W83A 4QJ4A 2C9OA 1NN0A 3ADBA 3X1XA 2GAAA 3TQCA 2VO1A 3H1TA 1OH6A 1WRBA 3ZD7A 2HXSA 3OEHD 1GNRA 4W7SA 2BBOA 2QMOA 2QT1A 4ZIRA 4QKQA 1Q57A 2VHQA 2P2LA 1YJ5A 5JJLA 1BMFA 2J0UB 1S96A 2OILA 1KI1A 1L7VC 1OIVA 1Z5ZA 2WKPA 3IQXA 1DS6A 5E7MA 4TMKA 2XTZA 4TYNA 3EPLA 4MGYR 4DLZA 3LBIA 1XWIA 5KPDA 1U0JA 2ZE5A 1KKMA 1Z08A 2V6IA 3Q8XB 3X1YA 1GZSA 2QSYA 3BC1A 3MWJA 4Q19A 3VX3A 4A9AA 2ZE8A 2XJ9A 2VIIA 3MLEA 4KYUA 5D3MB 1AZSC 1Y3AA 3FOZA 5B30A 2GJ9A 4BEJA 1P2VA 3RC8A 3DO6A 1E2PA 3EC2A 1E2IA 1TF7A 2ZYVX 3I73A 4J0QA 1DVRA 1U98A 1UKEA 1Z2CA 3UWOA 1HV8A 1W0JA 1MRSA 4MA4A 4LHVA 2JJ1A 3E70C 3WRXC 4G5OA 1FNNA 1JR3D 3LAWA 4ZCIA 2KI5A 4KU4A 1XMSA 3EWAA 3JZMA 4HUQA 1Q12A 4MQBA 4ZCLA 3QXHA 4IVQA 1HTWA 1LVGA 1KJWA 2C03A 5GJCA 2IWRA 1UEIA 5FR1A 3EIQA 2GRJA 3U44A 4KFRA 2RB4A 2O8EA 4KV9A 1OJLA 2WIAA 5L3VA 1XJQA 2ZRIA 3THYA 4M1MA 4DCVA 1YZGA 3AP1A 3DKPA 2XB2A 4MRPA 3RS3A 3PENA 3EW9A 2CE7A 2IS6A 2N42A 5EP4A 4MYUA 3NDBB 1Z6YA 1VCNA 4WIAA 3VKGA 2XZLA 3QOFA 2NG1A 3B1VA 4JLMA 5M04A 4PX9A 5JZVA 2WWGA 1MO6A 1QHSA 1G4UR 1Z6GA 1XFAA 4ZI2A 3IGFA 4LHXA 4NL4H 1HE8B 2ZI7A 2NQ2C 4P33A 4DSUA 1FTSA 3PR1A 1UM8A 1QVRA 4ASUA 4RKFA 1G7SA 4BECA 4XSHA 5TB5A 3GFTA 4RD1A 1OXSC 4FMBB 1EG7A 1P9NA 1TADA 1GKUB 2WJYA 2D2FA 2REBA 4KLNA 4LX0A 1U81A 4JZKA 3KDSE 3CNNA 3QI2A 4TTQA 1KI9A 4ZKEA 1MABA 2IXGA 4QL3A 3TLXA 1ZUHA 2GZDA 3B78A 2NZJA 3A1VA 3KJHA 3P32A 2EFGA 4Q5IA 4PAMA 1OF1A 2DHRA 3HR7A 4PSAA 1P2SA 2SHKA 3OIVA 4BFUA 2UZIR 2ODBA 1BKDR 3SYNA 3HR8A 5DN6A 2FSFA 3TW4A 4A0HA 3LVRE 5CDFE 2QBYA 1XTRA 1O87A 3RS0A 1UEJA 1OB2A 3TKLA 4NH0A 2BV3A 5J4YA 4AKGA 2GKSA 2ZRDA 1R2QA 3AUYA 2YWGA 1E2FA 1UAAA 2G6BA 1KY3A 3OAAA 2XXAA 4RVCA 3QUSA 3THWB 1II8A 2HLDA 3B6EA 3E2IA 4KFTA 1TTTA 2OBNA 3EPHA 2F1JA 4AYTA 4R9UC 4C9BA 1VG0B 2JLUA 4B74A 1LF5A 4RCYA 1T5IA 3U2QA 4HUTA 1F48A 4KFSA 1DO0A 3VR5A 1R0ZA 1UBEA 3NBXX 4D4LA 3CONA 4TL9A 2HJVA 2JASA 1K5DA 2R8RA 4LY6A 5J5CA 4QM7A 1P6XA 2GCNA 3RAPR 3R9WA 4CVNA 3BD9A 3MJRA 2DFLA 2WJIA 3NIBA 3VMFA 4EIWA 2JAQA 1E2DA 4JL5A 5BQ5A 4BLRA 1NIPA 3KKOA 2CJWA 1IN8A 3VAAA 3ZIAD 1OHHD 4IJMA 4DLVA 5AJYA 4I1OA 4BEBA 3AKYA 4MITA 1S8FA 4ASUD 4N0EA 3VR4A 3CWZA 4DCTA 2GXUA 1FP7A 1SVKA 1N5LA 1DADA 1JAIA 3CZPA 4O25A 3AVWA 3VNUA 3B1XA 4R71A 4G5GA 4NYMQ 1NP6A 2DFTA 2OUKA 2QUZA 1DAIA 2XZPA 4L15A 1G3RA 5DIFA 4BFWA 4HI0E 4IW3B 5FOVA 5JFGA 4Q1DA 2ZI5A 4TQ9A 1KK1A 3HPRA 1IY0A 1S1CA 3AVVA 3QJYA 4MDFA 1ZVQA 2W2VA 2WM9B 4KBGA 4KSBA 2WPDD 3GD7A 1G5TA 5FUYA 3NDPA 2Q0HA 5FTMA 3V9PA 1GNPA 4DBLC 1BS1A 3C4JA 4A8JC 5IF9A 4EKDA 4IOMA 1ZNYA 4LCBA 1C1YA 4IDOA 5LD2B 1EX7A 1GRQA 1DTSA 1R6BX 2BCGY 1P2UA 2IYYA 2ZPTX 4A2PA 1E1RD 4X8OA 2YKGA 2ODWA 2VPPA 2ZS9A 1XTIA 2QY9A 2JLRA 4MKHA 4E07A 2ZI6A 1ELOA 1YVDA 4PPFA 1NSTA 1XD9A 4B6FA 3F3YA 4G3XA 1W5SA 4O3MA 1CULC 2J9RA 3WYAA 3RSLA 5KTYA 4FW9A 2KWIA 4UJ5A 1Q44A 1EFCA 4PC2A 4TL8A 1G20E 4YDHB 3I61A 1YRBA 2OXCA 2ERXA 3WNBA 3U7FB 2CHVA 1OYWA 3MG9A 3RABA 2ODNA 4TSFD 3SFZA 4D4JA 4JBYA 3R9XA 5B57C 1SXJB 1U0HC 1VCMA 2GVDC 2ORIA 3MD0A 4TT3D 3GLHA 4RFSB 4V0NA 2ZU0C 4KJZA 5EZ6B 4V0LA 4F92B 3I3SR 1MRNA 1CR0A 2IYUA 2J7KA 4G1UC 3V4RA 1G41A 4NYIR 4Q47A 5DYGA 4KXFB 1KK0A 1FNMA 1AA9A 3NBYC 2I4IA 3EC1A 4OHZA 2FFBA 2R6FA 2JDIA 3EZ6A 5FUVA 1OB5A 1XDBA 1TAGA 2HT6A 2WICA 4NU0A 1Z07A 3DEFA 3FPAA 1RRPA 3D3QA 1L4UA 2ZU6A 2VEDA 4YXWA 2WWWA 4ARZB 4AYWA 4N3NA 1KIMA 4ABYA 2A5FA 4IVPA 4LBWA 2ZI4A 3CRRA 2Q3FA 4L4UA 2QM7A 2A2ZA 1EX6A 3B13B 5IHPA 3U5ZB 1IM2A 1YE8A 3FTQA 2ATVA 1P62B 5CLQA 1PJRA 2VQSA 3VU9A 5JSZB 2QEQA 1D9XA 3NC1C 1ETUA 1T0JB 4Z8YA 4G5QA 3AV0B 4HZUB 3W8RA 4BZQA 1CR4A 4FCWA 2HXYA 3SBEA 4WBSA 4PTLA 2DWOA 3GCGA 5EXXA 2ZRBA 2OSBA 4WXPA 4G0NA 4XVQA 4D0LB 2PH1A 3H86A 2ODEA 3KQKA 3E1SA 1DAHA 2XJ4A 3WNDA 2V9PA 1COWD 5B2ZA 1D2NA 2VRWA 1JPNA 1YR7A 3IIMA 1FL9A 2JJ1D 1NMYA 3ICEA 3RS7A 4JYBA 1IXZA 521PA 1G16A 1OXXK 3CF2A 3QEOA 3CRW1 4NHOA 4LJ7A 2ZE6A 2EFHB 3CRMA 4IEIA 2VP5A 2P5TB 4A2WA 5C18A 1H8EA 3JVUA 4JBWA 3QBVA 4V0OA 1J2JA 1PLJA 5FBLB 4URXR 4XOIA 2V7QA 2GTPA 2ZS7A 4M4SA 5FTNA 1CRPA 1NLFA 1UKZA 4NCJA 2BCJQ 1PLLA 5JSZA 4C2TA 1KSJA 3AVUA 5UKDA 4D26A 3LV8A 2ZUCA 3AKDA 4HB0A 1HT1E 2ZTSA 2D7DA 4BASA 2RGXA 821PA 3THXB 5AJWA 4HB3A 5JMTA 2DR3A 2Z4SA 1ZINA 2ZJ2A 1G9XA 3S1AB 5HZHA 3FHOA 5JCZA 2P6RA 5AJZA 1N6IA 1IOZA 1FOEB 3UXMA 5ELXA 1E2QA 2O8FA 1E3MA 1GM5A 4UNSA 3SDZA 1BO6A 1BYIA 4PXAA 4AKHA 1A1VA 3WYGA 2AD5A 2JJ2D 1Q20A 2PEZA 4CEJA 1QHHB 2YNMA 2GZHA 1OFTA 1ZW6A 2B92A 3GJ6A 5C1BA 2V6JA 2YINC 3A1TA 3TQFA 3F0TA 4RZUA 3K1JA 2V55B 2F9LA 3BK7A 3SC3A 2CEAA 3Q5EA 1Q1QA 4OQMA 5HKKD 5AR1A 4BRUA 2ZSBA 2QENA 2D2EA 4TZ6A 1QF9A 4IEEA 5AJXA 1KO7A 4Z51A 3E5HA 3LQRA 3I8XA 3IILA 2J0SA 2O8CA 4PHTA 3UG7A 2GXAA 2QTHA 4ZI3A 2QG6A 3T5DA 1DELA 1R5OA 4D0NA 3TRFA 5KDOA 2FFQA 3EZFA 1JR3E 3GLGB 2F3RA 4V02A 3CNLA 1Z0IA 1C9KA 4Z1MA 4W9MC 3L8ZA 4U7DA 1QRAA 1MH1A 2AX4A 4M1YA 4H9GA 2X1VA 4KYIB 3SQXA 4KSCA 3FMOB 5FL7A 5JI2E 1I2DA 1QG4A 2C96A 3DPUA 4AG6A 1KO8A 1Q1EA 2F1HA 3ZZ0A 1UDWA 1E98A 4JBXA 5FUXA 3QVVA 1X8JA 3AF4A 3OIYA 3IEUA 1NVXQ 1CF4A 1T3HA 2W0MA 3T61A 1KY2A 2IYZA 2C9YA 2Z4RA 3FFAA 4NP6A 4D6PA 2JLYA 1OKKA 5CK5A 4Q1BA 1I2MA 4A0RA 2GF9A 2HDNB 5GJBA 4MRNA 4PAQA 3THWA 2I1VB 1G7CA 1F3OA 2OXRA 4KFUA 4D25A 4LUCA 5GJWC 1NG9A 1XMJA 2CCGA 4C30A 1RVDA 2CL0X 3SOPA 4F4IA 1KMHA 4GDFA 2H5EA 1YZNA 1S0UA 4WA7A 1FW6A 5C4MA 3I72A 1II0A 1XMIA 4W5JA 3GJ4A 3OIWA 3LH5A 5IRCD 1TF5A 3PITA 2PCLA 1CXZA 2HEIA 1E32A 4EPWA 1CR1A 3HJNA 1DARA 4FMCB 4ZPXA 3WY9A 2FMXA 4HDOB 4LJ9A 3FYHA 3ZVRA 4E5UA 1XPRA 1AK2A 2WJGA 1FZQA 2O0HA 1UKVY 4QHYA 3CZQA 2RGGA 2RHMA 1VIYA 3L8YA 1EWRA 3ASYA 2J5XA 4UNRA 3OEHA 1ZM2A 3PG5A 4OBEA 1HURA 1TMKA 5FOSA 3B82A 4IFEA 3WMEA 3GLFB 1DAFA 4TN1A 4RKEA 1NLZA 4OK3A 4B3XA 2DY1A 2PZFA 2J41A 2WMOB 2IA5A 3OE7A 2FSGA 2HF8A 4QRHA 1G64A 3VQTA 1SHZA 3O47A 1G21E 4II7A 1Z06A 4IRUB 1N6RA 4PANA 5JHHB 4Q7JB 1EGAA 2BBTA 4F91B 5FTLA 1I4TD 3CLVA 1TEXA 3SFVA 4DSNA 1OH8A 5SZJA 5KNDA 1G291 1HY3A 1KDRA 4NKRA 4QGGA 5DHAA 1WBDA 3B7GA 1E9CA 1Q1ZA 2BJWA 2AK3A 2BJVA 3AEZA 1P4SA 3A1WA 2GWHA 3OEEA 2QAJA 2ZJOA 3ICQB 5J4LA 3NKVA 2CCKA 2E87A 5CM9C 4OHXA 4DB2A 4F4JA 1Z0KA 5EP3A 2EYQA 3QXXA 4HUQB 5CLLA 3RDPA 3RS2A 3AUXA 5AJVB 1EFUA 1W48A 3LLUA 4ACAA 5KYKA 1HEIA 2FA9A 3O8DA 4GZMA 2Q3HA 2FGKA 4PPQA 3N2IA 5CIQA 5FBRB 5J4HA 4OHWA 1FUUA 2A9KA 3SE0A 5FTKA 4DLTA 3TVDA 1XX6A 1XXHA 1E9SA 3QNUA 2ZYWX 1CRQA 3I1FA 1M8PA 1ESNA 2F1RA 3O8CA 2DFNA 5FH9A 5FTJA 3Q7QA 4C7OB 2F6RA 2IHYA 4BZXA 1DAMA 5G3ZA 4OK6A 2FNAA 1NVWQ 1KHTA 3NH9A 3UIEA 3TMKA 3EX7C 4OI2A 3GFPA 3TSOA 3UKDA 2G88A 2ZRFA 2OAQ1 1N6LA 1YZQA 5FUWA 3SHWA 4NE2A 3BAFA 5BYKA 3X1DA 4B35A 1X3SA 1DEKA 1G8GA 2YJTD 1G5PA 2PEYA 1HA3A 1FP6A 1FX0B 5EE1A 2GXQA 3VTKA 3C5CA 4LJ6A 4TLAA 4TMZA 3BWDD 3LD9A 1HE1C 1N25A 1G3IA 1SGWA 4Y0AA 3OE7D 3MRSA 1NRJB 2ZAOA 1Z8FA 1JQLB 1G7TA 5JWOA 4DEXA 1W36B 2JLSA 2VLIA 3C15C 3SJBA 1YU9A 2A3RA 1Z0AA 4IFBA 4P0TA 1AZTA 2OBMA 1QHYA 3QKUA 1AM4D 4C7OA 3VR1A 2GF0A 3PUYA 2WSSD 1J99A 2GEDA 1KDTA 4LV6A 2KJQA 3PEVA 1QBKC 4HEJA 3CH5A 4MGIR 3VHXA 2MSDB 4OKSA 1CJTC 1GL7A 1S2MA 3MMPA 4GP7A 5GVRA 4CEIB 1L4YA 3OAAD 4EPRA 1E9RA 1JECA 4GOKA 1MR3F 4C0QC 1WQ1R 4GOJA 5EXTA 1G5RA 5CDFA 4DHEA 4EPYA 2PX3A 3SU8A 3ONWA 2ZRGA 2HLDD 5KHOC 1GDDA 1E99A 2FPMA 4R7ZA 1YZKA 4MRRA 3I92A 3RHFA 2WSMA 4AURA 1PV4A 2WJVA 5EZ5A 5B58C 1N5KA 4QNMA 1T4GA 4TYPA 1GFIA 2RH5A 1ZD8A 3M0EA 3AGPA 4GI7A 3LDAA 2F43B 3FB4A 1KJZA 4LK2A 3IPXA 2OBLA 4DDUA 2FOLA 1CJMA 2AR7A 2ZSFA 3CX7A 2BMDA 2CL6X 4IHQA 2P67A 4ZDIA 1T6NA 1N0UA 4PHGA 2FPKA 1E2MA 4XH9B 4QBFA 1NSFA 2NOAA 2ZRAA 2PZGA 3DMDA 1E94E 1TX4B 2WZQA 2PX0A 4NZYA 2PT7A 4M53A 3TUJC 3NBFA 2OCAA 4PC3A 3D31A 4L9SA 2CHGA 4HDCA 4LJ4A 3MWKA 4MYCA 2BIFA 1KO4A 3T1OA 1G8PA 1U99A 2QROA 3IBGA 5KSPA 4KVAA 1NN5A 3ZS9A 3NVAA 4NYIQ 1GKYA 2RHDA 3CPJB 2VL7A 2W6ID 4QJ3A 5KSOA 2JLQA 4C4PA 5HR5A 2XX3A 1IY2A 3LQQA 3L0OA 3EZ2A 4I81A 1AQYA 1LF0A 1E9BA 3BGWA 1VG9B 1Q22A 1SVOA 4CF7A 1GG2A 2IX3A 3I8SA 4YDSA 3GEIA 2H7VA 1G8YA 4M1TA 3QG5A 4Q9JA 4DCNA 4ZDJA 4Q4AA 1SZPA 1B0UA 5CM8B 4A0FA 2KBFA 4DUGA 4E03A 4ITRC 4F4CA 4LDJA 4A36A 1E0KA 3BXZA 4B73A 5AUNB 1IN7A 1KMHB 4Q03A 1MV5A 4JSTA 4QGAA 1G7RA 2ERYA 2GJKA 1QHXA 3BFXA 4GFDA 2WJHA 2WWXA 5SZKB 4DT1B 4CGZA 4LZZA 2GESA 4GBMA 1XCPA 2PMKA 3NHBA 4HLCA 3FE2A 2RGNC 1IN6A 3BS4A 2BDTA 4YC7A 3QG1A 1OPXA 2VF7A 5L3SA 1NBMD 1T8TA 1OFHA 1K6MA 2YC2C 1LS1A 4HATA 4KITB 3B1ZA 3LWNA 1R4AA 1WDTA 5EXPA 4OI0A 4WZ6A 2H92A 3GLFE 1YKSA 2ECKA 2BC9A 2GBLA 5FI0B 3RWMB 8OHMA 4GZLA 4HB2A 1GKIA 2W6JD 4LBYA 1VYUA 3CW2A 1KO1A 4X8MA 5A4JA 2W00A 4TSFA 3U3JA 4QGHA 1CJVC 2VHUA 2ZJ8A 3AP3A 1OYYA 1JXMA 1XF9A 4Q9HA 4RSGA 3GLGA 4A15A 2QAGB 1R5NA 3U4QB 4GSYA 3CRVA 4JYCA 2H18A 1F2UA 1UBCA 5JS7A 2IT1A 3GQBA 1XD8A 3K70D 5KDDA 2NO7A 2W2XA 4US0R 2QE7A 1P75A 2Q6TA 1J7KA 3AVOA 3HWSA 4Q4JB 1IXSB 4TL6A 5JHGB 4G5RA 1QHIA 2BHRA 3ZVLA 4JKYA 1VHTA 2NTYC 4B75A 4UNPA 4EQ6A 4Q1AA 1P9WA 2Y8EA 2ZRCA 3SJCA 3SI7A 4D2IA 3U3KA 2FE4A 3NEJA 4M1WA 2KB0A 1E2HA 2GHIA 2OG2A 1U8YA 2ONJA 1U90A 5KSZA 2FZLA 2XZOA 3QY0A 4BZPA 4DEYA 4IOLA 4PHHA 2YC4C 1GTVA 1N0VC 4M8NE 4Q02A 3CB4A 2N46A 3LY5A 1YZLA 3WBKA 3GLIE 2D3WA 2P5SA 3K0EA 3S1AA 4DCSA 3SQWA 2QPAA 2AKYA 2IYWA 2KSQA 2PT5A 1M74A 4DLYA 1UDXA 4FMDF 1RE0A 1YZUA 2PMDA 2FFAA 1G8HA 4DLUA 4XSGA 5IK2A 4TLEA 3GLHE 5JBQA 3AVXA 4DLRA 1E4YA 4O2RA 2IEYA 2VHJA 3LBNA 1KI8A 3KJEA 2AFHE 3HU1A 1NL3A 5ANRB 2V1XA 2OFWA 4P32A 1FFHA 1SULA 1V5WA 4LPKA 3U3MA 1NN1A 1YZTA 1D5CA 2GA8A 2WAYA 2BEKA 1X6VA 1HT2E 3KKQA 3QXSA 3T1VA 2QMUA 4B34A 5F2EA 3IIJA 5LDDC 3VFDA 2FEMA 3RC3A 2Q21A 4QG7A 3H0KA 1OIXA 2ZI3A 4TMXA 3MUFA 1X8KA 3KTAA 4XWAA 2J1LA 2JEOA 1E69A 2VF8A 3ZLJA 1Z0JA 1XP8A 2IXFA 2ONKA 3FGNA 3I62A 3WMFA 1FTNA 2R65A 4EJSC 1NI3A 5CYPA 1NKTA 4LHZA 4XWKA 2R6CA 1IXRC 2ZR7A 1P5ZB 1SVWA 1M6NA 4JVLA 4MKGA 3KTAB 1TUEA 2H16A 1JXOA 2H57A 3WRYC 5JWRA 621PA 2J7PD 1AS3A 3LW8A 1IONA 2IUSA 2ZUBA 1EXMA 1U2RA 2ZSDA 2WKQA 1UPTA 1Z83A 3PEUA 2QNRA 1ZP6A 2JLVA 2YOGA 3KXKA 4M1OA 1UF9A 4I99A 1DO2A 2WOJA 3RRYA 1W47A 4ZCMA 1T0HB 4D82A 2IK8A 4NTZA 4B3DA 4ERNA 3TR5A 3TSWA 4GMDA 1CU1A 3OHMA 2GCOB 4ZV4A 1J90A 4LV5B 2DB3A 2C2HA 2ZRMA 3KL4A 4LI0A 1TQDA 3W6OA 2ZRKA 3FWYA 2NPIA 2WWIA 2BKUA 4KI0A 3GP8A 1KAOA 1WCV1 2YWFA 2BBWA 3UATA 5JRZA 2EWWA 3QF7A 5G53C 3T1TA 4BWYA 4AWXA 3KXIA 3KKPA 3DM5A 5SZIA 4F93B 4ARZA 1XTKA 2ATXA 3KJGA 4BFTA 2XEXA 3ZJYA 3ADDA 4AC9A 3K0FA 4RY2A 5KDLA 4POAA 1OLOA 5GJVC 1XEXB 3T35A 2PJRA 1TQ6A 2Q9CA 4TZ0A 2CLCX 3L43A 4QBGB 1LB1B 2QP9X 3AF2A 3R7WB 3UANA 4Z1MD 3QEJA 2CVHA 1VDZA 2V1UA 1K8RA 1Q21A 5AK0A 1SVSA 2GETA 2ZJYA 1VECA 4RD4A 4BFXA 3H4MA 5FL7D
chains in the Genus database with same CATH superfamily
1RAFA 2HT1A 3WYNA 2ACKA 2A33A 3JWHA 1GEEA 2GZSA 1A5BB 3KEQA 4G4SO 2LRHA 1WCYA 1Q7CA 2HHCA 3IHWA 4B45A 5HZMA 1KNXA 4I66A 4ACBA 4MS1A 5HJ5A 2X13A 3UYLA 2GX6A 3UH1A 3ZD6A 1GWNA 3AR2A 1PFGA 4KIFA 1WA5A 2PJZA 3AF0A 1R8XA 4U7GA 4YROA 3VR6A 4ZJYA 5BW5A 1LD3A 3PC8A 5EWLB 2VBFA 2JPDA 4B3JA 9GPBA 2ZG6A 3CGGA 4DR6B 3INGA 1V8DA 5K2MA 1V95A 2PUFA 3OH8A 3OFND 4G36A 1XXLA 3ZK8A 4JI6B 3HCCA 2FEAA 3REFA 4LBZA 4ZDWA 4OJTA 1L8QA 3HJCA 1FXSA 3EGWA 3PNQA 1T0BA 4JT8A 3UWKA 3H2KA 4NPAA 4CV0A 3BCRA 2DH6A 4QJ5A 2VWPA 1YZHA 1M34E 4KR9A 4B9AA 2WG0A 2SNIE 4D79A 2BMEA 2VT3A 2AC7A 1IIRA 1EXWA 2YQ4A 4XUGB 2IBTA 2O5CA 3OQBA 2B1GA 1TW2A 4U3JB 1C1DB 3H7AA 1JHRA 2QT9A 3GZJA 1CY1A 1NE2A 2QMQA 4M88A 4HNQA 5LLSA 4D8VA 2ANCA 4EHBA 1PVDA 2WT9A 3LPDA 5TGDA 3ROEA 2UZAA 3W77A 2NIPA 2RMKA 1G5HA 1A7AA 1HUQA 3QBTA 3P2MA 3G6WA 3RSFA 4BMVA 2HV8A 2DFKB 2GXSA 4QBKA 3TLZA 2AGVA 3B51X 2CV0A 4IGIA 4CLDA 1Y1LA 2EVWX 1GAWA 1AKRA 3AJ9A 3BE6A 3FJYA 4HMPA 4LQ4A 3A9RA 4B4VA 2QGFA 3N8KA 1L5OA 4C06A 2JFBA 4D4GA 2WB4A 1QCYA 1I32A 3K31A 4EVRA 5MHTA 3E3NA 1OWNA 1VYVA 2QZJA 3JQDA 4L72A 3PB3A 1M2HA 3A6JA 1ICEA 1NF8A 2V7GA 1EK2A 4TV9B 3SHVA 1Y6QA 1KAHA 4ICIA 2L19A 2W6OA 3KQUA 1Z2DA 1ZC3A 5K8UA 3ZJTA 4WAUA 1Z8DA 1PJZA 5EWJA 4F1KA 1BRMA 1HYEA 4X93A 1KORA 1YZFA 1BWRA 2GILA 2H1FA 3TLAA 3RIHA 2ZETA 1XJ0A 3GAAA 1ZOOA 4DIEA 4EG7A 3W5DA 2IHNA 2IH2A 2VC2B 4O2AF 2OTCA 3HU2A 2W6MA 3N2GB 4QGSA 4HS4A 1YBFA 3BH7A 3HB5X 2WWTA 2P9EA 4QAJA 2JLBA 3FYSA 4CQMA 4BVHA 3NAMA 1H8HD 1FPMA 4O2LA 1SNYA 2PV7A 2Y1LA 4BTEA 2DPHA 2J09A 2H11A 2UYCA 1DMRA 4L4ZA 1U7OA 2H31A 1CUUA 1EJ6A 2ZULA 4IIUA 4L2IA 4IDPA 4UBKA 1D4FA 1OD6A 1R0WA 4IHJA 5AK3A 1Q1BA 3U0VA 3V4VB 3KQMA 4NG4A 4ID9A 4IHKA 3ILSA 5CVDA 2CMKA 1T36B 3E5RA 4HGOA 2W70A 4CF4A 3WNZA 2JHPA 3E0XA 4P98A 1CY2A 2EHJA 1RLTA 1GFWA 2HNKA 4GO1A 4J94A 1E5VA 2GT1A 2WVGA 4HGZA 3L0DA 2H2AA 3NORA 1P4HA 2W9XA 4JLNA 1IOWA 2A5DA 1QQBA 4PIVA 3TQQA 1WLYA 3JTMA 2FB9A 3MM4A 3PFCA 2Q4EA 1G21A 1JIJA 1HT0A 3MPOA 4BN5A 4RENA 1G5FA 4I1VA 1JDTA 4PQEA 2OYSA 3T12A 4DBLE 3RRMA 2XA9A 3UB2A 1CIPA 2B5OA 1UPCA 5FP0A 5BP7A 1XLUA 5IDQA 4HSGA 3LBHA 5H4HA 3A2MA 2IU3A 3IA7A 2RGDA 2ZSAA 5F3WB 2VVTA 3AB3A 3S5UA 1OT5A 3MWGA 4EY5A 3RVDA 1SUPA 2BOVA 2OOKA 3GLRA 1W4LA 2G9VA 5L3RA 4I8DA 3VHXB 4R01A 2OXIA 3UB3A 3VSAA 1WZUA 1D0IA 2VBGA 4FDTA 4ND6A 4KAFA 2LWIA 3RYIB 3FSEA 4ZQFA 3AJAA 5AFSA 2VDPB 4CIXA 3HBAA 4TTVA 1AQJA 2F55A 5BNIA 1S8OA 2JIBA 3TG2A 4CXMA 1OXTA 2J5KA 1W44A 1LX7A 5DSXA 4EDHA 4BNYA 3FCEA 2EIXA 4RQUA 2HW8A 1NW4A 2V9CA 4JKIA 2FZKA 4F85A 4M55A 3KB8A 1XD2A 4OV6B 3CZAA 1KYQA 1Y1PA 3NP9A 5HE9A 4XCXA 5J40A 5BXQC 2G1UA 5J5VA 2EEZA 2Q7XA 2YIMA 3N2KB 4KKXB 4HDNA 2EFDB 3I9V6 2AUNA 5CU7A 4FE4A 3AGQA 3PC4A 1CJCA 2VHCA 2YUTA 2W0SA 3I62A 3PRKE 5EE0A 2R2GA 4EEZA 3TLYA 1QF6A 5B7QA 1NMQA 5A62A 2C98A 1JIUA 3FTPA 1WTAA 3R23A 4TS1A 4YR9A 1SURA 4AMUA 2VHTA 1ODFA 5KU7A 5C8DA 1U9IA 4LI3X 1O95A 1A0OA 1ONSA 2IYQA 3FZQA 3L7BA 1I1QB 1ZL2A 1AUOA 2Q1SA 3U3DA 4WK6A 4E5YA 3KLOA 1JDZA 3CIOA 5DYIA 5FOXA 1H0SA 2W6QA 3KT6A 5TEWA 2VPQA 3I1IA 4QUDA 1OLUB 3O8LA 4R8VA 3GJ0A 3NHMA 2O8EB 2QAIA 2Z3ZA 1P7PA 1TTPB 2QTWB 2C99A 1EQAA 4HNVA 3BHIA 4B6RA 1K6JA 5KJCA 4OFWA 5ALZA 2I2WA 3A32A 4L1KA 4KPFC 5FDFA 1QTNA 1NR1A 3OUUA 3RJ5A 3TPCA 3O82A 2VRNA 5BQFA 4LDPA 1IL0A 1MAAA 4RIGA 3ZCPA 3N74A 4BC1A 5DBEX 2Y1XA 2G06A 3W8FA 4JDPA 4EA8A 4RMJA 2FVYA 4H1UA 3SEAA 1A82A 3MTIA 3LG2A 3VTZA 3RYTC 1DCFA 3IAEA 5JECA 3KAJA 1E96A 3FZGA 2TMDA 1IDOA 1Q1NA 2AUTA 3W6ZA 4GXQA 4O6VA 2ZQ5A 4IIJA 1KVRA 3BDAA 4ILEA 3TH5A 3UJ6A 2VHXA 2FWRA 5JCOA 3VAZA 4MXDA 5CXUA 3RS8A 3ZZMA 3Q3CA 3W5JA 1JYSA 1JZQA 5LB2A 3DTVA 3MINA 1RKBA 2D2IA 4H7HA 2R4TA 4E5PA 3IDQA 2IBMA 3KUKA 3OO1A 1LJUA 2P5UA 3G1UA 3UJPA 3ZX4A 2GK7A 4AO6A 4QE3A 1OCEA 1SBYA 1FQKA 4I4TA 4B33A 4DC9A 5IJWA 4DQLA 1TZMA 2NXWA 3L7DA 4WZAA 5A7FA 1T0UA 2IPAB 3ZV5A 4C2UA 3IAM1 2X76A 3I32A 3I4FA 3JPWA 2P65A 3WJ1A 3T3GA 3PVZA 3R7WA 2K87A 4B17A 3N6XA 3DONA 2JFWA 2I7VA 1NBOA 3QY9A 5JCXA 2BGIA 1ICIA 1HMYA 2PFGA 4MVWA 3T6KA 1EX9A 3MWFA 3OQVA 2OORA 2ZT5A 1O6GA 4BLTA 4DMRA 3LX4A 5K6AC 3H11B 4KTVE 3EQ9A 4L3WA 1TRHA 2O0KA 2XSZD 5EPEA 4B4OA 2WW8A 4Q37A 3MMNA 1A5ZA 1V3VA 2UZ3A 1T3LA 3BRQA 5EHQA 1ISSA 1DAGA 3OZTA 1QH0A 4NOLA 221PA 4AP6A 3CMMA 5GMOA 4M0LA 3NS7A 4D9KA 4O1IA 1GPYA 4MV3A 5JXHA 1GGHA 4FUTA 4WXYB 4AKTA 4EKYA 1W73A 2RHLA 2QX7A 3FYTA 3HBFA 1YB6A 4OHUA 2FG6C 3TNDA 3ZWCA 2FFJA 5HNKA 4C3ZA 4L9RA 1U1IA 2ROQA 1E1DA 5KNCD 3IQHX 1L4BA 1URPA 4J1NA 2V7QD 1Y7PA 4JMPA 5C51B 1WB4A 1XTPA 1DIHA 1PV2A 2C7GA 4ZZ0A 5B1YA 4RVUA 1B74A 3ONFA 4NJMA 3OPXA 1ZCBA 4BRSA 4OU4A 2PL1A 1ZK1A 3WI7A 4CODB 1TJ5A 1VJGA 4OATA 3UNXA 4M1ZA 5KQGA 5LYJA 1VZ3A 4FT4A 3KD2A 3NHJA 3ZBTA 5IMSA 3TL6A 1EVEA 4IAOA 1UMDB 2IRWA 3CYFA 3NWOA 3K0SA 3AG5A 2OHHA 4RA6B 5ESWA 4F2DA 2R8XA 3BJIC 4JY7A 4KH0A 4ARCA 1ZD9A 2BFFB 4EUSA 2XY4A 3IESA 4F4HA 5EXEA 2WTUA 2O1WA 3U49A 1XYGA 1M83A 1RYNA 2EATA 3Q7SA 3R8XA 3W3AD 4B8ZA 4DA8A 4KFCA 3STTA 1RXIA 4GXRA 4OVKA 4NY1A 4O5AA 2Q45A 3K96A 1Q7RA 2JGNA 5CCDA 4BQIA 4W5WA 4FM9A 3CG4A 1MV8A 5LXTF 4CQMB 3QMPA 4DQDA 1JV2B 1XA4A 1XV5A 4IICA 2IYRA 4RTPA 2QE7D 5CM2Z 2FW6A 2MSEB 1J9EA 3QTTA 3WK4A 3PV0A 5C8XA 5IX8A 4KX3A 3BGIA 4WZAE 2JBAB 3NCHA 1XU7A 1DWOA 5GADl 5BW8A 2NSLA 2ZDHA 3JARB 4Q3OA 1YRHA 3JATB 1JQEA 3E4DA 3ITDA 4IDNA 3T3EA 5L95A 1AV6A 1NJ5A 4UBIA 3SYKA 4K87A 2VH5R 2NM0A 2XD9A 4IZHA 4UEJA 1RRCA 3R6GA 2BCEA 2MYNA 2G9ZA 3BORA 4TYMA 5I8PA 5DXFA 1K7FB 3SOZA 3LJKA 2HJGA 4K9PA 3M8KA 3KAKA 2PL9A 5ALPA 3OJLA 5CEFA 1QPZA 4ZOCA 1QONA 1R88A 2C5SA 2J07A 4LZLA 4WN9B 3GLGE 2DU8A 5K9ZA 5F2KA 3I01A 5M2QA 2HYDA 4GC5A 2BGUA 4P3YA 3L0ZA 2OQ2A 2QTVA 2RARA 3UCEA 4JT2A 1VRWA 5L3QA 1G17A 3CKMA 3FI9A 4OBXA 4XYGA 1VBFA 2IDMA 3ID6C 3LDGA 5IVIA 1E9EA 2Z1DA 1M2OB 2C7QA 4A3SA 5DOZA 1L6RA 4JC5A 1P0MA 2C9MA 3CSUA 3FFXA 3MFYA 3OZGA 1QFXA 4G37A 2IDZA 2BM1A 5G4KA 3U7GA 4ESEA 3HKCA 1LV7A 1M54A 2ALJA 1RAAA 4RTSA 2FZ4A 2OD7A 1SUSA 3CUWA 4PCLA 1US8B 4MA0A 4LV8B 3MWDB 1NUHA 4KI7A 4JLJA 4NPCA 4RK5A 2H63A 3A11A 4QHSA 4DIFA 3GBPA 1MORA 3TAHA 3H5TA 4WESA 4HF7A 3TOVA 1LSUA 3HP1A 1WY7A 3N70A 3C3CA 5DISB 3H8SA 2DH5A 3VNBA 1IVSA 3JQFA 1SKYB 3VPHA 4KP7A 1IHUA 5T5QA 2DFVA 1HNXB 3FUXA 1WQ4A 4D9JA 5AW6A 2EFEB 2VHYA 2WOOA 5KKAA 4AYXA 3Q88A 1GFSA 2OV6A 4I50B 4P84A 5K0CA 1W9MA 4U2BA 4AS1A 3KNZA 3MJTA 1NYRA 1Z6AA 3MSXA 3SFTA 1P0CA 1D6SA 1PL8A 1MO5A 3ZI4A 3RKUA 5CDHA 5C5IA 9ATCA 4M9ZA 4MZDA 4G9EA 5DX0A 3QKSB 4BUCA 4D8WA 3X1KA 2WA2A 4DQ0A 5K6TA 3I4LA 4DVGA 4JWTA 4EZIA 5DM4A 3WGYA 1MG0A 2BRUC 5C31A 2X0FA 3VI4B 5F4BA 2BFWA 4FDUA 1QGOA 2QUIA 4ZHQA 2ONZA 3IO5A 2RAVA 4B31A 2JFOA 4YYEA 5HIJA 1NF2A 2KLHA 5BN4B 2I03A 4DR7B 1JJFA 1IFXA 5K2OA 2A92A 5U4QA 2E5LB 3F7MA 4W7HA 3ZGOA 1WU7A 1YBVA 2FSPA 3DMPA 5B3KA 1TEZA 1Z15A 2JGDA 3SDBA 4C3UA 1XCBA 2PQ6A 2GPSA 1YJAA 2PYZA 4K0RA 2HXGA 2M9MA 2RHJA 2D5LA 1N9KA 4R3NA 1U65A 2PUGA 1AO0A 1BGXT 4H4DA 1FXWF 2LVBA 3KFVA 4LVOA 3KXPA 4HY3A 1KQFA 4G5HA 3DZHA 1X42A 4N03A 5LZ5A 4HNUA 5J3JA 3ESCA 2K2WA 3TL2A 1Z6XA 3DCYA 3FDJA 3OCZA 3WYCA 4ETWA 5BV7A 5DM70 4YGYA 1XT6A 4FFSA 3BTOA 3S7ZA 1ENZA 1DE0A 5HKBA 4INZA 2VP4A 3V1UA 1D4ZA 4K2HA 1V0JA 4LYFA 5ADWA 1NIJA 4LF4B 3OKAA 1JEQB 1M7HA 3SBDA 3FRJA 1QIMA 1GUAA 1V3UA 2PQ0A 2WYWA 4J9VA 4YRGA 1MT0A 3MMZA 2AKAB 4PV7A 2REXB 3D3EA 4KE6A 1OXUA 4CM4B 1TM1E 1KDOA 1T9HA 1QFSA 2FR8C 1XU9A 4JLVA 1Y9JA 5CDFE 1BXRB 1NUAA 2FJ0A 5A5GA 3G8DA 1KGSA 4UE3S 4R8RA 1FLDA 1P1HA 2J4FA 1JNYA 3NNSA 3ONVA 4BE4A 2ZJ0A 2WIFA 4MI1A 4HVAA 4M83A 1V16A 2Q2WA 3CSSA 3EA5A 7MHTA 1HEUA 3QKRB 3GLHB 4YBZA 1H2WA 4BLPA 5JSFA 1DAPA 4F5YA 4D9BA 1VJDA 1JQ5A 2CC2A 3N5CA 3R9XB 3PFWO 1PAUA 5C7LO 1ZCFA 2GNAA 3CEHA 1E4OA 4YXWD 1R6XA 4YPFA 2O5EA 1EK0A 3C3XA 1DT5A 1C4KA 2XIQA 1RXSA 2OLKA 2PDAA 3GZTB 3RSQA 4YV0A 2IYLD 4G0MA 3BE4A 5JV5A 3QI7A 4UVDA 2PUTA 4WLFA 3WC4A 4PFKA 5IVPA 1L7EA 1DQZA 3CLKA 4RA9A 1PFVA 4NNJA 4WOBA 3TINA 1XZQA 5I7EA 3WL8A 1XQWA 1W75A 1HFKA 2OLEA 1DOAA 2ZBPA 3PNLA 5TMPA 2CV2A 2MMCA 2A78A 3CUVA 4KN8A 3DZKA 2G0AA 4ND8A 2B7CA 1E8NA 3UTDA 1XRPA 1MRZA 3PX2A 4E08A 3IP6A 2H2DA 1OX4B 3DULA 3PSHA 1NI4B 5HRAA 3LBFA 4M0KA 4O1HA 1WG8A 1ADJA 2O0LA 1WVIA 1HF3A 3UJ3X 1H0HA 5DM2A 4P08A 2FUNB 2P2YA 1FDOA 3COVA 3Q0TA 1XMQB 3HLKA 1DIGA 5AJUA 4D44A 4H3HB 4Q1EA 1NY5A 2BVNA 1W30A 4JASB 3IERA 2ERCA 1I0ZA 3RTAA 2ZAYA 3ADOA 3SSOA 3TOZA 5LJIA 1XC7A 4BFYA 3NC0C 1EUYA 1HORA 2ZYSA 4CMCA 5MGBA 4OXIA 3R5TA 4RACA 3CVYA 4C4SA 5BWLA 4AJ1A 1BE1A 5C2JB 1TZKA 4FINA 5IXJA 5I3CA 3C1UA 3NHAA 1EE2A 3A05A 4KBFA 2FP4A 3PF9A 2VSNA 5GGYA 3N7TA 4M3NA 1GZ4A 3NIWA 1ADFA 4Q9DA 4K6CA 1YCGA 5ALJA 2IODA 2FSVA 3F71A 3FX2A 5M29A 1EFLA 2BTEA 4W6QA 3FCYA 4IGAA 4E94A 3P2KA 4BMDA 4D57A 5LIRA 5KMGA 3NYIA 4QT4A 4KQ6A 4RMGA 3KE8A 2V3CC 1H4QA 3LFUA 3MT8A 1UEXC 3KJFA 3L06A 3KSRA 4WBNA 4X62B 3LFTA 2QVLA 1OV6A 1Y89A 4HXGA 4WXRA 1I3MA 2GEUA 2O57A 3JYOA 4CT5A 2HI0A 3A9UA 1F2UB 3V33A 5A0VA 3AOGA 2OKCA 1ZM4A 2WP0A 2HHJA 2XRMA 2XW6A 2EJCA 5EEHA 2O8DB 2GM9A 4F5WA 4E30A 5AKZA 1A95A 1R7RA 3N8NA 2MMGA 3GDFA 3RJMA 5IBQA 5DLEA 4XLZA 1V7QA 1J70A 4Q01A 2NZ2A 1KBZA 2QXYA 4K9DA 4NBTA 2BM0A 2E4YA 4YO8A 3PUZA 5HYVA 2CLOB 3A3OA 3KR0A 1E0JA 3AESB 3EVGA 2JJ2A 2QTFA 1GEGA 5A7HA 3S27A 3V55A 1RHRA 4JIMA 2QRVA 2MSLA 3FCAA 4EFMA 4RZXA 4MR8A 4YRQA 2PRJA 4EELA 3N76A 5JCPA 5IT0A 3GLIB 1YKGA 3BVPA 2FDCA 2F59A 2R4UA 2PKXA 2DSNA 2F1IA 3LXRA 1R10A 3IR7A 2PFKA 4RAQA 3K0CC 3C16C 3DV2A 4XJVA 1UP6A 4ESVA 1GT6A 3IAS6 2GPNA 3AMVA 4GSLA 3A1UA 3HKEB 5DNCA 1NVFA 3U3KA 5IYZA 2YRXA 4R2KA 5HTKA 2PO5A 3AEYA 5CA0B 1PQWA 4KQEA 3ROXA 1L6IA 3JX9A 3CVUA 2FEOA 2IEIA 4HWOA 1N2CE 1JWLA 1YR8A 1WHSB 4MCHA 1IHPA 3DOUA 3H7IA 1NVUQ 1Z5WA 1QV6A 2V7VA 2YWEA 3AVPA 3PXDA 4RHYA 3ZU3A 4PZEA 3U7QB 4B5LA 4F4UA 3A3NA 3QLUC 4J2OA 3BWCA 2WVJA 4U0KA 4TWZA 5K09A 3ETHA 1OWMA 4ZPJA 4V39A 5E7JA 4KE7A 1W0JD 4MQFB 2X3YA 4NH4A 1W85A 1MVNA 4HNAA 4YUXA 2Z5FA 1YA8A 1P73A 4R31A 3KC2A 5BWMA 5M5BA 5JS8A 4AK9A 2J45A 3HGMA 1Y3BE 3L1VA 1BD3A 1J2TA 1YRAA 1T1GA 1W46A 2I6GA 1Z5PA 1CY7A 2W2NA 2X58A 1SKUA 4NQZA 4ALLA 4EPTA 5I9IA 3O1JC 2KQUA 2OLJA 3ONNA 3OZVA 1X1SA 4DJEC 2WZCA 3HB9A 4JJEA 2FRDA 3EXIB 4LOJA 3WLFA 2AKEA 4YCLA 1Z6TA 3IDSA 1WZIA 3OZCA 1QZTA 2I6TA 3HYTA 3A9WA 2NQTA 3KVOA 1EQUA 4J2HA 1M73E 1U8AA 4N1AA 5EHGA 3WP0A 1ZSNA 2X4IA 2ZM5A 4RHTA 2QN9A 4NXNB 4CQLB 3QLVA 3MWYW 1R37A 3OICA 5GONB 4UEWA 2R6DA 4EWLA 1G8MA 1WU8A 4FIDA 3M6WA 5JAUA 4G07A 1D2EA 4XI9A 4NNPA 2O7VA 2R9VA 4YR7A 5FWNA 3OSZA 3CV3A 4PZUA 4JEUA 4XARA 4XGNA 4ALKA 4ZI7A 5IWAB 3HHEA 3SR4A 3TXYA 2P3LA 3HABA 1UJ2A 3I04M 3NYRA 3TJZA 3OX4A 2Q3LA 1U8CB 3EXIA 3BA6A 3AERB 1TFUA 3JR3A 5GM2A 2GF2A 2PPLA 4MGKR 4L73A 3HUUA 4A1OA 2FK7A 2LUOA 2YV5A 5ENVA 1KSGA 3DZCA 3WIUA 4C43A 3T38A 3EXG2 1VG1A 4Q24A 3GIDA 1N32B 1GYPA 3DE7X 1ORDA 1II8B 5DHSA 4I5GA 1DPGA 3LY9A 2GMWA 2CXXA 3PDIB 5CFPA 3EN0A 1NVTA 4MQFA 4L8LA 2ZWPA 2TSYB 3L82B 2GK6A 3M2PA 4FGLA 3K30A 3MXTA 2O6LA 3MT0A 4GX2A 1B16A 4IIYA 4TQUS 3W2TA 5KYWB 4GP6A 3M6XA 1MNAA 2P4HX 4BV8A 4WZBA 4XRGA 2II6A 3ZD8A 4C7XA 5DN6D 1DEHA 3CBGA 5TNXA 2AJBA 3BXPA 2QBYB 2IXEA 2D00A 5ICGA 2O2CA 3NTUA 3VR0A 4G41A 3KKMA 4F72A 3CUKA 3Q8LA 4UASA 3HKEA 2PQMA 4YLGA 2CVFA 5G3YA 1C9JA 1NT4A 1T24A 5I7FA 4N8DA 5H8WA 3EOZA 4ZYVA 3FPKA 1G6KA 2P7HA 2PGOA 1HC7A 1EFVA 5KVCA 4GX5A 4JX9A 3R7BA 1M75A 3DT9A 4QWWA 2VYNA 1EGVB 4MVJF 4A1FA 1MABB 2DPMA 2ZIEA 2XWBF 2QRVB 4Q05A 4QYMA 3R5XA 2QV7A 1S6YA 4QYTA 1JDVA 4HLDA 1BKYA 1B76A 4BLWA 2PIDA 3QLJA 4PGFA 4QOGA 4PN3A 1WMSA 3L8MA 2DT8A 1RLMA 2RBEA 5DSTA 3QU4A 3K92A 4G5YA 3FDZB 1YJ8A 3MBIA 4QVGA 2EOAA 1VE3A 1XL1A 2E5WA 3BN3A 5EINA 2O8DA 1H2ZA 3WMWA 4RIHA 4LGMA 1JSZA 1OYVA 1V4BA 2O23A 3H83A 3N8IA 4DLXA 5DLQC 1XZDA 1BE0A 1R0XA 3JS5A 1UZMA 1RI4A 3ZGZA 3T15A 2QI9C 4MI3A 4D1YA 1HH4A 2UKDA 3AEUA 4AZSA 2HCBA 3PQ3A 2Q3DA 2WHQA 3A27A 4KRGA 3WXMA 4WBNB 4ZYXA 3U6KA 4CQNA 1A5AB 1OI4A 2J9ZB 1VHWA 5AXAA 2ENWA 2IE0A 4O63O 4B81A 5KMGB 2BI4A 3C87A 3BGDA 1WXEA 2IOHA 1W4AA 2FFRA 2G07A 4RVSA 3NPMA 4CDGA 1VE6A 4HAYA 3P4YA 1D5WA 4MYTA 1KEEA 3DLTA 2ZUVA 4B4DA 3FUWA 1YF3A 1YRYE 2DQKA 2XNDA 5GVSA 1Z4PX 3GL9A 1XXHB 4IDEA 2QTRA 2CDNA 3H2ZA 3M89A 3RVMA 3DVQX 1ZOSA 2ZRHA 1Z3CA 1VIDA 2NQ8A 1R6TA 4BP8A 1AB6A 3NWPA 1LBQA 3L0PA 1T5OA 3TZEA 2GTHA 4ZAVA 3VR2D 1EDEA 2OO7A 4QEZA 3A2KA 1N0WA 4DS3A 4B3FX 1IY9A 1D03A 3D2LA 2JBHA 3B1YA 2IF2A 1GA4A 2HJSA 2IYEA 3BSSA 1D0SA 3D5EA 1BX0A 1KNQA 3HBJA 2DM6A 2X5KO 3AFIA 3KELA 1IM5A 4M21A 2XNSA 4RIEA 5DK6A 2FXIA 5F64A 1WDKA 1E2LA 1NY6A 1CJKC 5LQCA 2CT8A 1WY5A 4N47A 4YDQA 1GM5A 4HAVA 3IT3A 3L4BA 2M32A 1Q7TA 3BIJA 1Y4UA 5TQ0A 2B9VA 2VAWA 3UA3A 1MKYA 2ONCA 3CUUA 2H7YA 3N3BC 2O59A 2J59A 1AZWA 5FUBA 2ZTLA 2W2OA 3CLUD 3KTDA 4J0KA 1O1YA 3DDNA 3PXAA 5IT4A 1FFEA 1KPHA 1O57A 2AWNA 2NW6A 3NHPA 1ZS9A 4LY0A 2NMVA 2I7DA 1SIBE 3L92A 1E1CA 4YH1A 2ASVA 2VYFA 2QTAA 3RVPA 3QUCA 2Z2YA 2FJUA 2WHRA 4RPCA 1QHNA 1VSUA 3GLFA 2ZWIA 4UEKA 5AI0A 3RHTA 721PA 3QSYA 1NASA 5KTNA 4QECA 1WB9A 2AZXA 3CPEA 4NBWA 3KJNA 5FI1B 3VI3B 7REQB 2YQ5A 3WA7A 4J0EA 4DADA 2IYSA 4YT4A 4LF5B 2I2CA 2AMJA 3H3JA 5EMJA 3TSCA 1N2CA 3PD0A 2HA2A 2OXEA 2XKJE 1MX1A 3OFSA 1RQGA 2I7TA 4IDDA 3IPRA 3F98A 3KYBA 2X0JA 3MCAA 3MBKA 5FLKA 5DYTA 4Q7LA 4LXYA 4X00A 2W2KA 5TS3A 1YO6A 3C7KA 4OXRA 1X92A 5EMNA 5CCEA 4NMLA 2FP3A 4ZOQI 1E20A 4FN5A 2AXPA 2J87A 3M6FA 1ORTA 1YQ9A 2CXRA 3IAHA 1TMYA 1XPUA 1F2TB 4ND2A 4NIMA 3K8YA 1YE5A 3R77A 4B44A 4CM9A 3ROKA 4MS3B 1GUFA 2JB9A 3QPDA 3VU0A 5P21A 2I4NA 3H9BA 1FS5A 1J97A 2H1CA 4L08A 3WGZA 4W8GA 1ZI8A 4JT4A 4E0BA 3W2GA 4C14A 1P0PA 3K09C 3RUEA 3ZXYA 2R8EA 3EIEA 3WKBA 1XZAA 2IYXA 2JLWA 4GR4A 2HIMA 2QX4A 4YN3A 2UV8A 3G5TA 3WOVA 2YNMC 5JE8A 4MMXB 3IQWA 3PKJA 3GOQA 3QMVA 5J2UF 1H42A 1YS7A 3P27A 4LJ5A 1GP2A 3RBAA 2HA6A 1RADA 2F3QA 1R4NB 2GLTA 3DE0X 3L2OB 3TJRA 4EG6A 2NO1A 1KZ7B 1Q0PA 2EGHA 4U39A 1AS0A 4Q6BA 3AI1A 4TMVA 3WZMA 4AXBA 4D42A 3QNWA 3B5JA 2BI7A 4ZVPA 4OQDA 1Y1QA 1VJ5A 4E2YA 3D1LA 3V1NA 4MQEA 3I6ZA 3PE6A 3QKSA 4DUGD 4J49A 4EHKA 4RKWA 4P0QB 4Y9SA 3K2QA 3P0JA 1XTJA 3NHWA 3A4IA 3DZ8A 1QU2A 5JJKA 3UMCA 5DBHX 4I6JA 1QP0A 3ZH2A 4YMTA 2YV4A 4WLNA 4YUWA 3HM9A 2XE4A 1YUBA 1Z17A 1WD7A 2PSFA 2QSUA 1UXOA 4UD6A 3OCJA 5JOQA 3I5XA 2Q3EA 3WQQA 1WZ2A 4PYLA 3A2NA 2Z8ZA 3GPIA 1OXBB 2HA0A 2QPTA 3OU6A 1SRQA 2P3SA 4EMBA 3VSEA 2WU3A 3BIFA 1M0WA 1OLSB 2C42A 1ONBA 3H1AA 1VZ2A 1Z5NA 5FB3A 3FMFA 1EFRD 1XCOA 1KIFA 1JS1X 4LXIA 4UHJA 2P1RA 2R8ZA 2NAFA 2CLSA 1HKUA 5TE9A 3MGKA 3OHSX 4WQMA 3F3KA 5D2CA 5CA1B 1JI3A 1QHHA 2J0VA 2R60A 3ITNA 2PKQO 1MIHA 4EZBA 2C3OA 4DNXA 4RZ3A 4HDRA 2FSVC 1JSRA 3ET5A 1MAHA 1SJ9A 1UQUA 4IP0A 1MN6A 2W6JA 2P35A 1H8HA 3W5SA 1M2VB 1ISFA 3K9WA 3HFSA 3K1AB 3NTVA 3N2LA 4L5BA 2VNJA 1WD5A 3JPYA 3NFYA 4Q3LA 3LQ2A 2C1ZA 3FKSA 3NATA 2NUPA 5K6RA 1FFCA 2W48A 4HAOA 1SHLA 2C4KA 5HPYB 1G3QA 1G38A 1QJCA 1XMVA 2AJ8A 2WDZA 3E61A 3IOMA 4QOHA 3I9V1 4XASA 5EIOA 4IVRA 2XNCA 5CA1A 2EQBA 3AF3A 4HNRA 4P4LA 3D7MA 3PQ7A 4KR2A 1OLSA 2P8JA 2VF5X 4F8YA 2DOKA 2QGZA 2XOEA 3PR2B 3WL5A 1WTCA 4DQXA 3P2JA 2FQYA 3G49A 1IJKA 1Y8RB 2YNMD 4KWTA 1FPQA 2GEFA 1X15A 1A8PA 2RHBA 3IHKA 3PRJA 2G9QA 4NI5A 5IAKA 2IP2A 5TARA 4ZT3A 6PFKA 2NAPA 3QV1A 4B7ZA 4PNEA 3ORQA 3RV3A 4CKBA 2R48A 3H5LA 1T9CA 3I2JA 4ETNA 1VMAA 3WNVA 1O6BA 5HF5A 5JVDB 4C0KA 1LLCA 1RPZA 2Y67A 1HDIA 5EIBC 3MTQA 1M0SA 2RAFA 3MJHA 4S04A 2JATA 1X87A 1E2KA 1RYZA 1L5RA 3SIWA 2PQ2A 2Y0DA 3CS3A 4UU7A 4D81A 3CX3A 5KTRA 4DHWA 1C4WA 1G2OA 3S2YA 1GTRA 1ARZA 1XLTA 4HC4A 5LPNA 4HQRA 1RBQA 3ENQA 4IIGA 3UB4A 3WRYA 5CA0F 2HN9A 3HDQA 3H1EA 3KXLA 1VBKA 5DYWA 3AR9A 1SU4A 1RP7A 5J59A 2GAOA 1Y63A 2JKZA 3A6HA 3LK7A 1E66A 1JBEA 2FZWA 2RGBA 2DWPA 1ZUNB 2A0KA 2VYND 2IF0A 2ZJZA 3GVXA 4X1IA 4O4HA 3VH3A 3GK3A 2TMYA 1OPRA 4KN9S 2AXQA 1I5OA 4E5MA 3HU3A 3TUZC 1VMKA 1XAIA 4XKJA 1D2AA 1D1SA 1ZY2A 1GL9B 2YJ5A 3AUSA 3ETLA 5EQDA 3TW6A 3MB8A 4ER6A 3HLYA 1XSEA 4LNHA 4RA6A 1QFJA 1ZMXA 2PR7A 5DTRA 2ECFA 2E37A 3W34A 1I94B 4EVSA 3LF1A 1MW9X 5J4VA 5LYJB 3ILHA 2GPYA 4JXZA 5HA5A 1VE9A 1MNQA 1PR3A 4HFRA 3MLBA 2MR6A 1NN3A 3EDMA 3BB1A 3P9QA 2WWYA 2O2GA 3TR0A 3HVJA 3UUWA 3IVRA 3K05A 1F2TA 3K9BA 5JALA 4PCVA 5CBKA 1LBSA 5C1DA 1Y5LA 5EHIA 2ZTMA 1ADGA 1Q3HA 3GMTA 4D02A 1S4QA 2ZXUA 4B3GA 2CUNA 1QJ4A 2VZEA 3ZW9A 3CBQA 4KSYA 5FOUA 1OXMA 5GONF 1UIRA 4YACA 4AX8A 3K6SA 4Y6QA 2HLNA 1T8RA 1KPIA 2ZJAA 3DD5A 1QIKA 3R20A 4IMIB 3CMCO 5JCJA 5C7OO 1MEJA 1RPJA 3LUDA 5A0TA 4UM7A 4OFZA 2JVIA 2XNDD 1V8OA 1DG1G 2ZT7A 2EP7A 4YONB 4ZQHA 3ZCRA 1HBJA 1NWCA 1YR9A 1JR6A 1FCJA 1UBKS 4S3MA 1LLDA 4EHIA 3OZAA 5JATA 4OMDA 3KKNA 3G2JA 1USIA 3ADBA 2OUIA 1QPGA 3DNMA 4PGAA 1XR3A 2CLHB 3F1KA 1T1RA 2HXSA 4H1HA 4XCQA 3M1LA 4B3TB 1HI9A 2P77A 4AJEA 1NATA 1T0IA 1Z6ZA 2FN9A 4P3NA 4MB0A 2H48A 1JVSA 4CU2A 3T95A 1OYOA 4PLGA 4U6SA 4KDFA 4X1KB 2P2LA 3LGXA 5K51A 1BMFA 4YMHA 1S96A 2OILA 3AI3A 4L22A 2C4UA 3BM5A 4UW9A 1L7VC 1Z5ZA 2PO7A 3EXG1 3ETEA 4WNYA 1DS6A 1K68A 5JW6A 2XTZA 4RDCA 4CUKA 1UMBB 1YIOA 1J20A 3WKCA 3L93A 4IIJB 2OENG 1GZSA 3DTVD 3AUJB 5CX4A 5IJ0A 4A9AA 3A4YA 1XZCA 3VZQA 2PFSA 2XJ9A 2VIIA 3HNOA 3NM6B 2PN1A 4GBJA 4JQSA 4OL9A 3FXAA 5KS2A 5LQKA 3FOZA 2WM2A 1RJDA 1RM0A 1P2VA 1UC8A 2H4ZA 2X7XA 5AVUA 5BUSA 5KYTA 3RC8A 1E2IA 1ZITA 1UDCA 4J16A 4PTYA 5CTAA 3WJ7A 1DVRA 1U98A 2VAXA 5AHKA 1CFJA 2FZVA 1HV8A 2F67A 1KA9H 1Y42X 1I9GA 2OAEA 2FI1A 3LT1A 4LHVA 2HBRA 3U48A 3I2IA 5CLFA 5JNWA 1JR3D 2BONA 2OQRA 4RWEA 2KI5A 3UXEA 1XMSA 2WSIA 1LBTA 1UMKA 2AN1A 3OBIA 3VBEA 1N5DA 1O94A 1KS9A 2ZFUA 1HTWA 3QXHA 4IVQA 4ZCLA 5GJCA 3WGQA 1WBJB 3R5SA 2JHCA 4U7HA 3EUEA 1JHQA 3UKOA 1ZJ5A 1EHIA 4YP6A 4CKZA 2DWUA 3UMYA 1MLDA 3EIQA 1LWOA 4GEGA 3U44A 4XRRA 1PJSA 4R7TA 1CVIA 1VLVA 4V24A 2O8EA 4KV9A 1RCFA 2Q2QA 3MAGA 2CHUA 4LZAA 3M6IA 4UULA 3S2SA 3KPVA 4H0FA 1SCUB 1RTTA 1AHIA 2RHGB 3I53A 1QIHA 3AP1A 1WF6A 1IEWA 3DH0A 2CE7A 3W5VA 1LPMA 2N42A 4HH0A 3F67A 5EP4A 1A72A 1GPDG 4Q12A 3TIIA 1THZA 4KQMA 4WIAA 5IH3A 5AOAA 4DG8A 2I3GA 1U7HA 3HB4X 3PQ4A 2ARKA 1YI8A 5JZVA 1V5IA 2WWGA 1B2LA 2XCUA 4DXHA 1Z6GA 1V41E 5AI4A 4JC0A 4ZI2A 4AECA 5CB4A 4LHXA 2P75A 3EF3A 2XWPA 3BRCA 3KBOA 4G1CA 1A1SA 1PYGA 3TTSA 4E5VA