2CLCX

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gtp (2)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
molecule tags Nucleotide-binding protein
source organism Homo sapiens
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2clcX00
4Q4LA 3AKYA 4QC2A 3K0CC 5JS7A 4GL2A 4BASA 2C9YA 4D4KA 2GNOA 4Q1DA 4V0ME 1CJTC 2NPIA 4IOJA 1YVDA 2RGBA 3BERA 3PFIA 4V0NA 4AI6A 2QSYA 1Z07A 3KTAA 1NVXQ 3MLEA 2OBNA 1WDTA 3SI7A 3TSWA 2WWWA 3EPKA 1KNQA 3U3OA 1SVOA 4EIWA 3CWQA 1SVKA 3LXXA 2Q0HA 4OHVA 2QBYA 3QG5A 4MDFA 3ZS9A 2HEIA 1KHTA 1W1WA 4URVR 5DI9A 5E95A 4NCIA 2V7QA 4OK5A 2NO0A 1G1MA 2QGNA 2QPTA 1R8QA 1UDWA 2AFIE 2NZ8A 2QA5A 3K70D 3P26A 1OIVA 5DE3A 4DB4A 1E2HA 1ZIOA 3B5JA 5JWRA 3A1VA 1S96A 4D6PA 4RKEA 1K6MA 4TQAA 3CF0A 1AS0A 1FNNA 3WYAA 5JWHA 3QEOA 1DG3A 1JI0A 2EFEB 2FMXA 2GJKA 1VDZA 2XAUA 2IA5A 4KO8A 1GRQA 2QNRA 1DADA 1OSNA 1Z6XA 2HUPA 5F2EA 4X8HA 2J7PA 1GFIA 1Q20A 2HCJB 4MRPA 3LX8A 2G3YA 3RS2A 1T3HA 1KSJA 3L2OB 5GJCA 1K5DA 5F98A 2WBLC 4LZZA 2QT1A 5CJ2A 1SKYE 4TMTA 1AK2A 4A82A 3MGCA 1G7TA 3RRZA 4P4SA 2B7CA 1XJQA 3DDCA 2JJ8A 4P0TA 5HCIA 5TDHA 2ZREA 1YZTA 3LX5A 2WPDA 4R98A 5EE5B 1TF2A 4H9GA 4O2RA 1NSTA 4WBSA 2ZJAA 2HT1A 3SE0A 3C5HA 1MO3A 3HR8A 1F2UA 2LKCA 2NOAA 2F3TA 2CE7A 1DAHA 1FMJA 2J0UA 3NBZC 2MSCB 3U7GA 2RAPA 5ANRB 1E98A 2J46A 2HLDA 1VTKA 2PEYA 2ZYUX 1W4RA 4BFWA 2J59A 4FCTA 1SXJB 4PX9A 1GL6A 1VG1A 4LHWA 1CJVC 3OF5A 2FN4A 2VP6A 4ESHA 1M34E 4OI0A 2VEDA 2VP5A 721PA 4FINA 3GLIA 1VCOA 2O8FB 4OQFA 4QG7A 1DAFA 4BLTA 4JS0A 5B64A 1BKDR 2P0EA 2X8AA 3TQCA 1NP6A 3H4MA 3TKLA 1X3SA 1I4TD 4QGHA 1A7JA 2BHRA 3KJIA 1KI4A 3OEED 2NO9A 1ZM4A 3NG1A 1E96A 1E1RA 1ZD8A 3GQBA 1XTRA 4EJSB 3EXAA 4GMXA 3LBNA 2CL7X 2QTHA 3MSXA 1IM2A 4FN5A 2NO6A 4QBIA 1JJ7A 3A4NA 3VMFA 1N2CE 1FQJA 2YC2C 3EWSA 2QU8A 4ESVA 5ELXA 3GJXC 3CUEF 3MWJA 1GRNA 4WZBE 3NKVA 4Q7KA 2P6UA 3H84A 4S35A 4X8LA 4A1FA 2OHFA 1VG9B 2HCBA 3QE0A 1CR2A 4JYBA 2R6AA 4A2PA 2F3RA 4YMVA 3HU1A 4G5OA 3B9PA 4NDZA 2OO7A 4EPYA 3BAFA 3CF6R 1VMAA 1W48A 2OCYC 2FSFA 1W0KD 3DOEA 1Z28A 2D4HA 1GVNB 3FWYA 1VHTA 3T1OA 1A82A 3U6BA 1FQKA 2PT5A 3B1YA 3L8ZA 1R0ZA 2C77A 1XZPA 4URWR 4AWXA 4A15A 3VNVA 2ZRKA 2FSHA 3CONA 1ZU4A 3IIJA 4H1UA 3GLGE 3U6KA 2C2HA 2PZFA 4BLOA 3RLFA 3P32A 2ZS9A 1MABB 5EZ5A 1W0JA 2XOKA 4GOXA 3EPHA 1ZUNB 1GZSA 4Q7LA 1NLYA 2ZSDA 4G5GA 1Q44A 4QM6A 2BOVA 2V4ZA 4FI3C 1HH4A 1COWA 1R2QA 1S3GA 1JALA 4LJ4A 4QNRA 2VHUA 2Z4SA 4AG6A 2PJZA 2DB3A 4F92B 4QRHA 2GESA 2KBFA 1KO8A 1NIPA 3ZZTA 2XGJA 1F5NA 1KJZA 2G83A 4B33A 3PQCA 3CH5A 4M2LA 1FW6A 3E70C 2QBYB 4Q4AA 1NG9A 3ND9A 1MH1A 1E9AA 1G4UR 1D5CA 2OBLA 2WKRA 1FUKA 3N70A 5JRJA 4M1MA 2CK3D 5FI0B 5A4JA 4Z8XA 3CO5A 4Q4JB 4PAQA 2IUSA 3T12A 5AJYA 1ZM3A 1AJEA 5CM8B 3OFND 2DY1A 4GBMA 4FMBB 1E2PA 3T34A 4F38A 3Q9LA 1FPMA 2R44A 4C7OB 3A37A 1E3MA 4JLAA 3LQRA 3W3ZB 4UJ5A 3RWOA 3QF7A 5HPYB 1H8HA 3QXSA 4CIDA 2OESA 4CYMA 1E4VA 2J0VA 3CRVA 1E32A 1Z3IX 3JVUA 3LLUA 4G5RA 2DWPA 4LYJA 3QENA 2BMDA 3DVLA 2IWHA 1YZQA 4GDFA 3N5CA 2NTYC 4MYHA 1R5OA 1XD2B 2V6JA 4PPGA 2ODBA 2C9OA 4KFTA 2HYDA 4TTQA 2WM9B 2IUTA 1M7GA 4A8JC 4BE7B 4ZCIA 4DLUA 1TPZA 5DGXA 1G8FA 1YE8A 5KO2A 3H86A 2VO1A 3RVBA 2WWHA 2XNDD 3VHXA 4Q03A 1ANKA 3IHLA 4ASUA 1GNPA 3KJGA 2OZEA 3IDQA 1NVVQ 1KMHA 2CNWA 1X86B 3U3JA 1NMYA 1TU4A 1G8PA 2QSZA 3BFXA 5FI1B 3ASZA 3HPQA 4XVUA 3OEHA 3NTUA 1R0XA 2ZSEA 3CX7A 4PQYA 3EZ9A 1UF9A 3U3RA 3P4XA 1EX6A 3HDTA 2WOOA 3KB1A 3PG5A 1TX4B 1W2HA 3EZ7A 2CHVA 4JBWA 1KSGA 1AIPA 4MGKR 2RGAA 5FPSA 4ZI2A 3K70C 4NHOA 2V54A 2QE7A 4L5BA 3OE7A 5FPHA 3UATA 1SHZA 3MD0A 4GFDA 2WJHA 2H18A 4KFRA 1TUEA 2LWIA 2DFKB 3CIOA 1KK0A 4QJ5A 2ZJ8A 4HZUB 5DYIA 5L3QB 4URXR 4OL0A 1XNJA 2SHKA 3K09C 3NH6A 2GAOA 1ODFA 4EFNA 1EK0A 3RS7A 3S1AB 4D0LB 1IQPA 2A3RA 5JSZA 1FNMA 1CS4C 5EE0A 4D4LA 3QPVA 4LBYA 4MYUA 4DEYA 2O8EB 1NKSA 2ZJYA 4AC9A 4DT1A 1L8QA 2CLDX 4UKDA 2J7PD 2RGEA 3HU3A 2QUZA 3F0TA 4C7OA 1KO1A 3LBIA 3SJAA 4LBZA 4B2LA 5DN6D 2H92A 3NDBB 4NE2A 4DRZA 2Q3MA 2RMKA 3QY0A 2WSMA 4NL4H 4WZAE 5CLQA 2NPFA 3SFZA 1AGRA 1P3JA 2DWOA 1ZAKA 4OYHA 4JZKA 1T0JB 1XTIA 2HXYA 2F1JA 4OI1A 2IC5A 1RJ9A 3K0EA 5LD2B 2QTFA 3CRQA 3JZMA 5AK0A 3C15C 4LC0A 3VR1A 1KMQA 1W36C 2IL1A 1PJRA 4DSOA 2PT7A 5G53C 3X2SA 2EFCB 4K81B 3GFOA 2HLDD 3V00A 3CB4A 4FCVA 4XTCS 1RKBA 4EJSA 3TW8B 5JCZA 3DPUA 5KDLA 2D2EA 2ATVA 1SVMA 5E3HA 1E79D 5JHGB 1LV7A 3TLXA 1TUIA 4P4UA 2EWVA 3KQUA 2MSEB 3W3AA 2YWGA 1TEXA 3R7WB 1BOFA 1E2FA 4OQLA 1OKKD 2PZEA 4G3XA 2IF0A 4FMCB 2G1JA 4M1OA 2WIBA 1F2UB 1G20E 3X1WA 3MWYW 2ZANA 3T15A 3T1VA 4CF7A 4TYNA 1JR3A 1OYYA 5FFMA 5G41A 2ZUBA 2EQBA 2JLXA 3DKPA 4EPXA 1PLJA 3THWA 4DZZA 2BWJA 1R0YA 1U2RA 4YXWD 2ZI9A 5DHAA 2F1RA 2PBRA 3KB2A 1II0A 2Q21A 2D62A 3R7WA 4AIIA 1MO6A 2J7KA 3AUYA 3EASA 1DARA 1V5WA 1E2KA 1XTQA 2IYLD 2VA8A 4C2TA 3AVWA 2QROA 1W4AA 4LX0A 2ZSFA 1E2NA 1AKYA 1W46A 4NCJA 1BH2A 4PSVA 2C8VA 2YNMA 2GBLA 4TMZA 3TR0A 1Z6AA 1U8AA 1XWIA 1F48A 4JLNA 1MV5A 3MUFA 3H2YA 4U02A 4A8JB 1NG1A 1ZUIA 4TMWA 1ESMA 1FL9A 3KQLA 1RYHA 4D0NA 2X77A 4JLDA 1XTKA 1FP7A 3CX6A 3KKNA 3X1ZA 5FOWA 1LW7A 2H16A 3ZVRA 1T6NA 2Q3FA 4UNRA 1IN6A 5KUTA 1ZC3A 1FP6A 1G3IA 1UBEA 2FX3A 2H1LA 3WMEA 2DFTA 4BWYA 2QPOA 2C98A 1MO4A 4IDOA 4QNMA 4UJ3A 1OXUA 4TL6A 1JPNA 2A7QA 2D3WA 5EQTA 3ZD7A 3W90A 3T5DA 4BRUA 3PEUA 3WBKA 1H8ED 3K0AA 2XTZA 1QG2A 2GA8A 5DYGA 2QRNA 3KUCA 3LAWA 2AKAB 2CNWD 5UKDA 3RS0A 1Z5ZA 1IOZA 1OH5A 1N6HA 4LV8B 2P65A 3GJ4A 3RWMB 1XU4A 2W6IA 2A78A 4CEIB 1R4AA 4DLZA 2IS4A 4YMUA 3U44B 4L9SA 4QJ3A 3THYA 1XMJA 3QKRA 1ZUHA 1T3SA 1NF3A 1N6OA 4PC7A 4M9XA 3CR8A 3CPHA 1ZD1A 2IHBA 2RH5A 1WF3A 1G3RA 2CLCX 3W5JA 1IY2A 3BB1A 4IXMA 5KYKA 1HEIA 5JI3E 1OLOA 2CHQA 4UQOA 1ZIPA 2J87A 3LH5A 4BZPA 3AGQA 5EZ6B 3PUWA 4A0HA 4DEXA 1I2MA 2F43B 3A1TA 1NMZA 2VP2A 1ZBDA 3L0PA 4B48A 3AGPA 1CR1A 2AD5A 2OUKA 3CRRA 1KK3A 4DLYA 2CCKA 2G1KA 4F91B 2RHDA 2Z5FA 3SN6A 3OIWA 2IYUA 1JQJC 4XIGS 1NN0A 2P6RA 1GG2A 4GRAA 2QTVB 3K0FA 821PA 3KQNA 4TMVA 4KYUA 1OFTA 5AUQA 5JJKA 4M1SA 2XB4A 4JVMA 2QPAA 2H8KA 3QKSA 3IHWA 1Z2AA 4M4SA 4M1KA 3AVYA 2FF7A 2ORVA 2JLUA 4GP7A 3OIYA 2BCGY 4WXRA 4RFVA 5KPDA 2B8WA 1NSFA 2G0TA 3EIEA 1O3YA 4RJLA 4Q4HA 3EX7C 2GCPA 2C95A 1XEWX 2O0KA 5TB5A 2E1RA 1CIPA 4PC2A 4CEIA 3D8BA 2V6IA 4B2PA 1DAGA 4O3MA 1Z06A 1J8YF 2CEAA 4D82A 2V9PA 1C4OA 3QVVA 2PH1A 4GT1A 4H1VA 5TY0A 4Z1MD 2IS6A 3PUVA 1ELOA 4IOMA 1E99A 3PITA 421PA 2A30A 4CW7A 2QQEA 2Q9BA 4TYQA 4B34A 1N5LA 4LJ5A 3DM5A 3KXKA 1SQ5A 3LD9A 3Q85A 2EYUA 3BJIC 1W5SA 3JVVA 3RABA 5JRZA 3B13B 2PCLA 4EQ6A 3UMSA 4F4JA 3A6PC 2GCOB 4B3XA 3WBJA 2GEDA 2A5FA 3IBYA 5BN5A 1OFHA 1QHXA 2IYZA 2ZYWX 3GJ8A 3CPJB 1VHLA 1OPXA 3L0SA 1RPZA 1O87A 3Q7PA 2G88A 1IN8A 1WCV1 4EAQA 4XWAA 3KJHA 2QENA 4F7WA 3GLFB 3U61B 4B43A 1U81A 3BH6A 4Q9HA 2ZEJA 1XXHB 1XJCA 1UM8A 2Y8EA 1EFCA 4FCWA 2BM0A 4FMDF 4BZXA 2CMKA 5JJLA 2ZIAA 3TVDA 1F60A 3D31A 2NO1A 121PA 3I72A 3SR0A 4DDWA 2FH5B 2OEPA 3P20A 1ZNZA 3TH5A 1AA9A 1U8YA 5J47A 2XJ9A 4HB0A 5DISB 4M0LA 1YHNA 3C8UA 3BGWA 4LJ7A 1VYUA 2NGRA 1ZNYA 5FBLB 3CH4B 1RRFA 4NCHA 1ESNA 1E9DA 1SVIA 1KYIA 1PUIA 2ZSBA 3K0CA 4HLUA 6Q21A 2FPMA 2VSOA 4B3DA 4QHYA 1E2IA 1KSFX 2VP4A 3RRYA 3FHTA 4B3FX 1KDOA 2DFNA 4PPFA 3IBGA 3MCAA 3GJ7A 3BS4A 2RGDA 4G5QA 3EWAA 1XTSA 3VR4A 4QFMA 2UKDA 4EPWA 3UWKA 2QAJA 2AR7A 2CVHA 3BH0A 3CRMA 4W5WA 3WYFA 4LJAA 3DMNA 3QKTA 4B71A 3CF2A 4JL8A 3SU8A 3RRNA 1L7VC 1W36B 4G0NA 2IX3A 3MAAC 1R8SA 1U98A 4LJ8A 1UPTA 4RCZA 2BV3A 3O8RA 4PO9A 4RSGA 3T1QA 4L8GA 1WBDA 5AUNB 4DLSA 5JBQA 2GZDA 4LHYA 3RHFA 1G3UA 3BFKA 1TTTA 2IS1A 2BC9A 2DCUA 3OE7D 4W7SA 3ZQ6A 2DPXA 3Q3JB 4E09A 2R2AA 2Z0MA 1YZUA 4JBXA 1NY5A 1OH8A 4V02A 4RD4A 4EKDA 1CULC 4L4UA 5DI3B 1U94A 3PXGA 3BB4A 4GI7A 3RNLA 1DO0A 2IK8A 3HJNA 4QHSA 4ACBA 4M8NE 5G40A 2N46A 4IDNA 4WOPA 2KE5A 4L9WA 2J9RA 4M1YA 1QHHB 1XB2A 4F4IA 2JATA 4DSTA 1DEKA 1OKKA 2VYFA 1N3BA 2TMKA 2C04A 2QMHA 2ZR0A 2OCBA 2WSSD 4RFSA 2R9VA 3FFBA 5FPKA 3VNUA 1NRJB 2A5DA 3FKSA 3LV8A 3EA5A 5J5CA 3B1XA 1XP8A 1A5TA 1NJFA 5G3YA 2CBZA 1MABA 2JIZA 3TSZA 3AM1A 4Q9LA 1ONBA 4RD0A 2YKGA 1G7RA 1HTWA 1KZGB 3WYGA 3MJHA 4ZI3A 2D7CA 3QBVA 4Z1MA 4DUGD 3IO5A 1W4BA 2IBMA 1N6LA 1N5KA 2B6HA 4JYCA 3CWZA 4LCBA 4ACAA 1XZQA 5L3RA 4DT1B 3VR2A 4V0LA 2HF9A 4KODA 4HAUA 1YR8A 3MFYA 3T35A 2ZXUA 4B75A 4AY2A 1KSHA 4PFSA 3W6PA 1WQ1R 1Q1ZA 4W9MC 1GIAA 4MUBA 4M22A 1XPOA 2WVJA 1U90A 1E9EA 5HZHA 5AJXA 2PMDA 5LDDC 4TLDA 1U99A 2LCFA 2BKEA 1NBMD 3W8NA 1AZTA 3P27A 3SQXA 2WJIA 2J45A 1W0JD 2ZUCA 4LOAA 1VG0B 5TVKA 4DWJA 3BD9A 3PUXA 4LYHA 5GJWC 2JLZA 2ONJA 3T06B 5AJVB 5KPJA 2FNAA 3K09A 2GILA 1G3MA 2VRWA 5J4LA 5CJPA 2F1IA 2ONKA 3RC8A 2IS2A 2O8CA 4EPTA 2PX0A 2GRJA 5KDDA 4PZYA 3EW9A 2B92A 4B3BA 4TZ6A 1AN0A 1QVRA 4LC1A 4LRWA 5HE9A 3L0IB 3M0EA 3IO3A 4JVLA 3NBYC 4ON9A 5IF9A 5K8UA 1KK2A 2F43A 1XMIA 1P9WA 2OCAA 2YC4C 3AP2A 1CRQA 4JLBA 4K8OA 1VYTA 1G5TA 3TAHA 4AYXA 1OB2A 3ADDA 1T0HB 5J4VA 1NL3A 5AUPB 2GZHA 4A4DA 4DLXA 4YMTA 2ZRAA 3K0FB 3ZQJA 5JLJA 2YHSA 3VAAA 4DCTA 1D6JA 4KFSA 3FE2A 4PAMA 1H8EA 5AR1A 3KKOA 2XXAB 3AF0A 4FWTA 3W6OA 4JIMA 1NMXA 2QZ4A 5KNBA 4B35A 4BFUA 5BN3A 4TTPA 2W58A 1UKZA 1UBFA 3IEUA 1VPLA 3TK1A 1R5BA 4TMKA 3GEEA 4MKHA 2QG6A 4LBWA 4WW0A 4NYMQ 5CIQA 1E0JA 3L8YA 4TL9A 1WP9A 4E03A 1KO4A 4MH0R 4JLOA 2ZAOA 1LB1B 3K9NA 3S1AA 4Q1AA 1ZINA 1FX0A 1G5RA 3H1TA 1UJ2A 4IJMA 1B23P 1IXSB 3RS3A 1GOTA 4TL8A 2WV9A 3GJ0A 1E4YA 1JBKA 1EFTA 2IUUA 2DYKA 5AJWA 3WXMA 2O52A 5GJBA 4TWZA 3TR5A 1P62B 1Z29A 2H5EA 2AHOA 2Z6VA 4F93B 1OHHA 1ZJ6A 4C0HA 4HEJA 4OHWA 2BBOA 4KVGA 1P2SA 1KK1A 4GP6A 2O5VA 4WZ6A 4DXAA 4O2LA 4EFMA 2FEOA 2ZRCA 2ZJOA 1GITA 1SVSA 1KZ7B 4XWOA 2G0NA 2OE2A 3CLVA 4A36A 2HYIC 4E22A 3U4QA 5FTNA 2AKYA 1H65A 2REBA 5KSOA 3VFDA 4OHYA 3REGA 1K5GA 1OB5A 3I4LA 3LWNA 1WB9A 3W34A 3UG7A 2WKPA 4HUQA 2BIFA 3DEFA 4M1TA 4IFBA 1OYWA 2YYZA 4LSGA 5KOYA 5IT5A 2O8BA 4LY6A 1JB1A 4BLRA 2I1VB 1IN4A 4LGMA 3THWB 2YZ2A 1KNXA 2IF2A 4I4LA 2R62A 4NPHA 2A2ZA 2FE4A 2ODNA 3WNDA 1GKIA 1BYUA 1DPFA 1XPUA 1CBUA 1Q1QA 1KY2A 4B44A 4OBEA 2NG1A 3L0OA 1E2EA 4OHZA 1US8A 3PCRB 5C1BA 4TMXA 4BFZA 2JASA 3B2EA 5HR5A 1TADA 4Q00A 1GDDA 1G19A 2QMUA 4MKIA 4OK3A 1UADA 5JHHB 3NXSA 2X2EA 1T5LA 1P2VA 1U0JA 2R8RA 5SZKB 1NJGA 5B57C 4KV9A 2JLQA 1LF5A 1X8KA 4OKSA 5KU1A 5KHOC 1HA3A 1AS2A 4RVCA 4YDHB 1ZM9A 5KSYA 5B58C 3BFVA 3D6TB 1XBTA 5CDFE 3FMFA 1NN5A 2GBLC 4MUAA 4Q9JA 1NY6A 5BYJA 1HYQA 1FX0B 3EARA 1HE8B 3AVTA 4DIEA 4DJTA 1P2TA 2WJYA 4B6FA 1CJKC 3B9QA 4M9SA 1Q12A 3I5YA 3R9XA 5FOUA 2G9NA 1JEDA 3WMGA 3K8YA 3WP0A 2ZYVX 4KFUA 5CYPA 1CLUA 5FOXA 5FL3A 4IDHA 3WY9A 2FZ4A 3TUIC 2E87A 5FTMA 5DN6A 3AF4A 3VU9A 1W0KA 5LB4A 2VP0A 1GM5A 2B21A 3UWOA 1QHNA 3NWJA 1G4AE 1II8B 1NBMA 5JWOA 1KOFA 4I1UA 2OLJA 4LJYA 1YR9A 1P72A 2PZGA 4QHTA 2CJWA 2OILA 3LA6A 5DLQC 4DUGA 2WICA 2RKOA 3AV0B 4XH9B 4CT4B 2ANCA 1HT2E 2PJRA 3NBXX 4QKQA 4GNKA 4IFEA 3OEEA 3QNUA 4RFSB 5AJZA 4NBSA 2DWQA 2WWFA 1AQYA 3QKUA 4GZLA 1QHHA 5FL7A 3PUYA 4ZIRA 2QT0A 4NCNA 1YZGA 3U2QA 1DAIA 1ZMXA 2I3BA 3R20A 5FUXA 1CP2A 1JPJA 1QF9A 4NYJQ 1FOEB 1N6PA 2CXXA 3O47A 2P67A 3NC1C 1YZKA 4TSFD 1ZP6A 2P5TB 3MMPA 2WMNB 3QBTA 2FU5C 2JJ2A 4MYTA 1ZNWA 3SBDA 4TYPA 1GSIA 3DKVA 3SQWA 2OFXA 4MA4A 4PO1A 4BRWA 5JI2E 4BFTA 1S1MA 2WWGA 2W2VA 3Q8XB 1U0HC 3CNOA 2WOJA 3LFUA 4IDPA 2QEQA 4LYAA 4BECA 1TQDA 3ZVLA 3HU2A 4ASUD 2ANBA 2CL0X 3NIBA 4GPTA 4KYIB 3AKEA 3G0HA 4QGFA 3BIFA 1LVGA 1OW3B 2J0SA 3TNFA 3LBHA 1TL7C 3B78A 1YKSA 4HAWA 1A2KC 3GFTA 1KTVA 4QBFA 1KDPA 5IRCD 3U5ZB 1JQLB 2OCPA 3QI2A 3FKSD 4Q7JB 3U60B 5TMPA 5H8WA 4AD8A 4BFYA 4TLEA 4ZV4A 4HDQB 4CEHA 2GKSA 5CM9C 1J70A 2QM7A 5EUMA 1IAQA 3ZIAA 5FOTA 4C0KA 2ZUDA 2XNSA 2IYRA 4Q18A 4BZQA 1W47A 4ARZB 3KKQA 3U4QB 5SZHB 1S4QA 2YWEA 3C4JA 5FR1A 3PV0A 1XF9A 4HB3A 2GJ9A 1QZXA 1GL9B 4LV6A 3NEYA 3VU9B 1M7HA 1Q22A 3FKQA 4KCGA 4XJXA 4N1AA 1SULA 1B0UA 1XEWY 3QPWA 1XFAA 4R2IA 1COWD 3IQXA 5D3QA 4US1R 4Q21A 3QG1A 4MDEA 4JMPA 2IYVA 2QL6A 3RSLA 1T8TA 2AWOA 2FPKA 1KKMA 5HKKA 1CEEA 3WNCA 3AVVA 1T9HA 3ZGXA 2EFDB 1GRRA 2GK7A 4D26A 2ZRLA 4LHZA 4JJZA 4R2HA 4OQMA 1Y63A 4ZPXA 3BB3A 3GFPA 1QBKC 2ZAMA 1R7RA 3KKMA 1RE0A 2VTKA 2GJSA 3LLMA 4LI0A 1HT1E 1UDXA 4MITA 4JLKA 4HDOB 1IXRC 2RCNA 3EPLA 5GJVC 1ZC4A 2JDIA 3G5UA 2ZS7A 3NH9A 3BC1A 4URZR 5FTLA 1UKVY 4ZKEA 1P4SA 4KSCA 3OAAD 1G8HA 5E4FA 1TQ6A 5L3SA 1TAGA 3E2IA 2WJGA 2F9LA 1OXXK 4BUJA 3C5CA 3UANA 3A1SA 4PZZA 4UNNA 3SDZA 2O0HA 2ZU0C 3SS8A 2EW1A 2O8DA 1EWRA 1LF0A 3M1IA 2NIPA 5LB2A 2EYQA 4B2IA 3ZD6A 2W2XA 1RRGA 1SXJC 3TIFA 4AK9A 5K8IA 3AEZA 3HPRA 4A6PA 1AGPA 1LY1A 4A2WA 4NH0A 1IJEA 4AKGA 2WMOB 3LW8A 3EC2A 4P33A 1YU9A 5E7IA 3RANA 3AVQA 1BYIA 4Y0VA 2W0SA 5CYOA 4I1VA 4B32A 2WHXA 4EPRA 4I1SA 1S9DA 4OJQA 4URUR 2W6JD 5EE9A 5FPYA 3SYKA 1J2JA 1U9IA 1DAKA 1NLZA 2GF0A 2VIIA 1OXTA 5FTKA 1JAIA 1UBGA 2FFQA 5C46F 4RZXA 5AWFC 4US0R 2A9KA 2D06A 5BXQC 1W7AA 1RFLA 2PLFA 1FTNA 5H1YA 2J0UB 4F4CA 2OAP1 3CKLA 2FGJA 3MRSA 1JXOA 1RJ9B 2GZAA 5L8VA 1G41A 1G291 2ZRHA 4NYMR 3I92A 4K46A 1TU3A 2AX4A 1Q1EA 4WAUA 4YXWA 1Z0KA 4BEJA 1P7CA 4KBGA 4UXIA 1LTQA 2VHJA 3CR7A 1WMSA 3TVTA 4ABYA 4OQXA 2JIZD 5F3WB 2IXFA 2YOHA 3CZPA 3PENA 3M6AA 1XD9A 2ECKA 4JLPA 1N5IA 4LHVA 1D9ZA 4V0KA 1QHGA 4YDSA 5G3ZA 1E9SA 3EZFA 1E9RA 3AVUA 2QP3A 2P6NA 3FVQA 3BK7A 3V9PA 3ICEA 1SXJE 1UEJA 4OJKA 4A8JA 2O8DB 1R5NA 4DB2A 2VF7A 4D0GA 2XJ4A 4L15A 1EXMA 1Z0DA 4DBLC 4HATA 4FW9A 1MRNA 1SVLA 4Q1BA 5FH9A 2FV8A 3I1FA 1EESA 5C2JB 4ZDJA 5DIFA 4TZ0A 2GJAA 4Z54A 3SYNA 2QY9A 4N3NA 3N2IA 2G6BA 4NZYA 4PANA 4C0AC 4IEIA 4B3GA 1LFDB 2XZPA 4RD1A 4LBVA 2ZR9A 4NONA 5AUOB 5J4HA 1R6BX 3R8CA 4Q19A 5KDOA 2VHCA 1N0VC 3R9IA 1E1QD 1OJLA 2HJVA 1J99A 1EX7A 1GKYA 4M1WA 4OK6A 4KAXA 5FTJA 4YQFA 5EJEA 4LJ6A 3JZAA 5CB6A 1XPRA 3AVXA 2KBEA 2AFHE 3CPEA 1TNDA 3DMDA 3T1TA 1V43A 4FMDB 4BLSA 4OQNA 4WVFA 1EWQA 5FR2A 2ZRBA 3AP1A 4AKEA 3KDSE 4KITB 1IBRA 1JR6A 1VIAA 4KJZA 1WA5A 2ZITA 2ZQ5A 5FUWA 3UIEA 5KTYA 3OIUA 4WA7A 1Z08A 3QXJA 3UKDA 5A0FA 1N0WA 5BQ5A 5JEDA 4IOKA 4BLPA 3K0SA 3LDAA 1II8A 1DE0A 1P73A 4XTRA 2ZJZA 2KJQA 3QEJA 3QIAA 3Q72A 3PVSA 4BGDA 1G8GA 3GPLA 3OESA 1TF5A 2Q9CA 3AKDA 2BMEA 3B1ZA 3GJ3A 3T5GA 3SJCA 1IN7A 2IWRA 2ZRPA 1QG4A 3BWDD 3VKWA 4YLGA 1ETUA 2GTPA 2ZE7A 1L4YA 1CJUC 5IDVA 2ASEA 3D3QA 1SXJD 4DHEA 1CR4A 4IDQA 2F7SA 1X8JA 3B82A 3KJEA 1BMFA 5C18A 4II7A 1E1RD 1UFQA 3KX2A 1EFRD 1QHSA 1X6VA 4Q4AB 4X8MA 1G16A 4QL3A 2FJUA 2E9SA 1T5IA 2IYQA 2VH5R 4MYCA 2CE2X 2WAXA 2BVNA 621PA 3MJRA 4JL5A 1RRCA 1J7KA 3E5HA 3ZS8A 5JS8A 2WIAA 1M2OB 2HT6A 4Q02A 4XOIA 2XEXA 1Z0FA 2QAGB 4JSYA 3THXA 5KSPA 4XD7D 2IEZA 4HLCA 1OHHD 3Q5DA 2QP4A 1KIMA 2JLWA 3AF2A 3UXMA 3DZ8A 4D2IA 4O0MA 4ILEA 5H70A 1KMHB 2IHYA 5JECA 3MWKA 1AZSC 4HLQB 4IOLA 4R7ZA 2FGKA 3PR1A 4FMCF 1RC8A 3BORA 2QI9C 3ADCA 3F3YA 2B8TA 3LY5A 521PA 5EP4A 5EXTA 5EP3A 3TQFA 1XEFA 4RD3A 2YINC 2Z83A 3KL4A 1IHUA 2VQSA 2PLRA 1YQTA 1QRAA 4C30A 4LK2A 3KQHA 4A0FA 2ATXA 4JKIA 1OH6A 2AK3A 1IY0A 3PEVA 4RY2A 3F8TA 4DDUA 4TYYA 5EXXA 4TLAA 4QGAA 1W4CA 2J3EA 3A58B 4TQUS 4AYWA 2W00A 1PVOA 4EQ6B 4R71A 3QF4B 2XZLA 3UG6A 4PQFA 4TN1A 2ORWA 2FG5A 4QGGA 4U5XA 2OM2A 3IIKA 1T91A 2ZSAA 1G6OA 1T3LA 1TQ4A 2NQ2C 1XXHE 2ZTSA 4LDJA 1FTSA 3SJZA 2C03A 1HQCA 1GP2A 1Q3HA 2OXRA 2NMVA 5C4MA 1ZNXA 2IW3A 1P9NA 4Q9IA 4LPKA 3MG9A 4DIDA 2FFAA 5FOVA 1ZM2A 1YRBA 2F1HA 3AB3A 2IYTA 4XVRA 1A4RA 2IT1A 4PHHA 1BIFA 3Q7QA 5BYKA 1E6CA 3RC3A 5EUQB 1NVWQ 1XTJA 3E1SA 4URYR 2JJ1A 2F55A 3GJ6A 4XSHA 2IXGA 1LS6A 2HXSA 1XDBA 2CCJA 8OHMA 3CNLA 1P6XA 1XEXA 3NHBA 4DSNA 3C7KA 5IK2D 4DDVA 1PZNA 1NIJA 1G6HA 5CB8A 3WNBA 2RHMA 1I4LD 2J5XA 1W5TA 3GLHE 3QJYA 2OXCA 5GVRA 3EZ6A 4IVPA 2KSQA 2L0XA 4ARZA 3AF3A 3EC1A 1NKTA 2XNDA 4Z8YA 2GAAA 5SZJA 2QRZA 1IONA 1P2UA 4C0SA 3QUSA 4IHQA 5HZKA 1Z83A 4QM7A 1Z0JA 4GZMA 2Q6TA 4YMSA 3KZ1E 5LD2C 1CU1A 3QXCA 3I32A 1G5PA 1VYVA 4HAZA 3K9HA 5LBIA 2ZU6A 1KI3A 3A4LA 5M04A 5GADl 1G7SA 3WHKA 1DOAA 2BM1A 3CM0A 2ODEA 2GCOA 4TLBA 4QXAA 4DCSA 1KI6B 1Z47A 5BN4A 4PC3A 3I62A 2H57A 1N6KA 3OFNA 1ZCAA 3EG5A 1E94E 1T8UA 4PPNA 3IEVA 2IYYA 2BMJA 2AXNA 2BKUA 4JLVA 1UKEA 4HI0E 4V03A 4E07A 1AM4D 2WPDD 1G17A 2GEVA 4JKYA 5J40A 4B73A 3O8CA 4EDHA 1DAMA 2ZROA 1H8HD 1ZYUA 1TMKA 2MMCA 1WE2A 1ZU5A 2QMEA 4ZKDA 1KI7A 2R65A 2RGGA 1FZQA 2Q3HA 2XOKD 4MRNA 4JVSB 2V1UA 3GLHB 1SKQA 2AD1A 4P4TA 4J0QA 4TT3A 2OAQ1 1F2TB 4Q47A 1Z6TA 3NDPA 5FBWB 2JGNA 3ICQB 1Z0AA 4M53A 2RGNC 2WWIA 3QPUA 2EVWX 2QGZA 3GLIB 4GSYA 4NYIQ 2WTUA 3CZQA 1Z6YA 3GEHA 1E2DA 3PIRA 4KLZA 4HYYA 4PSKA 3V4FA 1RVDA 2IEYA 5JSZB 3AVPA 2ZI7A 4E5UA 1E2QA 4PQRA 1KKLA 3ZVMA 4BFVA 2V1XA 2XTMA 2FDCA 1F6BA 3RDPA 1YR6A 2X19A 3NVAA 4ZDIA 4MQBA 2A5YB 2CL6X 4DLWA 3I61A 5F9FA 4W5JA 1UEIA 4V0OA 2RGNA 2W2TA 3QVUA 5J4KA 3BXZA 1D2MA 3KTAB 4JSTA 3DO6A 5DO9A 1KY3A 2ZRMA 4RKFA 1ZW6A 3TUJC 2VL7A 1HE1C 4AURA 3VX3A 2C99A 5EP2A 5EXSA 1W36D 5E7MA 2CDNA 2BDTA 3TW4A 3THXB 1G18A 1P5ZB 4P31A 4DVGA 2ZRJA 1N5JA 2ERYA 3DHWC 4Z51A 4A0RA 4R9UC 1WXQA 1XRJA 1ZVQA 1KDRA 1Y3AA 2ZS8A 3RSOA 3F5FA 4GMDA 1SZPA 3RS5A 4JJKA 5FBQB 3VR6A 2ZYTX 4MGIR 2YOFA 4HB2A 3SC3A 2IXEA 4LV5B 3THYB 2EU8A 3U44A 1S0UA 5D3MA 3BH7A 3LRPA 5DI3A 5KSZA 2YWHA 5SZIA 1Q57A 1W49A 2JAQA 2QE7D 5H68A 4C3ZA 3RYTC 3ADKA 5DH9A 2ZI4A 4ZIRB 1DTSA 4JT4A 4OI2A 3SZRA 1CTQA 1D9XA 3WHLA 4C9BA 4HSEA 4MKFA 4EUNA 1Z8FA 4U00A 3EPJA 5A5GA 1U0LA 1R10A 4P4SB 1PLKA 4FIDA 3VTKA 3LQQA 2LKDA 4C2UA 3TBKA 1MKYA 3HR7A 1N6RA 4HUTA 3TAUA 5CLLA 2O8EA 2XZOA 2BMFA 2N42A 3IQWA 1VG8A 1JJVA 2ERXA 4LWZA 3U7FB 3KKPA 4KLNA 1D2EA 1UAAA 3A36A 2V8OA 3CRW1 1LS1A 3FPAA 3REFA 2Z43A 3X1YA 2CLSA 4WXPA 2GDJA 3W6NA 1OT3A 5JMTA 1EGAA 2P5SA 3A4MA 4KXFB 4QOSA 4D81A 1W44A 1NLFA 2REOA 5L3QA 1AKEA 2FA9A 3KQKA 1TEVA 2QN6A 1Z6GA 4EFLA 3CNNA 1DS6A 2CJWB 2REXB 1ZM7A 4JLJA 5JFGA 3C41J 3LNCA 4G1UC 5DHFA 3WRYC 2WZQA 2GK6A 1E2MA 4HAXA 2JLRA 4YONB 4FWIB 2WSSA 1RW4A 2GWHA 3ZIAD 3SHFA 3SHWA 3QOFA 4TYWA 5HKKD 1KAOA 2ZRDA 4I1OA 1Z22A 4B74A 3J81k 2GXSA 4IEEA 4LJ9A 4Q7MB 3A8TA 5DSZA 4QBGB 1KJYA 5BW8A 3VX4A 1C1YA 3AKCA 4P3YA 1KO7A 3ZH9B 2V3CC 2OFOA 1X8LA 3W8RA 5TARA 4B6EA 2PEZA 1NI3A 4O25A 221PA 2KI5A 4TT3D 2KWIA 1E0KA 3L82B 5HTKA 3C16C 1KO5A 4A6XA 2AN9A 2GETA 3P1JA 2BBSA 5J4YA 3ETLA 4NU0A 5FPTA 3QXXA 1MO5A 3NHAA 2UZ3A 1M74A 5FUVA 1A2BA 2VP9A 5FOSA 2BBWA 2ZE8A 2QAGC 3X1XA 4A0GA 5EE3A 2X1VA 4RZ3A 4B47A 5KNDA 5JJIA 1Q3TA 1GWNA 1XX6A 3EZ2A 1US8B 3GD7A 2CVFA 3VQTA 4D4MA 4IKEA 1FMLA 3ZDQA 1VECA 1OXVA 1KI8A 4IVRA 4TL7A 1DELA 3GEIA 3RRMA 4ZO4A 3FDIA 1KAGA 3B7GA 1T4GA 2XX3A 1S8FA 2FSGA 1XJ0A 4Q4JA 1XMSA 2QMOA 4MGYR 4WIAA 3AQ4A 2DBYA 2MMGA 2VHQA 4YMWA 4X8OA 2HV8A 3OZXA 2GXAA 3IPXA 2BEKA 3I8XA 4BLQA 4LUCA 2YWFA 1G7CA 3EIQA 4W5HA 4KVAA 2H7VA 3G82C 1XCPA 1IN5A 4B3CA 1U8ZA 4TSFA 1CRPA 4HZIA 2FPLA 5E7JA 4C0QC 2R6GA 1FUUA 3LXRA 2N1BA 4I99A 2B7BA 5FBRB 4G01B 5EP1A 3I3SR 4LHXA 1VCMA 1JXMA 2J41A 2V7QD 4PPQA 1EG7A 2GJ8A 4Q1CA 5CK5A 1X1RA 3B1WA 2ZM5A 5K8LA 3TJZA 2WAYA 2O8CB 4CZ2A 2C9CA 5BWMA 3HWSA 1QHIA 2GVZC 2YOGA 2W0MA 4ZDWA 4KBFA 5HCNA 3SNHA 4UXJA 3SEAA 2AL7A 3UMRA 1VCNA 3W9YA 5LPNA 3K70B 2WJJA 4MRRA 4PR0A 2XTNA 2HF8A 2W83A 2ZE6A 4V0MA 3U7EB 4XWKA 1NBME 2I1QA 3OEHD 2ORIA 2XITA 2JLYA 1N6IA 1U9IC 3U3MA 4C4PA 4CDGA 4NTZA 4C0LA 4A92A 3GLFE 1E9BA 4NMMA 4DLTA 3CBQA 4US2R 2WWXA 1KI6A 3H0KA 2FOLA 3LO5A 4GOKA 2KB0A 1K8RA 2I4IA 4MRSA 4Q5IA 4P32A 4MKGA 2DFLA 3I8SA 2RGXA 2JJ1D 3AVOA 2NO7A 3BBPA 1G9XA 1JAHA 4HAYA 1E69A 1NVUQ 3KXLA 3RS4A 3WMFA 1YZLA 2R6CA 5B2ZA 2Q9AA 1S2MA 3IGFA 5D3MB 3ZJYA 4UNQA 2GCNA 4PAOA 4Q4HB 1EFHA 2ZI6A 3GLHA 1OFIA 2FEMA 1JECA 3OHMA 1UKYA 1A1VA 3B6EA 2C78A 1NN3A 2P2LA 1SVWA 3K53A 4OI4A 2XXAA 4PC6A 1CJMA 3HYRA 4NP6A 1Z2CA 3BE4A 2A5GA 1I4DD 1YZNA 4CGZA 1OIXA 3WP1B 2PX3A 3I73A 1IY1A 4CRWB 1PUJA 4PSAA 1OFUX 1XEXB 4Q9KA 4RZUA 2WKQA 4JL6A 3DZDA 4L16A 4ERNA 2QM8A 2FFBA 3WRXC 1MRSA 4AYTA 5CDFA 1TQ2A 2DHRA 4PXAA 1CR0A 2CK3A 2EWWA 4MRVA 3GLGA 2G77B 3FTQA 1D2NA 1OV4A 2D74A 4EJSC 4LYFA 3VHLB 4AKIA 5CIWA 4D80A 4G5SA 4NYJR 5TXGA 4TTRA 3PEWA 1OIWA 2F9MA 1RZ3A 3NEJA 3Q5EA 5JCPA 3B8HA 1SHKA 3VKHA 1LNZA 2ZR7A 3IILA 4UXHA 3DM9B 3FHOA 1G64A 4DCVA 1S9HA 4OHXA 3C14C 1DBSA 4HAVA 3ZZUA 1CF4A 4JLMA 1P9RA 2FFHA 4KI0A 3FGNA 2Z4RA 1X1SA 3AH8A 1DO2A 1GNQA 1HV8A 1AQUA 1Z63A 2X2FA 3TRFA 4C0JA 3MWLA 4LPSA 2OV2A 3UMFA 3EAQA 1II9A 2WJVA 3VR5A 1WBBA 2J1LA 3AUXA 1M6NA 3SOPA 2C96A 1W2GA 1Z0IA 3O8BA 5L3VA 1KJWA 1OF1A 5FBVB 1GAJA 4RD2A 1JNYA 1G3QA 1VCIA 5KNCA 2ZI3A 3A1WA 1IJFA 1E9FA 1L4UA 3CW2A 2AXPA 4KSBA 4DLRA 3ZVNA 5F9HA 2GHIA 1F2TA 1JR3E 2VPPA 3HP1A 1AS3A 2FWRA 3GP8A 2CHGA 3SBEA 3FFAA 2D7DA 4QBHA 2JLVA 2PL3A 2V55B 3NC0C 4XD7A 2JDID 4Q01A 4CT5A 2UZIR 2QORA 4D4JA 1I2DA 4Q66C 2GEUA 2QQ0A 1KI2A 4KHZA 2ZJBA 3QKSB 2YV5A 4BPBA 2XSZD 4NKRA 1FFHA 2W6JA 3BOSA 1QVAA 1KI1A 3FB4A 4XSGA 4PO8A 4ITRC 3AF1A 2HJGA 3O8DA 1DG1G 1C9KA 1HQYE 1KDTA 1DAEA 1KGDA 1J90A 1Q0UA 1YR7A 2PCJA 2GF9A 3EA0A 2O8FA 1GUAA 1HY3A 2VSFA 4Q1FA 4DCNA 4ZCMA 4AG5A 3FYHA 2GXQA 1E0SA 1VIYA 2OBMA 3ECCA 4I81A 1MOZA 5IK2A 1M7BA 1M1YE 1TF7A 5CITA 3K1JA 1GILA 2JCSA 5HE8A 1P61B 3TGPA 4CEHB 4UNPA 4ZDKA 4A9AA 1E2GA 1KI9A 4EPVA 3V4RA 2EFGA 3LVRE 2EFHB 2RGCA 4YC7A 1E1QA 1NVVR 2VLIA 4RCYA 3U7HB 3GLGB 1ZD9A 1XD2A 2ZVQX 1YRAA 3P4YA 2ZVPX 4B76A 4BEBA 5EXPA 1OH7A 5K8TA 3QKRB 2OLKA 1R0WA 4M9QA 2QP9X 2VBCA 1WRBA 4DCUA 1PV4A 1GTVA 4JBYA 3ADBA 3ASYA 4NYIR 2IYXA 4S2EA 1RRPA 4N0DA 4N0EA 1ZRHA 3FOZA 1JEEA 3DOFA 3DL0A 3ONWA 4CVNA 2QAGA 1NN1A 3GLIE 4Q1EA 2GVDC 2BJVA 3U3KA 2JEOA 4XVQA 4M21A 2VF8A 3B85A 3TMKA 3R8FA 4CEJA 2IYWA 3K0AB 2OT3B 3CX8A 1CKEA 2DR3A 4TQ9A 2VHTA 3ZYCA 4C0BA 4IXNA 4DSUA 2WWYA 4UNSA 2C5LA 4PZLA 5DNYB 2UVQA 3TUZC 5GVSA 4A2QA 1GKUB 1E2JA 1GL7A 3FHCB 4HLDA 3VR3A 1XCMA 3QXHA 4D25A 3PJRA 3SYLA 1CXZA 3QQ5A 3W5IA 3A1UA 3PUZA 4BFXA 3IUYA 4FXPA 4KU4A 2ZI5A 2NZJA 3HYTA 5IHPA 1E0AA 4DC9A 2ZETA 1XXHA 3LVQE 5B30A 1PLLA 3X1DA 1HURA 1XCGB 1YJ5A 3THOA 2JA1A 3AP3A 3UK6A 1EFUA 1P75A 3GMTA 3N2EA 1ZCBA 4JT2A 1JR3D 3ND8A 2RB4A 4HUQB 2YVUA 3B60A 5FL7D 3R9WA 1SGWA 1Q21A 2ZPTX 2OFWA 3KUDA 4HB4A 3T61A 2OSBA 1F3OA 1HUQA 1E79A 4DLVA 2VSXA 5TV2A 2ZJ5A 3EIHA 1BO6A 3OIVA 3IPYA 2YJTD 3I5XA 2AWNA 4FD2A 4QJ4A 2MSDB 3GLFA 3GCGA 2CCGA 2BBTA 2JJ2D 4Q48A 1E9CA 5L3SB 3M4YA 3QSYA 2XB2A 1G8YA 2JLSA 2ZRIA 1L2TA 4HZUA 4M9ZA 4U7DA 2O0JA 3UPUA 1J8MF 1XMVA 1G21E 1MT0A 1EFRA 1OE0A 2R6DA 3GJ5A 4RZ2A 1IXZA 4DKXA 1RYFA 3RAPR 1QHYA 3FMPB 3PEYA 1VKJA 2BJWA 1XD8A 2D2FA 4RD6A 5JZVA 2HDNB 1NNEA 5EE1A 4IRUB 1UBCA 1MR3F 4IVQA 4PHGA 2ZRGA 4JVNA 4ZCLA 2H17A 4Y0AA 2FZLA 2AK2A 3KFVA 4PHTA 4TLCA 3LW7A 2ZRFA 4BFSA 3FMIA 1N25A 4PHFA 3KXIA 5FUYA 5C4GB 2F6RA 4NCKA 2OG2A 2R6FA 1OXSC 3FMOB 2J0QA 2ODWA 2FSIA 3KFXA 1E2LA 4CEJB 2PMKA 4MGZR 3D7MA 4PTLA 1Q1BA 3OAAA 1BS1A 5CK4A 2XSZA 3K9GA 4DDTA 2P3SA 3TSOA 4HDCA 3ZZ0A 3SJBA 3VKGA 3BRWD 1RIFA 2GXUA 5P21A 3IKJA 1N0UA 3QF4A 1QDEA 1M8PA 1GNRA 1P60A 1SKYB 4GOJA 3IIMA 5JEEA 2ZRNA 3B1VA 2ZJ2A 1DVRA 2ZE5A 4HLUC 4POAA 2O8BB 1BMFD 3L43A 4PC1A 1S3SA 3TE6A 4IW3B 2W6ID 2BCJQ 1SXJA 3ZLJA 1N6NA 2K5UA 3NBFA 2IYSA 3SFVA 4AKHA 1D8TA 4BQSA 2A5JA 2BEJA 3K9LA 1S1CA
chains in the Genus database with same CATH superfamily
1P1IA 2R79A 3K0CC 5BSTA 4CL8A 5J3JA 4I9UA 5CT4A 4EA8A 4GL2A 4QVKA 2ERCA 5TGDA 4BASA 4UUMA 4O63O 2P2NA 2GNOA 3FFWA 4NU6A 4WJLA 3K6SB 4KH1A 4A03A 2NPIA 1TOAA 4R84A 2R8EA 5DDIP 4OQYA 4UBLA 5M34A 3PC3A 2ROQA 4MW4A 2P7HA 3N6VA 1L0BA 4RK4A 4KWTA 4B4UA 1PCXA 2OBNA 3TSWA 2WWWA 1X1QA 1DEOA 5CFRA 5I9BA 3STYA 3HA2A 2D1YA 2Y1EA 4YRQA 1E5DA 3TLAA 4OQ4A 5EWJB 4YCSA 2YZKA 2HSGA 3DT9A 1BXRB 5BQOA 3ZS9A 5DI9A 4P4LA 1ODKA 4XQ9A 2Q1TA 3BMOA 4XLZA 3TDKA 4YV1A 2NO0A 1Q92A 1JE0A 1Z5WA 2QGNA 3JW8A 4ZJUA 3VYTB 5IJ9A 5TIIA 3GN2A 4UEQA 1ZD2P 2VPIA 2QA5A 2NZ8A 3K70D 1M10A 3LSYA 3P2JA 4X1YA 3WDLA 2XGGA 3DEHA 4AP6A 1OIVA 3GAMA 3IAFA 4FGSA 1NQTA 1GCIA 1E2HA 1CB0A 1QMGA 3B5JA 4Z2YA 1MW8X 1S96A 1YR3A 4D6PA 3ZJVA 1IBSA 3CF0A 1AS0A 4TQAA 3ZV3A 1EP3B 2YV3A 4X93A 3JWPA 4K6CA 5JMPA 1MP0A 4UTXA 3WYAA 3GLUA 3SVLA 3QEOA 3CNBA 2VZLA 4K03A 5A4KA 2IA5A 3MIZA 4YRMA 2Z56A 3V1KA 2QNRA 1OSNA 5F2EA 4X8HA 2FW9A 1GFIA 1Q20A 2OQIA 3B9RA 4E2WA 5HJ2A 2JFGA 2BFNA 3AERB 4IH9A 4MDHA 1A88A 1W6UA 4LZWA 1AK2A 1GJRA 1SBCA 4A82A 3OPYA 1GPLA 2C5BA 2JH8A 3RRZA 4AY5A 1XJQA 3DDCA 5HCIA 4ARCA 2P9BA 1JKFA 1YIAA 4V1CA 2PS9A 2PT9A 3JQDA 4GQBA 3EXEB 3D2LA 4R98A 2QN1A 4H9GA 1KF0A 4MCIA 4R1LA 1NSTA 4DOMA 1PS0A 2ZJAA 2HT1A 7MDHA 3C5HA 5I7SA 1UOPA 4Q3AA 5AI0A 3AHDA 1DAHA 1FMJA 1AVTA 1Z4MA 2DCMA 2J0UA 2MSCB 2BP7B 4C4XA 4EHHA 1MO2A 2ACWA 2F1OA 2PKEA 3E1GA 1PT8A 2JFPA 2ZYUX 4JNKA 1W4RA 4CKXA 4BFWA 1CUGA 2J59A 3PXDA 2NAPA 2ZBDA 1DPGA 3NOQA 1TK3A 3G1UA 4PX9A 5G1PA 3KTOA 3INYA 3RYFA 1NBOA 1NW6A 1U1FA 3PC2A 2FN4A 4CF3A 3FVTA 4OJMX 1JDUA 1M34E 1M6WA 4R81A 4UASA 4ESHA 2VEDA 5ECWA 3UGKA 4K28A 4FINA 3GLIA 1NSYA 3P2IA 3WV4A 2DMRA 3HJFA 2I5PO 2IIQA 1ICEA 2F67A 1DAFA 4JS0A 4ND3A 1BKDR 2P0EA 3QVGA 3S27A 3DXZA 4ZZ3A 2BFMA 1RQXA 2X8AA 3MJVA 1NP6A 4X71A 1AXRA 3VOTA 3ZBPA 2EBUA 3D6VA 3UB3A 2ZRQA 1ZX1A 3ZHZA 3AFOA 3UOWA 2HQ1A 2WWTA 3KTDA 2NNLD 2BHRA 2PLNA 3WK7A 3KAKA 3RVPA 5AJTA 5HMMA 1FYFA 3GRVA 3LKZA 5IAOA 1ZM4A 3D3WB 3LC1O 3EQ6A 1YDMA 4I6EA 1XXLA 1E1RA 4YRGA 2P2DA 5LWQA 1S2GA 1W5BA 1W34A 4FN4A 4ALJA 1GNVA 3HADA 3W2FA 1E3DA 1QS0A 2ZATA 3GHYA 3BIWA 4PGFA 1DFHA 3B20A 3JQFA 3UO8B 2WJWA 3PUJA 3OHSX 3Q0IA 1DZ3A 1VKHA 3Q7RA 5EZYB 4EDFA 4MR8B 3GZTB 3MWJA 3F49S 4K9MA 3KWJA 4LFAB 3Q88A 3DCIA 1P4AA 3FDXA 2IKSA 4S35A 3S44A 3FPLA 1EEHA 2OHFA 2Q0QA 1JA0A 2HCBA 2Z2ZA 2QN2A 4WD3A 1FSPA 1P9OA 3GOQA 4BMXA 4DSZA 1THGA 2B5VA 2FR1A 4MR8A 4EGQA 1GGEA 3B9PA 3R7LA 3TR6A 3X1KA 4DY4A 4N76A 4P0PB 1M0TA 3B38A 3BAFA 1ORVA 4UVDA 2ZXFA 3WE7A 2M32A 1W48A 1JQKA 5E9JA 4OP2A 2FSFA 2C0QA 3DOEA 3K2BA 3JRWA 4LISA 2YRWA 2NV6A 3K15A 3R3HA 2BF7A 1A82A 2B4TO 3RK4A 1H4SA 1JHDA 1XV5A 1O8BA 4H17A 2PT5A 3TZ6A 2JGIA 3HCNA 1WU7A 3AOEA 3CVOA 4KPFC 4HGYA 4ZMBA 4F2PA 5CB4F 3IIJA 3VNVA 4Z3KA 3F71A 3GLGE 5TF4A 2I7TA 3B6ZA 3QV1A 3ITNA 2LCQA 4BLOA 4E1AA 1ORWA 1GTSA 2XYQA 1RLTA 3OLZA 4KMSA 5C80A 3H7AA 2XOKA 3LYAA 4WUVA 2QJFA 3EPHA 1T35A 3QFCA 1V5GA 3BMCB 3OPXA 1QGYA 2ZSDA 4G5GA 3LSTA 5JYBA 2XYHA 5DGCA 5DSXA 2V4ZA 2PA3A 2Q2OA 3FNFA 4W1RA 2HPZA 3K2EA 5E1OA 2Z4SA 1RU3A 2AJBA 3I9JA 4L8FA 1XNRB 2DB3A 4KRYA 3NIGB 1VKRA 2GESA 2KBFA 3A2MA 1KO8A 1NIPA 3RU2A 2XGJA 5A9SA 4FQ5A 2AA3A 4MGHA 1JXQA 3FWKA 3IP9A 1KJZA 3KDAA 3EFEA 4L72A 4FGLA 1Y4SA 4YUAA 3E70C 1Y1LA 1GAWA 3BHIA 4Z4HA 2LUOA 5HMLA 2YNMC 2ZSJA 1MH1A 3SIRA 3MWDA 1B4DA 2OBLA 3ZYZA 4YQZA 1H2ZA 2OXFA 3I6QA 1JSCA 4F5EA 3KD2A 4MWOA 4BUCA 1U5AA 1UK9A 2AZ4A 2PM8A 1TDJA 3N2KA 4R1OA 3U4GA 2YIJA 1FDRA 3AUUA 3OKPA 3GLQA 1J1IA 3VYWA 4O2BB 1OLSB 2I67A 1E6EA 1ZM3A 3NR2A 4FYXA 4H0FA 4B3HA 2DPGA 4YIHA 4KO1S 2DY1A 5GGXA 5EXEA 2WHEA 1SZJG 1XWFA 4FFBA 5IP5A 3U0BA 1GDTA 3COZA 3NANA 1SCNE 3PFBA 1FPMA 3U49A 1AQLA 2W2LD 3A37A 4CM8B 1VPEA 2LW7A 1PFYA 5G02A 1L3CA 3HRHA 4BAGA 3QXSA 3EB9A 3OTQA 4PLWA 3T1NA 3U3XA 1I80A 2J0VA 3KPVA 4PXYA 5DEIA 1Z3IX 1AGXA 1LVUA 1TMOA 1K5HA 4LYJA 4M87A 1Z7BA 2IWHA 4QVIA 5BURA 1YHZA 3H87A 5TPWA 2PUBA 2HRQA 4MYHA 1XD2B 2SKCA 2ODBA 1ORDA 2PUJA 1ML3A 4KFTA 3A6FA 3GDHA 2VYND 2WM9B 3ENNA 4A8JC 1M7GA 1U8FO 4OGKA 5F5XA 3V97A 3HM2A 4AECA 4HNTA 2PV7A 1TPZA 3AFMA 1F17A 3B6IA 3NV9A 3HJBA 4QXMA 3LBFA 2VO1A 4UATA 2WWHA 2QYTA 2RK6A 3K5IA 3VNAA 4BVAA 3UAZA 1RYZA 5C8YF 1K3UB 4Q03A 4ZVSA 1ANKA 1WIWA 1FC0A 4ASUA 1GNPA 3KJGA 4QREA 4ZANA 5C52B 1WW3A 2GM4A 2PLWA 1NVVQ 1KMHA 1EM8A 3PUKA 5EZSA 3TOCA 4YV0A 5ISMA 1X86B 2OCDA 1RQ7A 1TU4A 1PTJA 3TRDA 3WLSA 4XVUA 1K97A 2D5AA 5E38A 2FXVA 3W4KA 4FIZA 4X1IB 2Z2KA 3U3RA 1WS6A 4ZTZB 3KB1A 3PG5A 1S6YA 3OJEA 4JXXA 2Z5VA 3M4NA 2CHVA 2VPYA 1KSGA 1AIPA 2HLNA 3QITA 4ZI2A 4BLVA 4JJ6A 2BKLA 3L9WA 4KGDA 4NHOA 1DC3A 4R1MA 1MQ9A 3OE7A 3DHVA 4NSNA 1N0IA 2F9FA 1BU8A 3UATA 3VZPA 4YJFA 1F4VA 2R25B 5CLJA 1U2GC 1GD1O 2P69A 1OX4A 1TUEA 4H18A 2QY6A 1BEZA 3C8MA 1XNJA 3K09C 2GAOA 1ODFA 1OFUA 1XLTA 2HOQA 5AD1A 3L18A 4YS6A 3B2QA 4EFNA 4F97A 5JSZA 1IQPA 2P4HX 2Z2IA 3F7MA 3LHDA 3BT7A 2P9EA 2EWMA 1UPFA 2JGDB 2O3SA 3QLJA 5EE0A 3EZGA 5CLFA 1JKIA 1YDHA 5K8JB 3H6KA 1QIMA 1NKSA 4OO3A 1BGXT 3V3KA 2J7PD 1VMKA 1I4OA 5IDXA 1L5WA 2R97A 3HU3A 1J8DA 1T13A 3JU3A 3LG2A 3RVNA 4HPJB 1BE1A 1U2SA 2W43A 4B2LA 3ET5A 1N3LA 2DUJA 5E6RA 5WRFA 4DRZA 5IHXA 1UZLA 1RABA 2RJOA 2Q3MA 1GQOA 5CLHA 4FZ5A 1KPHA 2RMKA 3QY0A 3RV4A 3OQ6A 4EB0A 3PC8A 5AKGA 1ZAKA 2GF2A 3AHJA 3ORFA 4OLFA 1T0JB 4LQCA 4E33A 1QFJA 2X7HA 2YTZA 1KEPA 3C1TA 3JD2A 3HVJA 5BNFA 2B3TA 3VAZA 2QRVB 1AF4A 1EXDA 2CDRA 2QTFA 3GJYA 3H9EO 3JZMA 4J2HA 4DTIA 1KOJA 3I76A 2ON6A 4LC0A 5GM2A 3PYMA 4DJEC 1EB8A 4DSOA 2PT7A 5G53C 5AVYA 2ZJFA 3D6UA 2HLDD 3K9QO 3QVLA 3CZAA 3OI7A 2ZBFA 4IR7A 3LGXA 3OVMA 3L1IA 2FOIA 4XTCS 4R7GA 1A5BB 1XTUA 3HACA 1ZXXA 1SVMA 3O8QB 1E79D 3RYHB 4EBFA 1LV7A 1RHRA 2AUMA 3ASVA 3TZBA 2RI1A 3V8PA 1X13A 2BMWA 5K9ZA 1NFFA 2EWVA 1IL0A 1ZLYA 4ZARA 1CS0A 2DM6A 4D1YA 3D6FA 3PRHA 5KQMA 4YAKA 3ICVA 4OQLA 1OAOC 4BBAA 1OFGA 4IRMA 2IQIA 3IHKA 2ZANA 4E5DA 1J0CA 1JR3A 1X7DA 3L02A 4QDOA 3K5WA 5F4ZA 2JLXA 3DKPA 4GX5A 4AY3A 4DZZA 4F04A 2HMYB 3F1KA 5G4KB 2ZI9A 4KWIA 4RL6A 3DE0X 1II0A 3FTCA 4N9QA 4QDKA 5KMGB 1K06A 4WXHA 2A0XA 2V7XA 3JQAD 4MQLA 4AIIA 1BSVA 2J7KA 3AUYA 3EASA 1B16A 3O4GA 1DARA 5IUNC 5CA1B 2QRQA 2W6CX 3HB7A 2OV4A 2VA8A 3I4CA 3B53X 2QROA 1GU1A 4JOCA 3IR5A 1U3UA 2ZSFA 4QASA 1BH2A 1XZJA 2L82A 4U6SA 3IMEA 3TR0A 1UQRA 1KETA 1F48A 3GRKA 4JLNA 5AI9A 3AW8A 3DYIA 2GCIA 1NG1A 2VHWA 3UH1A 4A8JB 1ESMA 1U11A 4JENA 1Z38A 3LCRA 1DTEA 2VJQA 4BVJA 3QHAA 1SQGA 3CX6A 3KKNA 3H83A 3FOBA 3V4VB 1LW7A 3BGIA 2ZWPA 4P7FA 2GCGA 2HHHB 2CJFA 1U0EA 1VE5A 2Q3FA 3EG9B 2UDPA 3OX4A 4LGYA 3DS8A 4G2NA 4UNRA 5KUTA 1H9CA 2FX3A 3JQCA 2L69A 1KE1A 2AW3A 4GX1A 3U7JA 4BU1A 3LUKA 4BWYA 2EKLA 4P3NA 1MO4A 4IDOA 3J7AC 4QNMA 2FYTA 1OXUA 3GZJA 3HCPA 2A7QA 3I2GA 1UBOS 5JAOA 2WHQA 4BRUA 3SCZA 3WBKA 3K9FC 4B6PA 1H8ED 2B8JA 1HKHA 4DA9A 3H4IA 3W0LB 3AF6A 1W25A 3KIPA 1FQWA 1IOZA 2X42A 4KZPA 5DXJA 1N6HA 4KVZA 1S5PA 2TS1A 3Q0EA 2PGNA 2VDOB 3R3XA 4YROA 2W6IA 4C4ZA 2IXBA 4DLZA 2VBIA 3L7DA 1Z5NA 4JUDX 4OGLA 4E46A 4IWYA 2Z8ZA 3G0GA 3EFBA 2XODA 3L9XA 4QJ3A 2H9AA 5LFAA 1ZUHA 2IXAA 3QPDA 5I45A 2PXXA 1T9ZA 4M9XA 4E5YA 4XM0A 5H5JA 3PX3A 2R00A 1PWYE 1ZD1A 4QOHA 2GA9A 4RA9A 4YV2A 2E5FA 4DWWA 1QYDA 5ULLA 1H1DA 1NWHA 1G3RA 2RBGA 2QZPA 2VQ6A 3BB1A 3BHJA 5IVKA 1GGHA 5KYKA 4QPDA 3H7IA 3PPYA 2YNMD 2J87A 3MYRA 5H4GA 2H1VA 1RYMA 4G5YA 5K3FB 1E4OA 1I2MA 2C2WA 2F43B 4H6XA 4XYGA 3A1TA 3UPTA 3AK4A 3PF8A 5ALXA 3K96A 2AD5A 3CRRA 4DLYA 2CCKA 4I5FA 1I1OA 2ZB7A 3SN6A 1ZOLA 2EZ8A 3T5MA 2J3IA 2JZNA 4B7XA 3FOEC 2I2WA 3AY0A 2JBWA 2P6RA 2QTVB 5B58T 2R85A 2VJOA 3Q1LA 3QGMA 1JTEA 1LFAA 3ESDA 3GUUA 3EVDA 2W2KB 2XB4A 4J1TC 3SSNA 1DEHA 1V25A 2DLDA 2PGIA 2FSVA 2X0JA 4GRIA 5LP1A 3C3EA 3GO4A 4M1KA 1KBOA 2ORVA 4B85A 1PEKE 1FP4A 1QF6A 1BFDA 1GUYA 3ANLA 4Y18A 5AXDA 2GPNA 2JLUA 3JAMA 4AJKA 4FNGA 2B8WA 3MJSA 2R87A 1O3YA 4Q4HA 2VT6A 1XEWX 1I3CA 1UBKS 2O0KA 1T34A 2E1RA 3VKFA 3LTNC 3C5VA 2WFMA 5DNEA 2HX1A 5L40A 3SSMA 1JG4A 2D7JA 3S2IA 1JT9A 4EG6A 1Z3CA 5CJJA 3E4DA 2EF0A 3TXYA 1J8YF 3MRVA 4K9RA 3E3LA 1JQAA 4D92A 3G1WA 5GY7A 4CCAA 2HBQA 5DNCA 3VSEA 3ON5A 2X41A 2PH1A 1PR5A 1KFKB 4UUOA 1SEPA 1KE2A 1NHGA 1NBWB 2GFIA 1YC2A 2H0RA 2XD9A 3GRUA 3QW4B 3RSSA 2IS6A 1Q7CA 1T26A 6NULA 2ZIZA 5AVJA 3T54A 3M1LA 3VYVA 2A30A 4DUYB 2QQEA 4PN3A 3T7SA 4JA2A 5EEHA 4GI1A 1N5LA 4I0WB 4MW0A 3TL6A 3LHSA 4LJ5A 1OVMA 1M34B 3DM5A 3KXKA 3Q85A 4P80A 4AMVA 1Y1PA 1UWCA 1E1LA 1PSZA 3LJKA 3T99A 5LXTB 2H07A 1MOPA 4GP9A 3UMSA 4YRJA 1VJ5A 5D85A 2PANA 3TCKA 3A6PC 4DR4B 4D46A 1MQ8B 3MWFA 1SXIA 2OBXA 4B3XA 1NUAA 1X7WA 3V1MA 1OFHA 1QHXA 4NG5A 1C7IA 2PRKA 3S0JA 2I3GA 3L4JA 3VR0A 4RLQA 5IDWA 2ZVDA 4GG1A 3PIDA 4HADA 3HZHA 2O06A 1ZD5A 2AYZA 2A1TS 3I6IA 1RPZA 2G88A 2PLAA 5B4TA 4EAQA 4OU4A 2EP5A 3SKVA 1BQEA 1D09A 1QYVA 3ZY2A 1QGDA 3UNXA 4I9NA 1E59A 3EZNA 3VJLA 1MX1A 4J6EA 3USCS 3HM9A 1ZO8A 3OZEA 4B43A 4YQYA 1HG0A 4G1MB 2X5JO 4UU0A 1H94A 5A3JA 2O1XA 2WHYA 3TBHA 4C7KA 1HFWA 5BR7A 3NDRA 4FCWA 2PJDA 2Z1MA 4TUYA 1KH3A 3AEYA 2JVIA 4Q1VA 4BZXA 5FA8A 2CMKA 4YCAA 5BQFA 3C1AA 5T6MA 1QORA 5EIXA 3I72A 3QIVA 4IZOA 5HF8A 2OEPA 3P20A 1ZNZA 1ZH2A 3D0RA 3SC6A 3VMMA 4PG8A 5CCEA 2ZYIA 2QRMA 1AA9A 1U8YA 2IZ1A 2JH9A 2X13A 3KAQA 2XJ9A 3NHUA 4HPWA 1TCUA 3FUUA 3JYPA 4MV0A 5DISB 3VNRA 3JTMA 1YE3A 2VDWB 1L3BA 3LPLA 1WXHA 4ZU6X 4Q82A 3OUUA 5FBLB 3CH4B 2QUJA 4C4TA 1HXHA 1HYGA 2XUOA 1SVIA 2D1TA 2HFKA 2ZYDA 3UAYA 3VISA 2BLLA 4ZRDA 4HLUA 2RIPA 4C7MA 2FPMA 2HAEA 4HH3C 4QHYA 1E2IA 1KSFX 1RWBA 4DYHA 2GLTA 3RVJA 5TPWB 3GJ7A 3U7RA 2VF5X 2RGDA 3AR6A 3EWAA 2BH2A 1RRVA 1XTSA 1UJ5A 4HY3A 2Q5FA 2CV0A 4EPWA 1AZLA 1N2XA 3PGA1 2H1WA 4XKJA 5LQNA 1V8BA 3OLCX 3HCDA 3RSQA 3N0WA 3PNQA 2AR7A 2VNHA 4A7PA 5BW5A 4NZZA 3JQQA 2O2EA 1WHSB 4JT8A 1ZIXA 2A4MA 2HH9A 3ABSB 4HC4A 4NBNA 1XYGA 3CF2A 4JI0B 1HPLA 1SR8A 4KREA 2BI7A 3K0KA 3S70A 1W36B 5DTRA 1KP3A 1OBFO 4LJ8A 1YA8A 4PO9A 5BUZA 1MEJA 2KX7A 4IIJF 3ZUGA 1XZCA 1QU2A 1N75A 3C3PA 1H9BA 5JBQA 1G3UA 1TC1A 3BFKA 3N75A 4RIIA 5EMHA 3RVMA 3UV3A 4WGFA 2AI2A 2DCUA 3OE7D 3SAJA 4B17A 1H2BA 4E09A 2Z0MA 4P3KA 4DIKA 5IZ4A 1YZUA 4JBXA 1I13A 3P5BA 1NF2A 3ZWNA 1OH8A 3ANTA 4MS3A 4YY3B 1EVEA 1CULC 2DECA 1C3JA 1PZXA 2HEGA 1DRKA 2R4TA 2VK2A 1QGOA 3BB4A 2I76A 2OO5C 4HQOA 4MKZA 4QPJC 5EWMA 5C0OE 2W70A 1GLVA 4QHSA 5GP1A 4ACBA 1ID8A 4IDNA 3HYCA 1U6JA 1YRHA 5FHQA 3SIPA 2IUYA 2J9RA 3HCAA 2ZK7A 2V59A 3JY6A 4EKNB 4G25A 4TOIA 4XYBA 3VV3A 3DPIA 1JZTA 2C8KA 4NFLA 1N3BA 1V7CA 2ZGVA 4IVNA 2C04A 2QMHA 3KQTA 4TTTS 3WJ1A 4RTSA 5IKEA 5FNVB 4FB5A 4RFSA 4X3CA 3PU6A 4EYGA 5FPKA 3VNUA 3IOMA 2P6OA 5AVRA 1AHPA 3NATA 5J5CA 4DDMA 1XP8A 4D8YA 3AM1A 3PNMA 3O3MB 4RD0A 1JEQB 1YDWA 4YCDA 1G7RA 2XMGA 4CG0A 2PUWA 5F7OA 1VIVA 2JAPA 2ZIXA 1KZGB 1W75A 1RFGE 3MJHA 4WNAB 3WYGA 4BTEA 4ZALA 4CN8A 4EI2A 4JOQA 4KX5A 4QUJA 3QBVA 1P4JA 4Z4GA 4MO2A 1T2AA 1NBHA 3GNQA 3U7IA 2H5IA 5KNCD 2PDAA 2BY4A 5LQAA 2IP4A 4DUGD 4U4AA 2QTNA 2IHTA 3SS7X 3WLRA 3H2IA 4JYCA 1PGJA 5HUHA 4NECA 1G8KA 1UPCA 4DLNA 5FT9A 4I1IA 3SQOA 4DT1B 1V4NA 3ELYA 3TLJA 1Z17A 1VLVA 2HA6A 2O2HA 4LDPA 4RIEA 1YR8A 1ZMOA 3IUEA 3MFYA 4MVJM 2C7QA 4D9CA 2ECQA 2GD6A 2JANA 1KSHA 2WDZA 1WQ1R 4RADA 3ACDA 1Q1ZA 3D6AA 2PRYA 1ZEJA 5K01A 2SCUA 4I2VA 4M22A 1GQQA 1HWYA 2WVJA 4BO4A 4C87A 1E9EA 2VPQA 3IMCA 4PFKA 5LDDC 2LCFA 3OZBA 2AJ8A 1MQAA 5DHUA 1TECE 3GUVA 1B74A 1DC8A 2BDEA 4IIXA 4NG4A 1V47A 2FWMX 3W8NA 3RUDA 2NM0A 4BC0A 3HSKA 5FIUA 1RYEA 4BV3A 1TO6A 1KDYA 2J45A 5GZ1A 1N2CB 2O3TA 1VG0B 1WDLA 3E9MA 3DZIA 4O4IB 4ZQIA 3BD9A 1FYVA 3OO1A 3FYTA 3PUXA 4LYHA 2PNFA 4XPIB 4KAJA 4Q34A 5TRTA 3T06B 4EITA 5IKMA 1TQ8A 3AT1A 1G3MA 4G0MA 2VRWA 1T9CA 2D2IA 3VYRB 2HDHA 1TO1E 3G6KA 2FK8A 2WSIA 2P90A 2ZIWB 2YFHA 2QN7A 2IOYA 5T8KA 5B3AA 3LUFA 2CUNA 4EPTA 2DQYA 2KM1A 4BV2A 3OETA 4OAQA 1SRRA 1VIMA 2Y4OA 3G9TA 1Z4KA 3QVSA 1AN0A 3DTYA 4MS4A 4F21A 2VNAA 3L0IB 3E82A 3IO3A 3M0EA 5IF9A 1ND6A 2F62A 4JGGA 2P9YA 3FSGA 1FNSA 1KK2A 1XAGA 2XQGA 3CN7A 4Y6RA 2NU8A 1XTTA 4F5DA 5DBFA 3KSMA 2OCAA 3KLBA 4EHJA 4BVHA 5JXWA 2AKEA 2VUHB 2VXOA 4AS1A 4AYXA 1OB2A 2FZ5A 3WK9A 3DLAA 1M0SA 2P9FA 3BDVA 1PFKA 1GPMA 3QOYA 3BMCA 1K9SA 1EBFA 4G89A 5BORA 4YMTA 2ZRAA 3INNA 1FFWA 1MXHA 3ESZA 1I3KA 1LWNA 3K0FB 3CKMA 2J33A 2R48A 4Y98A 3RHSA 3VAAA 5JAUA 1QP4A 2CF6A 3QW2A 1NR5A 4PAMA 4KN9S 2BT4A 4BP1A 4D9IA 3RVQA 1L4FA 2CLFB 3OEYA 2AE1A 1P1RA 4MWDA 4QELA 1H8EA 1TCCA 3DZBA 2HU8A 4UDNA 4YT2A 1IU9A 4JP3A 4WA8A 4QSHA 1VZ2A 5JD6A 3W6OA 1PJ3A 1BJKA 1UFRA 4HDNB 4B35A 4BFUA 1NXXA 3KCQA 3IEKA 4TTPA 4M86A 4R1NA 5K3SA 3O03A 2I1WA 4DMUB 1VPLA 1WB5A 2XCUA 4TMKA 1P7PA 4BDTA 4YRLA 5JD5A 3ZOKA 3L8YA 5LLTA 4U6NA 2W93A 1FU4A 2Z4TA 3ENQA 4DM4A 5LQRA 4AQDA 1Q0TA 3WK8A 4JLOA 5I7RA 3VPSA 1P6UA 2V7TA 2ZAOA 1P80A 2PHZA 3G6WA 4G6ZA 2Y1GA 4Q1AA 1R0RE 4C7JA 3ONNA 3AF5A 3QWFA 4J2OA 4J0IA 1JHRA 2NYRA 1IXSB 3WYNA 4G0YA 3HA5A 3EEQA 5CCXA 1Z74A 1VPVA 5GZ6A 1L5YA 2EKDA 2JCGA 2FPUA 4YJHB 3ZWCA 1XMOB 5GJBA 3TR5A 3LWDA 2CLOB 2VJMA 4COOA 3MINA 1OZHA 2O50A 2BBOA 2PR2A 4H35A 4HEJA 4OHWA 3VPBA 2J3DA 3ZOZA 2ZIVB 1VBFA 4U9HS 1P2SA 1IB0A 4WZ6A 2XUZA 1WLSA 3AC0A 3O2NA 4O2LA 1OX5A 4UHHA 2Q46A 2HF2A 3GUCA 5EC8A 5G0TA 5HUJA 1T15A 3UMMA 3UK7A 4IP0A 3NX4A 1SXPA 4XB2A 1QIDA 4RSMA 1F0KA 3PGKA 4BMYA 1IK4A 5DLPA 3U9LA 3FWNA 3DC7A 5K7SA 2BZ0A 2G0NA 2OE2A 3INGA 3O8NA 3RKSA 1VHDA 3NHSA 3CLVA 1KZ1A 1U3WA 3ORSA 1PFUA 4JDPA 3UKJA 4E5SA 3SR3A 5KSOA 4RSRA 4OHYA 4KDFA 1HK7A 3LOUA 4FNMA 1K5GA 4UHFA 3I4LA 4WASA 3STXA 1AHHA 1BWQA 1XALA 1L3IA 3IMKA 2AXQA 1NTRA 3LRXA 1TKAA 5EY5B 2Q28A 3P9SA 1PS8A 1USVA 1XZKA 3ANYB 4HUQA 3A2NA 4M1TA 4U3JB 2Z8YM 3FSRA 4RXTA 2Q8PA 2NTJA 4L51A 4EG7A 1QE5A 1ACLA 2I1VB 1CERA 4PG4A 4UEWA 4BLRA 1UXJA 1GN9A 2PKQP 2VDLB 2YZ2A 3FMGA 3TLEA 4ALIA 2GD2A 3SHVA 4DQKA 4EI7A 4YRNA 4E6PA 4GLOA 1VE6A 3GDOA 4RMHA 2ENWA 3WIOA 1XPUA 2WVAA 4YPVA 2O23A 1XU9A 4JITA 4M6WB 3RJZA 5EVCA 1R88A 3RREA 1DJOA 3S28A 1C0KA 2FN3A 3CGGA 2BGTA 4DLAA 3CVWA 4QYIA 4JB2A 5C1BA 1SUFA 2CBXA 3B2EA 1QC5A 3MNFA 3OD5A 4ER7A 3LKDA 1GDDA 2NT3A 2XNCA 2YVAA 3IV6A 1D07A 1RPJA 2H2WA 4OK3A 5BYAA 2ID9A 1UADA 5JHHB 1U1GA 1T5LA 2ZDHA 5LCXA 4ALNA 2YZNA 2JLQA 1X8KA 4FYPA 4Y67A 4ZC8A 1P74A 4OKSA 3ENZA 1EFDN 4ZAFA 1RKQA 3JQ7A 2V7PA 4H4CA 3D6TB 1XBTA 5EL0A 4YV7A 2CNOA 3FMFA 3F7TA 3LP8A 3WQRA 5AQEA 4Q9JA 5CFLA 5JATA 4GEKA 1HYQA 4MUEA 3H42B 3EARA 3GLRA 2QTMA 3RNOA 5FA5A 3TLMA 2WJYA 3VSAA 3B1FA 1CJKC 2B4AA 2F3SA 1MAUA 4EKYA 4NCBA 2G9NA 4I55B 1JEDA 3RC7A 2WF8A 1WPGA 1BHO1 5NLLA 2ZYVX 5CYPA 2CXQA 2P9ZA 1CLUA 3C85A 5JMOA 1TM4E 5ER9A 4LJRA 4PHCA 1WNFA 2HXGA 3CV3A 4IDHA 2HIMA 3GNSA 4RH3A 5AHOA 2A57A 3GD5A 3ER8A 2R7NA 1G21B 4IV8A 3VU9A 2D54A 2MSNA 1DJMA 1QHNA 1XNHA 1M2KA 1II8B 2QVBA 3OZFA 5ALPA 5AM4A 5ICMA 4UAJA 4LRYA 1TIPA 2PZGA 3R5TA 3RSCA 1BCRB 1IWPB 2OILA 5A7FA 4A8PA 3PDCA 2P4QA 3KOOA 2DTXA 1JILA 1I4EB 3AV0B 3WJ7A 3I04A 2ANCA 2PJRA 2M6KA 1RLIA 1X92A 4HEA1 1ZMTA 3LUCA 1NQVA 3P9YA 3G2PA 2YJ4A 4JQCA 1CEQA 1FJXA 2WWFA 4BCBA 2H4ZA 1UIMA 4GOMD 4YIKA 3QKUA 1C30B 3ZK8A 4GZLA 2EEPA 3DE3X 3HY6A 3AEQA 1NOIA 2V7EA 3GLTA 3OJFA 4GVXA 4ZIRA 1YQEA 2QT0A 1U7ZA 3FVWA 3F4LA 3QFRA 5CDGA 1KDVA 5GIPE 4C76A 2VTDA 4U7PB 3C3XA 1T8RA 2DRIA 3GJSA 5IVIA 1FNBA 3BQNB 1M5RA 5FUXA 1L7DA 4BKUA 3NWEA 2JL1A 1QF9A 1GNTA 4NYJQ 1N6PA 3EJ6A 3MS2A 3O47A 1BCSA 4FZJA 3K31A 4U39A 3MMPA 1WO8A 3QBTA 3QPAA 3SBDA 3TRHA 3W5CA 3SQWA 1GSIA 4AT1A 2OFXA 4K9SA 4MA4A 3RKRA 4H3HB 3V1UA 4QTYA 4OA8A 3JATA 1FU8A 4NBTA 3WIVA 1E3TA 4ZYZA 2WOJA 3LFUA 3KSZO 3U40A 2WU0A 3UMGA 3ZVLA 1TT5B 2YS7A 3R5FA 5K6AC 3PHJA 3ZXXA 4C4YA 2Q1SA 4EMUA 2QX7A 5GMOA 2VZ9A 4INPA 4GPTA 1SBQA 4XOUA 3M5DA 5L3ZA 2OFFA 4CF4A 5ADHA 1CUUA 2F90A 3OA0A 3UJ6A 4OMUA 1V26A 1TLTA 3OPVA 3PX2A 4OXXA 1TL7C 2YHBA 4G63A 4MV6A 3NBUA 4HNAB 1NPDA 4Y1EA 5IRCD 3C6KA 1P5FA 4OHKA 1OLUA 3NJ8A 3WWCA 2ICAA 3ZNQA 2A1IA 1JLSA 4QDTA 4TLEA 4BFYA 3OQMA 3RSGA 3ODGA 1REQA 1J70A 2UZ0A 1DKQA 1GPH1 2XE4A 1E9VA 2H54A 4C0KA 2PRJA 3RE1A 2IYRA 3R3YA 4Q18A 3ZCSA 4GXNA 5SZHB 1BWPA 1S4QA 3GY0A 1XF9A 1J56A 1QU3A 4O2BA 4PVCA 4G0VA 4LV6A 5KIAA 5MF6A 3LFHA 2ZTUA 4A5SA 1Q22A 2JA2A 3LCCA 2O6LA 4XJXA 1N1EA 4N1AA 1TRKA 5CFOA 5AKJA 3M5WA 2VJPA 1XEWY 2VQDA 3I8OA 4LRUA 3A6HA 1DTWA 1F7VA 4NOKA 3T3OA 3DEJA 1COWD 2CSUA 3OQJA 4DUPA 1RWOA 3FOWA 2PO5A 3QLEA 3LK6A 2OAGA 1G20A 3GQVA 4G9EA 5DOZA 4YAFA 3ROEA 2K2WA 3RSLA 5AOVA 4AZ3A 4BN0A 4F84A 5HKKA 5KJEA 1J6UA 1J20A 2FPGA 3WNCA 1EE1A 2PTGA 1B0ZA 3MTIA 4K1XA 2J6HA 3TKAA 1GRRA 3E9CA 4D26A 1Z5VA 1JLLA 1I8TA 1ADGA 2AJTA 4LHZA 4JJZA 4YR9A 1MNAA 5ARBA 4PYJA 1NPYA 1UIRA 1ZUNA 9GPBA 4KNYA 1VLHA 1LPAB 3D4PA 3BB3A 5EI5A 3VI4B 3FYDA 3HGMA 2VTKA 2GJSA 2B4KA 3LLMA 1IPEA 1HT1E 1UDXA 1VHWA 3QTBA 3VNBA 4BVBA 3DF7A 4MITA 1TAQA 1IXRC 1GTG1 1BVHA 5GJVC 4BAZA 2R5WA 1O0SA 3EW7A 2OECA 3BC1A 1HNNA 2P1ZA 3O6VA 4URZR 5COQA 1UKVY 5HQ3B 4H1HA 2G1PA 3O84A 4AWBA 2DWCA 1UXGA 1P4SA 4KSCA 1ZI8A 1ZK2A 5JZBA 5DCUA 4FHGA 1TQ6A 1L5VA 3E2IA 4J0DA 3UJPA 1SB9A 4ER6A 4ZP1A 5EYPB 3SC2B 1CQWA 1H2AS 3UAVA 3O21A 5FOQA 4PZZA 3NYIA 4UNNA 3SDZA 2OAEA 2P77A 5F23A 4OATA 4GBED 3EY4A 1X1DA 2JJYA 3DMTC 2E0IA 1O77A 1ADFA 1ZFNA 1DMRA 4O6VA 4KXWA 1EWRA 1LF0A 2FE1A 1MVLA 3DLIA 1JJBA 2EYQA 4IS2A 1DV1A 1FQOA 2Z1DA 2OB1A 3W2GA 1RRGA 4W7IA 1SXJC 3G9ZA 2ZCUA 4RA6B 4E4TA 3A10A 4ZQCB 1ESCA 5FD8A 4NH0A 3DAGA 4AKGA 5CAEA 2IUFA 5EN4A 1ID1A 1LQ2A 3JYQA 1Z36A 4NU5A 3RANA 3C6BA 1O5OA 3VKVA 3RG2A 2F3PA 3R5XA 1NJ2A 1A27A 4B32A 1DT3A 3PCXA 4IICA 3IV7A 4F5WA 4J16A 3WSWA 1J2JA 1U9IA 3JWEA 3VBEA 1DAKA 2VIIA 5JU6A 1G59A 1OXTA 2C2GA 2PPLA 5C46F 2CDAA 4HFMA 3JALA 4ID3A 1D4OA 4BU0A 5ALQA 5H9WA 1L7MA 2VKTA 2PLFA 4NABA 3Q3GE 1IEQA 1A7UA 3GNTA 3K7EA 4F4CA 4JP8A 1D4FA 1N4DA 1Y5LA 3L7AA 3FAZA 3MRSA 3MJFA 3K35A 5B37A 3SICE 4CCYA 3X2EA 1G291 4FBMA 4R0MA 1UXKA 2GD1O 2GI4A 2ZRHA 5CA1F 2Z8YA 4K46A 3TMYA 4DR3B 1AT1A 1TU3A 1Q17A 1V95A 3OCXA 4WAUA 1GZ6A 4YXWA 1P7CA 4BEJA 5BV2P 3ZVKA 1C8VB 3PHGA 5K3FA 5FV4A 1H4QA 3I9KA 3QVXA 4NV3A 1MHTA 2OC4A 3HBMA 3PENA 3NWBA 4W8GA 1P18A 3M6AA 4C7XA 5ADWA 1XD9A 2ECKA 3HYLA 5BRAA 1N5IA 5DWQA 4JJFA 2BFCB 2QBYB 1QHGA 1E9RA 2Q6VA 4CF6A 1JHZA 1W52X 2QP3A 2QUIA 3CJRA 1PT9A 3EH1A 5I5GA 3TIVA 3SEQA 3TNLA