4LMAA

Crystal structure analysis of o-acetylserine sulfhydrylase cysk1 from microcystis aeruginosa 7806
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
318
structure length
318
Chain Sequence
MRIAHDVTELVGRTPLVQLNRIPQAEGCLGRIVMKLEGMNPAASVKDRIGTHMINSAEKAGLINPETTVLVEPTSGNTGIALAMTAAAKGYRLILTMPETMSLERRAMLKAYGATLELTPGSQGMKGAILRAQQIVDSIPGAYMLQQFRNPSNPEIHRLTTAEEIWQDTEGQVDFIVAGVGTGGTITGVAEVIKSRKPSFQVVAVEPFNSPVISGGNPGPHKIQGIGAGFIPEVLRTDLIDEVITVSDEEAFQFGRRLAKEEGLLSGISSGANLCAAIQLAQRPENEGKLIVVIQPSFGERYLSTLMFQNIEERELTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Structural and biochemical analyses of Microcystis aeruginosa O-acetylserine sulfhydrylases reveal a negative feedback regulation of cysteine biosynthesis.
pubmed doi rcsb
source organism Microcystis aeruginosa
molecule tags Transferase
total genus 123
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lmaA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lmaA02
4D96A 4NU8X 5I7WA 2Q3CA 4IL5A 5DVZA 4XUGB 1X1QA 2J9XB 5J5VA 3VSDA 4L27A 5I7RA 5D86A 5B1IA 4COOA 5I7HA 3AEXA 3HMKA 2D1FA 3SPXA 1M54A 3BM5A 3R0ZA 4ZQCB 3T4PA 4D8UA 4PCUA 3AEYA 2PQMA 3VSCA 4LI3X 1VE1A 2C2GA 1UBSB 1KFBB 2GN2A 3IQGX 4ZU6X 4D92A 4D9BA 4QYSA 2CLOB 1K7FB 5D84A 1A5BB 1UINA 4KKXB 5B3AA 4HPXB 4JBNA 5KZMB 4L0DA 2O2JA 1VE5A 3PC4A 5B1HA 4L28A 1CW2B 4D97A 1TZKA 3DKIA 3TBHA 5I6DA 2DH6A 1J0EA 1P5JA 2Q3BA 5KINB 3PC2A 3DWGA 4I1YA 2CLIB 3V7NA 1PWHA 5B55A 4HN4B 5DBEX 2DH5A 4LMAA 2ZR8A 1TTQB 2O2EA 3VC3A 1KFCB 4LMBA 1UIMA 3PR2B 2ISQA 4HPJB 1RQXA 2J9YB 4D8WA 1K8ZB 1K3UB 1A5AB 1Z7YA 5IW8A 1KFJB 3IQIX 2Q3DA 4HT3B 1BKSB 3DWIA 5D87A 1TJPB 2JC3A 3ZEIA 2J9ZB 2EFYA 1K7XB 4NEGA 3X44A 4D9MA 4Y6GB 5CGQB 3R0XA 2CLKB 2ECOA 5IXJA 5DW0A 1TYZA 5B36A 1TZJA 5B53A 1F2DA 4AIRA 5JISA 2C2BA 1WBJB 1KL7A 1C9DB 3X43A 3L6CA 1E5XA 1JBQA 4L3VA 5DW3A 4D9EA 4WX2B 5EY5B 5I7AA 2TYSB 2CLFB 1TZMA 2RKBA 2GN0A 3FGPA 3VSAA 2EGUA 1Z7WA 1KFKB 3CEPB 1K8XB 5J43A 1TTPB 1V7CA 2BHSA 1WDWB 1J0DA 1C8VB 1D6SA 2ECQA 1A5SB 1FUYB 4JBLA 2ZPUA 4OFXA 1CX9B 1QOPB 2CLEB 5C3UA 5JJCA 5BW6B 3SS7X 3FCAA 3RR2A 4OREX 4D9KA 5I7OA 2GN1A 4D9IA 1V8ZA 2V03A 4D9FA 1O58A 1PWEA 1WTCA 2CLHB 1K8YB 1J0CA 2CLLB 4HO1X 5T6MA 3L6BA 2TSYB 4ZU1X 2TRSB 2ZSJA 4D99A 1TZ2A 1K7EB 4F4FA 1J0AA 1J0BA 1C29B 2RH9B 5HBGA 4AECA 3SS9X 4D9GA 4D9CA 2RHGB 1TDJA 2CLMB 5E0KB 2WSYB 3IQHX 4H27A 3IAUA 3L6RA 3VBEA 1Y7LA 3PC3A 5D85A 1WKVA 5DBHX 1BEUB 1KFEB 1V71A 2BHTA 1A50B 5CVCA 5IWCA 4D8TA 1VB3A 1FCJA 4D9NA 1QOQB 1OASA
chains in the Genus database with same CATH superfamily
2YJTD 1W93A 3ZWPA 3IE1A 4DMMA 3RRXA 3L40A 5EKUA 2O8NA 3NHKA 3HRHA 4ARUA 2GYYA 4IGKA 1QGUA 1AQNA 1THTA 4W99A 2R1VA 1EXVA 3KQHA 2EWVA 1RQ7A 1LQ2A 1OLUB 1YBVA 4UXJA 4U6QA 2BE7A 2ZRLA 5KOHB 1PFYA 3DS8A 4G01B 3PU6A 3RG2A 2DWQA 2ZYDA 3IUSA 4MAFA 2FSSA 1UAGA 1N0VC 4LXQA 5KTTA 1C9NA 4WHMA 3BGSA 1S2LA 2FFHA 3LQ1A 4V0QA 1E0KA 4C2BA 3TFOA 3H2JA 2X4LA 1VMEA 3PB3A 1UJ2A 5LOVF 5T4HA 1ZKDA 1Y6FA 4BGDA 3EG5A 1P6QA 3CR7A 3AP1A 1SUBA 2G5GX 1B8VA 3K9QO 3K53A 1S8AA 1SU4A 4BEBA 2H2DA 4ZGBA 4QAJA 4X90A 4G24A 4B5LA 4CMHA 3QLTA 1F2TA 3IKVA 2VEDA 1NLYA 1ZM7A 3HCEA 3IDFA 4P4SB 5JY1A 5KNBH 4NDAA 1PWHA 1X3LA 3K6SB 2O8EA 4FHFA 4H15A 4GEKA 4YX9A 3N2EA 1R0YA 3Q3VA 4M0LA 2HL6A 2BFCA 3AHEA 4P5DA 4M55A 1EXNA 1ZGJA 3IKMB 4M86A 4KLCA 4XA8A 3RWOA 3RSCA 4E0BA 3MF4A 5BR4A 1Y4DE 2XMPA 3M8KA 4KO3S 2Q2NA 4LC1A 1MOPA 1JHOA 3AF6A 2Q3MA 2VK4A 3AJDA 3C39A 3PFGA 2ZI6A 4KXUA 4QDXA 4XAQA 1UP7A 3I73A 2JC3A 5I47A 3FHLA 5TJ9A 1KWKA 4E6EA 4LKRA 3W4JA 2C4WA 1V4NA 4JS0A 3G6KA 4JJ8A 1PR4A 5IBRA 3DEKA 3VH3A 2MSEB 3LC1O 2Q2OA 2AF4C 5JXGA 5EXEA 4GX0A 4QG3A 3OD1A 1DZIA 1L5HA 2B5WA 1W47A 3D3WA 2JDID 3G7UA 2V8OA 2GO1A 3SN6A 2H9YA 1TZMA 4MLZA 4EJFA 3SKYA 3E35A 4I9UA 4ZN6A 1EP3B 1ZZGA 3A36A 3KZCA 4QBHA 3GT0A 3DFMA 2B98A 4EG3A 1JJVA 2GO7A 2HA4A 3ZCPA 2RK6A 3LBYA 3SSAA 3WKEA 1WDTA 1I4TD 3D8HA 3DTVA 2ZWAA 2IEIA 1T5DX 1JR3A 3ZDZB 1ODSA 2WM8A 2PKCA 2XXBA 3CW2A 3O4FA 5K0EA 1M9NA 3NHBA 3IJPA 2WDZA 3UF0A 2WWYA 5IKEA 2HIGA 1XMJA 3DEZA 5CVJA 1EINA 1QTNA 5EFZA 1FMCA 1Z34A 4FJ0A 4M1QA 4ME6A 5L4NA 1EGHA 1TJNA 3JVDA 1BEEA 2ANCA 3P19A 5F21A 3CX7A 1A9XA 2L2QA 3KYCB 4OG2A 4IXWA 3JS5A 2PS3A 2VQ3A 2HT1A 3D7LA 4GI3A 1RAFA 2AJ8A 3GH1A 4RZSA 1Y6GA 1G6HA 2VBGA 4NMMA 3IULA 4M8NE 3WKCA 4X61A 2UZ1B 2F8SA 3X1MA 3RRJA 4MTLA 4JUFA 3UJ8A 2LXNA 4G1CA 2CWWA 3ODPA 2R5FA 2D3WA 4Q6WA 1MF7A 4UU8A 3R24A 1DC7A 3PDHA 1YBHA 4MR9A 4GUDA 1SKMA 2FMIA 421PA 3HB5X 1Q7TA 3IEIA 2MMGA 3JATB 3S55A 5AHRA 3W6ZA 1B15A 4KLRA 5T3UA 2CJWA 3R7DA 3CX6A 5HF9A 4DWVA 4HNUA 4Y30A 1E3DA 4OXYA 4HD8A 1PLKA 3HNPA 4F46A 1NZJA 2H16A 3AI2A 3IH5A 5EYPB 4YQEA 1F8XA 3ENVA 3OCJA 1YZKA 1PFGA 5KWSA 3PA8A 4LJ5A 3E3MA 5DYTA 3ICCA 3TOZA 1Q44A 3PR3A 4EF4A 2VYND 1JQDA 3L92A 1DX9A 1NVGA 1PHPA 3CJQA 4L4YA 3C3WA 4UBNA 2I6XA 2VC2B 2V7BA 1ECFA 1QG2A 2ZXEA 3F6YA 5F9HA 5KYGA 1EFUA 4RTPA 3MRSA 2VCHA 2XSZA 3TLKA 5DHUA 5DO9A 3W5CA 3ACBA 4OD0A 4DLLA 4RVUA 5L3ZA 2QMQA 2BF4A 1E1CA 3BZBA 4X41A 3FHOA 3TPCA 1UPTA 3TQQA 1D1TA 1BXRB 2W58A 4KQIA 2DPHA 5JOQA 3QE2A 1P18A 2XA1A 3FD8A 5F64A 3TL6A 2JFWA 5DGTA 1DIAA 4L8VA 4ANFA 1KR5A 3TW4A 1ZD8A 3CW8X 5JJLA 1EGAA 4H7HA 2FTKE 3EE6A 4QECA 4Z4CA 3KDSE 4AUKA 1EFAA 3Q9UA 2AKAB 2PZ8A 3ER8A 3MMZA 3QPCA 4CMCA 4EQ6B 3CUWA 2YMPA 4G1VA 4RENA 1XFAA 3IJRA 1KJNA 4XUEA 3GBPA 3KEQA 1TQHA 1H2FA 3CZ4A 2P79A 3GNSA 3MGCA 2O20A 1EI9A 2ZDHA 3I1YA 3O8OB 4LMPA 4OKSA 5J63A 3ZZTA 4AICA 4EITA 5AK0A 1ISPA 3ZI7A 3KZMA 1U4NA 5DP1A 2B92A 2HDOA 4E70A 1CTQA 1GO2A 1K7YA 4WBXC 2HF7A 2JH9A 1TYZA 1TJYA 2QP3A 3KHKA 3LPLA 4YLYA 1DKLA 3K6RA 2I78A 1K5HA 4XIGS 5HBRA 3FCOA 1I1QB 1SVSA 2OV8A 3VDRA 3OJOA 4EKNB 2RH5A 2VJBA 3BL5A 1N2ZA 3E61A 3KFLA 4YR9A 2ZSFA 2LWIA 3A37A 5EXSA 4A82A 5IUJC 1C8LA 1U5BB 5KVQA 3KAPA 1IHXA 2OKGA 3RT9A 3KEFA 4X64B 1T1EA 4UHDA 2Z5LA 1UJ6A 4ZO6A 4DABA 3E8MA 2OECA 4BE7B 1I7QB 4L5CA 1ZD5A 3OX1A 1U3UA 3LOQA 5LFAA 3D6FA 5BW6B 1DTEA 4WJLA 3GLFA 4ZQHA 1E7WA 4CI0B 3U5ZB 1NU6A 5ALHA 1I2BA 2RH8A 2BKLA 3L8YA 4GWKA 5T67A 1NQOA 1JXQA 1X8KA 3OLXA 3IBFA 4MAAA 1NBMA 3D4OA 1DCMA 4LFAB 3I04A 1KMMA 1W2WB 1UMDA 3NIGB 2C5GA 1XRRA 2PRZA 1JYFA 5F12A 4P22A 2A8YA 1CIPA 4IVPA 3ELDA 4BFSA 1W96A 2PZBA 5FL7A 2VLBA 4RHFA 2HWUA 3DOUA 4TN1A 1TU0A 4BV3A 3T3MB 3ZE7A 5EKDA 3DEYX 3R2JA 1MB2A 5JZVA 3KTOA 3A9TA 2BW0A 3LUGA 3WGTA 5AT1A 3TH5A 1NRXA 4TWZA 2O8FB 1EAMA 2Q4TA 2YXBA 3OZAA 3Q0EA 3AESA 3A6PC 1ZITA 3TIFA 2UYYA 2RI0A 1JA1A 2Q4OA 2QRLA 3X3HA 3MCVA 4AROA 2VHVA 3L0CA 3PHLA 5KVVA 4LHXA 3VNBA 4J9VA 4WY8A 2OZKA 5CITA 3IUQA 5BW5A 1QAOA 4D8UA 4D9BA 1M54A 5ABPA 4FJ1A 2Q6KA 1WW3A 4O4HB 3RFVA 1P72A 3PJRA 1CE8B 3KDAA 1UT8A 1DMRA 2NU9A 2Q7OE 4URYR 4CQMA 2FW9A 2VKTA 3KOXA 4HPXB 5CW2A 1VJTA 3DO8A 4Q9DA 3ZLVA 2VHWA 5SYAA 3PLAE 1RBQA 1YE3A 1TW2A 1AB5A 4DILA 1NMQA 3BVPA 1QU3A 4WESB 3DVSX 3Q7IA 1GTMA 2WJGA 3IQFA 4PPGA 1NZDA 1PR3A 1MHTA 4CEIA 4C2TA 3WZMA 5BVGA 5EEGA 2WLSA 1GR1A 1K68A 1I0ZA 3NEAA 4M37A 4XASA 2JLYA 5B37A 2WTNA 4X3OA 5I3ZA 4MMZB 4HN4B 3EPHA 3QUCA 1J25A 3L1KA 2B9VA 4UQOA 5AW2A 2QMZA 2JVIA 3C5WP 3IMKA 3ZDQA 2SECE 4KXYA 4C0XA 3QPUA 4NIMA 3HACA 4CM4B 1ULSA 4KBFA 1D6NA 4IIXA 3I72A 2BT4A 4MCAA 5HF6A 3UAWA 2CFOA 1U81A 4EDHA 3DBLB 1ZRNA 1QR6A 4WK6A 3ZHQA 2PT5A 3O2JA 3ESBA 4FKMA 4Q82A 3RSQA 3H2IA 2YZ2A 4LJAA 4MX8A 4PCVA 3EPLA 3SQXA 1FK8A 2BGLA 3WNDA 2ZYTX 4NV0A 5FNVA 4EB6A 1ZJ6A 4WN9A 3SMVA 3TSYA 1RBYA 4NE9A 4KRGA 4Q93A 2P9QA 2X4IA 1C3JA 3S40A 3V7WA 4EEZA 4I1OA 5JBIA 1S0UA 3DMTA 2C4KA 2QX8A 3O3NB 3BWYA 3ROKA 3GLIE 3FFXA 4CTKA 3ICEA 2PLAA 1JFTA 1EA7A 1VLMA 1Z7GA 4QHYA 4BVAA 3OZSA 3IXQA 1RPTA 3EBLA 4KQKA 4F9GA 5J43A 3AR7A 3GWZA 5JALA 2PANA 2H1SA 4PBSA 2AD5A 3QELA 2P5UA 2X0KA 3EBOA 3CZ5A 3PRKE 3T9BA 3I1JA 2CW5A 2ZT7A 3A3PA 1YS9A 1S5PA 5AW9A 1PEDA 3VR6H 5CFZA 4AJJA 4AMBA 4PZAA 5EJ5A 5BWBA 1KRHA 5DWQA 4OI1A 1QCDA 4DLNA 5HFAA 2J48A 3RFUA 3C4QA 2IZ1A 1VMDA 4EJSA 1FP4B 1MFZA 2OM2A 3OQPA 4DLKA 5IVPA 1H4TA 1LC3A 2BM0A 2FOIA 2J9RA 4QVKA 3FCYA 4F6RB 3O4VA 1TGVA 2WAYA 4JEIA 1VSUA 1RRGA 3Q2IA 5G02A 2NUPB 4UDXX 1OFVA 2QI9C 2W2VA 1VCNA 3UJNA 1BO6A 1ML4A 2ZRQA 3FNHA 5BSVA 1PYOA 1C3LA 4PSCA 3LO5A 3QV1A 3EVFA 1P61B 3EXFB 1QHYA 3BOSA 3BDIA 4EG1A 5KJCA 1IOWA 2PUCA 3TECE 121PA 2VZEA 1DQZA 1TCUA 2YIDA 1DELA 2BELA 1HFEL 2DPMA 4TV8B 3H9CA 1KQGA 1OAOA 1K5DA 3KQNA 3OX4A 1E6CA 1MQ8B 3WGLA 2JFUA 3T7KA 3HRKA 3S6JA 3LXRA 1TGYA 3V8NA 1U0EA 2JFPA 3I23A 3R3SA 3TSCA 4F8EA 3F5MA 2CEKA 3WJ2A 3BKWA 4EPYA 2WM2A 1MJHA 2G6TA 4IIVA 3V4VB 4NRDA 4IDDA 2ZZKA 1U8FO 4ND7A 3DLPX 4PYOA 3L2OB 4D3YA 3UXYA 2FV8A 3N2LA 1I6WA 1EIZA 3BRWD 3JASA 4TSFD 3GOHA 4TT3A 4MVCA 3EZLA 2FWNA 2X41A 1SA0A 4RE5A 1RXYA 2Q3BA 3RU3A 2DGDA 3H1FA 4FS3A 1P4AA 1O8BA 3RU2A 2R11A 5KYWA 1C7RA 1W19A 1XFDA 2MSLA 3MLAA 4MIOA 5A6VA 3QF4B 3OUUA 3GQVA 1V9LA 3PS9A 4MO9A 2AHOA 3EZFA 1OXXK 4FCCA 3TG8A 5F2EA 1S1CA 4G09A 1XF9A 1I7NA 4YUXA 3GRVA 4ZT4A 2B6NA 2BZ1A 2X42A 3A32A 3W5AA 1GG9A 1MAWA 2YVKA 1U9IC 1VRWA 1O94D 4JDPA 3ZGOA 2PUFA 4QICA 5ES4B 1N8TA 1PJTA 4COKA 1PL0A 1S3IA 4FGZA 4MUIA 5KHAA 5H4GA 1XPRA 9ABPA 1M7BA 2FX2A 2WF7A 4U8GA 3FSRA 4J1TC 3ZE6A 4IDHA 1GZSA 3MWJA 1JLKA 3C1UA 2B4KA 4GL2A 4L9SA 1OTHA 3H5RA 4P4TA 4WFJA 5IH3A 4U9IS 1V48A 1E89A 2VNKA 1JLRA 3H5VA 4CUKA 2JGIA 5TLSA 2DETA 1GCOA 1JR3E 5KKNB 2UYHA 1JHUA 1JAIA 2O1XA 3W5SA 1NFQA 1C4OA 1OC2A 2BD0A 3E1KA 4FWIB 5GMOA 3D4IA 3TM4A 3FGPA 4ZD6A 1ZM9A 3VSAA 4BKQA 4BMZA 1UCFA 2BTOA 1KAEA 3IBCA 1AY0A 3QY9A 5G1OA 4XVCA 4PS0A 1K98A 1OV4A 1P2GA 5GOZA 1AUXA 2FUCA 1DWUA 4AZVA 4M9XA 4AMYA 2PS1A 4ZCTA 1PEAA 1L7BA 4BYGA 2VSXA 3WLPA 4F5WA 3A4IA 4FONA 1ZI6A 5KKCA 2DUUA 5CR9A 3SC2A 4NVRA 1LW6E 2FK8A 2IDMA 3K94A 1CZKA 4TSKA 4J3NA 3JQ7A 1NI3A 1AGRA 1RMQA 3PDJA 4XB6B 5FNZA 2V5AA 1CRLA 2QYTA 4FOPA 5DNAA 3T06B 5F3RA 3OESA 4EWLA 5EJ6A 5HHTA 4B46A 4X1KB 1C0LA 2YOFA 4HLNA 1KAHA 2GWRA 3CGWA 1K7EB 2WT9A 3OY2A 3RSFA 2VTBA 3RU9A 4MVJG 3TXXA 1M2VA 4P3OA 1PV2A 1IM8A 1SIUA 4NV3A 4PFJA 5FIUA 1RQNA 4FILA 4GPD1 1XYGA 2ZCJA 1PFVA 4CF3A 2C42A 2ZI4A 4P33A 4R8LA 2WZCA 3PC3A 1GG2A 4MVJA 5BWNA 1BA2A 1ZK4A 1EE1A 4YP7A 4C5BA 1IN8A 1GKYA 2Z2YA 5EP1A 1OASA 1G7CA 3GRPA 3LT0A 1Q3KA 2B0JA 3RRMA 4CKCB 5CDHA 4L78A 1QP4A 5ALYA 4H0NA 4CW7A 3A2LA 4BUCA 4KFUA 2EQ5A 4M38A 5AVVA 5DHPA 1MJGM 2X76A 2GLXA 2OSVA 3JD3A 4W5NA 2JZCA 1MB4A 1CEXA 2ZDGA 3TZEA 2DQSA 4NPCA 3ZDRA 2XXAA 3U09A 1TUBA 3AJEA 5KJ1A 3D7MA 4OOEA 3CVVA 5M3BA 4B6QA 3PXBA 4D4GA 3DEFA 1UXGA 2UAGA 4RGQA 5DTRA 1Y6ZA 3PPVA 3HVIA 4ENPA 1YQEA 3N5KA 3TSOA 4A6EA 4DTCA 1QQ7A 3ZUPA 2E49A 3KYBA 4ZYXA 2QVXX 3C7DB 3JY6A 5KU7A 3RVBA 1YFLA 4Z7JA 1R9MA 1UJBA 2Y76A 4KWTA 3WIEA 1P80A 1JG7A 1GLGA 4ZV7A 2G1JA 1QG6A 3H99A 1ZRSA 3K0CA 4AMGA 4DNFA 2W2TA 3UH0A 1AN0A 1WW8A 1H6BA 1WUKS 4HQNA 4S0XA 3AF5A 5DX1A 5FTNA 1UXOA 1G20B 3AVOA 3GRRA 2G06A 3RGGA 2GXAA 5U4XA 3EIWA 4DR1B 3EJWA 2QVBA 2JLSA 3NI2A 3HR8A 3KPJA 5EIBD 1L2TA 3OJEA 4EUKA 2DKNA 5HTOA 3Q5GA 3F71A 4OQYA 1COWA 1GQSA 1YB6A 3HH8A 1EVJA 2I3BA 3LYAA 2XTAA 1P0QA 3WHIA 1BYUA 1UBEA 4P93A 1RJWA 5BYAA 3WSWA 1TJ3A 2ORIA 3MOGA 3ROXA 4IEEA 3AR6A 3QOXA 3DHYA 5JRJA 3ZZNA 1L5SA 2IHYA 1TTTA 5ADHA 1D2GA 1JHAA 1IHUA 2A9JA 3JAWB 2D1YA 2I7CA 4BASA 1ID8A 3LVBA 2C4HA 1UANA 3DVQX 1D8TA 4IDQA 2D7JA 1YS6A 4RANA 1LLQA 1N5LA 2R00A 3R5XA 4I4TB 2QB5A 1KMQA 1XDDA 1VYHA 2R3SA 5AYVA 1GLVA 3VOTA 3PQ5A 3BQMB 3QWFA 2PPLA 1V6SA 4HYQA 3LT5A 4H31A 4XR9A 3RUIA 3UHJA 1JKFA 4JYCA 5B36A 3I4LA 1CYEA 4XM2A 3GP5A 4LF4B 3CEJA 3QOFA 3T5MA 2JGKA 1SU7A 3NWEA 2J33A 4YB8A 1NVXQ 4CNBA 2ZVQX 4E51A 5ICMA 3B5JA 3T7SA 1EFPA 1F4PA 1NVAA 1VLQA 1X1TA 2QMHA 4I0WB 1N1DA 3P9QA 3M7IA 4YJHB 3G0BA 4GR4A 3CE6A 3C15C 3CF6R 5IP5A 3OCYA 4RWEA 4B45A 2PCLA 3LK7A 2QN1A 1JLSA 3QXCA 5IYZF 3K1YA 5DRTA 2YUIA 2HSJA 2VF2A 2SNIE 1WNFA 1YU6A 3GCDA 4FYVA 4LZJA 4GBGA 3ENNA 4HAVA 2FW7A 2XZDA 1Y82A 1KI8A 2VH5R 2OD2A 3ENQA 5ENDA 5CA0A 2X3YA 4EG6A 3QE9Y 1E9VA 3NDPA 2J3EA 3BGVA 4OK5A 2VBIA 1IULA 4QGBA 4EQZA 3CZ9A 1E4VA 3IE0A 4ZU1X 3ZHTA 1HH4A 2Z4SA 2P1DA 2WPDA 3GPIA 3HK2A 5AI6A 1KRWA 1YQUA 2ZRHA 3CZCA 2HMVA 3O8NA 4MCIA 4RFSB 2PUBA 4R1QA 1XHEA 3NUGA 1KNXA 4ZYLA 1XL1A 2JJ1A 1P3JA 3FYUC 2ADOA 3M83A 4EA7A 4OYYA 1YZQA 4OATA 1CHDA 1AN9A 2NTVA 2Y0BA 1EX6A 3AY0A 3FNFA 5GZ6A 3TNDA 1R4NB 2ZWPA 2GBLC 4ITUA 1P1HA 2DU8A 4WOKA 3STXA 3GFSA 3KBOA 3JAKB 3RT1A 3GNTA 4J49A 4BB6A 2BGGA 3SFZA 2NYAA 3TLZA 2OMKA 2YXNA 4R8MA 3HA5A 1ZD4A 3IDQA 4FFDA 1LFDB 4RZIA 4U8HA 3R6GA 4JODA 5L3RA 3G68A 5DF1A 1LEHA 4O2RA 3DWFA 3VYTB 4U02A 5E9QA 3K6JA 2YYSA 3KJXA 1RZRD 2Y27A 1GCAA 1INLA 3I9V6 1XMVA 3STYA 4MRVA 4R71A 5BNIA 5LP1A 1Q95A 5JROA 3A1CA 3CCBA 4A2CA 4S3MA 2ODPA 4XIIA 4ZMBA 4F84A 4N8EA 2IHVA 1KQNA 1UINA 2B1JA 1QIIA 3D6AA 3EVDA 5TVGA 1R37A 3LVRE 5HUHA 3S7ZA 1TADA 3TEJA 3KQSA 4IR7A 3WGMA 1GPJA 5J58A 3EEYA 3K9CA 2JIBA 3R3VA 4YRTA 2JVJA 3BWBA 1Q1GA 1SXGA 3Q8XB 4YGYA 3QQ5A 4UHJA 2FE1A 1LX7A 4D6PA 4MHOA 3L7IA 5IM4A 2I2XB 2FUG6 1CY1A 3T7IA 2NAPA 1PO7A 4EB0A 4I3FA 2JGMA 2QJRA 5AI0A 2QJWA 5DTIA 2JLRA 3GEPA 1Q14A 1J9GA 3VC1A 5IG2A 4AWXA 1PLLA 2A6PA 9GPBA 4B74A 3D7RA 2ZG6A 2ZJ5A 2I1WA 2NZJA 4ZCQA 4HZUB 3IODA 1CUEA 2P2SA 3DUFB 4E4TA 1O97C 4LA4A 2Z2ZA 3OQBA 1BYIA 5AHKA 5LQKA 2EG5A 4C0BA 5MN5A 4X1YA 2R47A 4E5MA 3T4EA 2NU8B 4J4BA 1WTAA 3LRPA 1QYCA 4G8CA 2V55B 2BM9A 2KSQA 3SAJA 4BVEA 4AAYA 1JT9A 3H13A 3OLVA 3TVTA 1AVTA 2EFYA 3K1AA 1IY8A 1QQ6A 3R0XA 2Q3LA 3IDAA 2NVUB 3I12A 4E32A 3GLSA 1IJKA 4YJ3F 4D9JA 1US8B 4HDAA 4A16A 5ITZB 2AW5A 2VYCA 2WHYA 3O7WA 4XJTA 1UZNA 4H6PA 2QTCA 2XADA 4ZVVA 1FLDA 2GTPA 5TDHA 1NUAA 4GP7A 1BHJA 5DI3A 1Z4OA 3CNEA 3DYIA 4AY4A 4EBFA 1EFHA 1XJCA 2HDHA 1BRTA 5G2OA 3FIUA 1DVRA 4DWJA 2ZZMA 1F06A 1BJRE 2LKCA 4L2IB 5K4HA 2OOKA 1NMEA 4AN0A 4ZYWA 4TWBA 1EFVA 1CFJA 2J3MA 4OP3A 2AOXA 1DAGA 1DQYA 3O7MA 3I9FA 4D44A 1JSZA 5KWEA 5JD4A 1TD9A 2VP2A 1ZXXA 4IAOA 1AXEA 1RCFA 1Z0IA 2XHZA 5C8YF 2PSEA 4JXXA 4JYAB 2B94A 2VDQB 3AR3A 3WQRA 2BKEA 2XNDA 5GONF 5IMBA 3N8HA 3ZDXB 4D5EA 3FYSA 2VK8A 3IIKA 3N1UA 2XNKA 3O4IA 2GRJA 4ZJZA 3AP3A 4MWEA 4CXMA 1IZZA 1GL3A 3WR5A 4B0OA 2JK1A 5T41A 4UCFA 3KYDB 1JL3A 1VCIA 2V5VA 1HORA 3DLAA 2P9ZA 5NULA 5MFZA 2H1RA 2QZSA 2RH9B 3LY5A 3V2UA 5K0NA 1T5BA 4EO7A 1G4AE 3R76A 1RWBA 4MA4A 5JSZB 3FYHA 2H2HA 5KTOA 3BFVA 3MUFA 1NN1A 3FUWA 3RYIB 5D85A 5JR3A 2GAFA 4AQ7A 5JXHA 2ZB3A 4DUZB 4MI3A 1CQJB 2XCRB 1T4GA 3D2LA 2B5OA 2WMDA 1SC6A 2XTJA 3GEDA 3PXCX 5AOBA 5T4BA 4FSXA 2NUBA 4G0YA 1BDMA 2IHJA 3ENWA 3BREA 3DV2A 3I45A 1BW9B 2AFHB 3UJ9A 1EUDA 1NVUQ 3W8RA 5FWDA 3ZV7A 1H1TA 4X5OA 1QMPA 1X2BA 5KYUA 3PNKA 4V03A 1P45A 4GVLA 3S29A 4TQ9A 3T7EA 4CETA 1AF4A 3I2GA 3K8YA 4FYYA 2EWMA 3PQ6A 1I3MA 4DR7B 5JNSA 4QRDA 5IJWA 3UXHA 1OYOA 1JG4A 2PSDA 3QVTA 4RAQA 3RTGA 2F00A 1KK1A 2JLWA 1PSDA 10MHA 2LD4A 2R7AA 1ZOIA 4RZ3A 4XWYA 2R751 4NICA 2XDQA 4M3NA 3TTWA 1NF3A 1DARA 5JEEA 4CV0A 1OILA 4GI5A 1WHTB 2P35A 1M74A 1U7TA 2W7TA 4BX3A 5LQNA 2G70A 2FEWB 3MJHA 4PBRA 1G8GA 5SICE 4CU5A 4C3ZA 2G88A 3GBSA 2GBCA 4I55F 5K3FA 2FB9A 3UGQA 5ALPA 4ZOLF 2W2MA 2I87A 3ZIAD 1D9XA 4RLFA 1PNVA 2O6HA 4AZTA 2ISQA 5L45A 3I09A 1Y8AA 3UO8B 3OIVA 3OOJA 2FMFA 1W48A 5AW4A 4RK7A 5BMVA 1AZLA 1F51E 1O4WA 1W5TA 5DMHA 3HGQA 3RTEA 4YT2A 5JHHB 4F5ZA 1ND6A 5E2AA 2C4VA 1WF6A 2O1EA 1RSZA 1W5EA 3MJSA 2DERA 4GVXA 2QW1A 4BE4A 4KQ1A 2RJOA 3K92A 1GYPA 1H66A 3WGVA 1LF5A 1RKQA 2HN9A 5CLGA 1IVSA 1ZL0A 4XWAA 3VOBA 3O90A 1SZCA 5LDGA 2I4OA 1Z5VA 1VFPA 3F9RA 3AL2A 4NZPA 4P4GA 4EUSA 1XU9A 3MILA 3NUQA 1BJKA 1U4OA 4BP9A 4Z7NB 5C5IA 4W5TA 2X1LA 5JSHA 2BEJA 1NAHA 2CLFB 4IXTA 3OF3A 3N7UA 1QVVA 4HDQB 1O87A 1MIOA 2OCDA 3KXDA 1G66A 2QZPA 2P3QA 4FNGA 1FFXA 1DKOA 5PNTA 3S27A 3UN1A 5EMKA 2DYKA 4CL2A 2Y4OA 5E9JA 5IC6A 1WCWA 3RWBA 5TPWA 1ODLA 3AYXB 1E5QA 4LCJA 1Y8RB 3PWKA 4UTOA 2VA9A 5AOCA 1QZZA 3QRWA 4XXHA 5JJCA 4MS1A 1URPA 2FWRA 1O1YA 2YHIB 4ZAFA 4D9FA 2XGJA 2YIMA 4RY2A 3ZW7A 1OWOA 2F1KA 2C9YA 2MWMA 2XT6A 3GFGA 4KMSA 3MJTA 1L5NA 3Q11A 1P7CA 1PNRA 2CNLA 2FZWA 4TS4A 2ZJBA 4BDSA 1NM5A 4C07A 2O8DB 2A1IA 4FOOA 3O4GA 2H7XA 2LDXA 2G07A 2JLQA 4UTXA 2FPWA 2OD9A 1OZHA 4ML3A 3HTXA 1N6NA 2C0CA 4B6PA 2C98A 3WK8A 4O4JB 1AHIA 3KE8A 3OQJA 3TI7A 1C30B 1SCQA 2XMDA 4P9NA 4CKZA 4DA8A 3GLKA 5FHQA 2P77A 4BECA 5C1OA 3I5YA 4NU8X 4KYVA 6GPBA 1PSZA 2J85A 3K7EA 4XD2A 2QV7A 4PTZA 5EZYF 2B61A 2JIQA 2R6GA 4AJ2A 4F2GA 4YYZA 4Z51A 3K9FC 1M2OB 3CNOA 3K30A 1QYDA 1FXUA 3CLTD 1M1NA 1OFHA 1D2CA 1T3SA 4FGSA 1XZAA 3RPEA 2EX1A 4MYRA 2J5XA 1L5GB 1Z0JA 4P5PA 4H1WA 2A3RA 2HMUA 2RCNA 2IIPA 3ZR4B 1XTQA 1JDNA 2OV1A 2GOYA 1I6KA 4B48A 1A9RA 2GZMA 3Q87B 2V7PA 4UEKA 5H81A 3ELWA 1U3DA 1XTIA 2V7EA 3JTEA 4DCCA 3PC4A 3BIWA 3EQ9A 2CJYA 4S1NA 2J9GA 1UKAA 1R66A 5TEVA 1GL9B 3HR4A 2FDCA 4PYRA 1QS0B 3M34A 2AN3A 2WYOA 3I52A 2JFVA 3N8DA 1DDIA 3O8QB 2WVAA 4CLOB 1VKZA 3U44B 5TVKA 4IUYA 4HI0E 5CW1A 1FL9A 4OO3A 1YK0A 2PR2A 3QKWA 3SG0A 3VC3A 2XCLA 4RPCA 4J0EA 1FX0B 3MIZA 4YUZA 3CRW1 5FJJA 2OXFA 4Z2AA 5L8VA 5ALSA 2AX4A 3IO3A 3ORHA 1ILWA 4JB2A 1SXJA 2GZ2A 4E09A 1FBTA 2WIFA 3H2KA 4DRZA 3FDIA 3B9RA 5SY4A 2QYHA 4UNIA 3WNBA 3TB4A 2C3MA 1LVGA 4P5EA 3PQ8A 3QLEA 1JSRA 2Q6OA 1XTZA 1HKUA 2AEFA 4N5IX 2GXQA 1JXOA 2IP4A 1OT5A 3PGVA 1QH8B 5CPBA 3K1JA 1UPBA 2P8SA 1HQKA 4U2BA 3IP1A 3LHSA 4HBGA 4W5HA 5LBTA 3RTBA 2A4KA 3DG9A 3W5UA 3ESAA 2ENWA 4CL0A 3PEUA 2H1VA 4R2LA 4ND1A 2ZTUA 2JCGA 1QIKA 2EGUA 1E8NA 4G9BA 1PS0A 4ZRMA 1HR0B 1FUIA 2XKJE 5IRCD 4NR0A 3WBKA 1G5FA 1RYZA 3DD1A 4Y0NA 2G5PA 2PH3A 3OOEA 3ZZMA 1TFUA 2EF1A 1CX9B 4MR7B 5EHGA 4CM5A 4CUJA 5H9WA 5DSXA 3UB2A 4BFVA 3RYCB 2ZCUA 1DIRA 1L8OA 4WCFA 4BBPA 2V9CA 2GB4A 3PQDA 4HGZA 1M5TA 3CLRD 5FPPA 1E7MA 3T3PB 4C1NA 5IT0A 1XLTA 4MO2A 4JLVA 3G5TA 1MH1A 1J0CA 1GN8A 2GD1O 4H60A 1ZA2A 5C0OE 4QUDA 1E99A 3JQGB 4IOLA 4B6GA 3QMMA 2WABA 1P9NA 1GNLA 3IRVA 4RZHA 2HK7A 1V35A 3OFKA 1SU6A 4IX1A 1H85A 4R8SA 4XOUA 4RPJA 5E2BA 5ULLA 2F62A 3NM6B 4QSMA 4F6CA 2CXQA 3EGXB 4Q3NA 4DV6B 2GCIA 2WSYB 1JTEA 3OY7A 3CM0A 1UBRS 3I9MA 1V71A 4I1VA 3AIKA 3ZCQA 4UNNA 3BDVA 2CLDX 3U4MA 4OXQA 4FKZA 2QL6A 3B2NA 3NTLA 4G8DA 3NHPA 3UTCA 1JYEA 3MA0A 3QEMB 1CRPA 4QYIA 3QXHA 3L49A 2NSDA 3IVCA 3NAGA 2GXSA 4BN5A 3N2ZB 5E6RA 3P0JA 2OBLA 4CKEA 3FWZA 5C7IO 1V16A 3MQ2A 3VR5H 3DBRA 1M34A 1LPOA 1OA0A 1V1RA 3LP8A 3SC3A 4EGCB 2O7NA 1CJBA 2FWIA 3AFHA 3ZDFA 5AVZA 3P7MA 5HEKA 3ZHXA 2Z6VA 3P5BA 2FX3A 4IDEA 3HZZA 1K89A 1U6IA 3FZQA 3IAM1 2YS7A 3TW8A 1XU4A 4N82A 3URKA 4ZU6X 4DNOA 3DZ8A 3MN1A 3CG4A 4PS1A 5LLDA 1KEVA 1U0BB 2O8CA 3SZUA 2WUDA 3GUVA 3JD1A 3LHIA 3WRVA 4BQOA 4EKGA 2OXEA 4HADA 1U8TA 1DOZA 3IQXA 4E1VA 5K7SA 3QFSA 4RF4A 2Q0SA 1MXHA 3DFUA 4BLPA 1KI7A 4CIWA 1KOFA 4YJ3A 4GKBA 2X13A 1F0KA 1EUCB 2AWNA 1SVKA 4GMDA 4C4SA 4HVAA 4IIHA 4I1YA 1RU3A 3ZCXA 1LD3A 2FFJA 3IT0A 3N8KA 3GB9A 4Q16A 3B70A 5AO9A 4BGEA 5ILOA 3K73O 5JCOC 3D02A 3LZCA 1Z0UA 1JQAA 3CUKA 4XKJA 5HDBB 1QFZA 1RYNA 2Y2UA 3B82A 4BO1A 3CVYA 2FZ4A 3NIDB 1ZN7A 2AYXA 3NORA 4BLQA 1C14A 4ENSA 3IMGA 4UUBA 4G1FA 1BMFA 4JROA 3LKBA 3BGWA 3BJIC 2ZITA 1P91A 4NJOA 7REQB 2F4VB 3CTMA 2JZNA 4YRDA 1KO5A 1X9HA 3NIBA 2OXTA 4DNXA 3KR9A 4LY3A 1PG0A 1KQPA 4X24A 4D43A 4M53A 3MB8A 3DVAB 1FYEA 4LX0A 3H7AA 4KLZA 3UT5A 1G2OA 1SBTA 4GBJA 4IDAA 4UCXA 4DJTA 2VK1A 1N9GB 2PLWA 2H3EA 2PRKA 2GFIA 4RK0A 4CCWA 1QUFA 1A9OA 3CH4B 4CIXA 5B2EA 2IYQA 5HJ7A 3VO8A 1QBKC 2FR8C 3M6WA 1MPXA 2EZTA 1A71A 5J4YA 3SQLA 3MERA 5HF5A 1U1IA 1MLDA 2H9IA 1UPFA 3E3NA 3UWMA 4PSDA 4AN1A 3HY6A 5IDWA 1WU7A 1YDMA 2R86A 4I4CA 5AFSA 2Z1NA 3OCCA 1GILA 1Q21A 1M2HA 3ETDA 4QUAA 3F7TA 3HJRA 3HFRA 3IT3A 4OHCA 4KIUA 3ZDYB 1Y8CA 4U0JA 1G1AA 1OB2A 1XRQA 3KKLA 4DJFC 2H2GA 1QG4A 2CFRA 5CD9A 1TA9A 1X7XB 5J4LA 1I3OA 4JD5A 4IS2A 4NEHB 3PEWA 5TQJA 5AW6A 4E30A 3D2CA 5H3CA 4KK3A 1OBHA 3U37A 5A2GA 1IXKA 2PO7A 4MUEA 4TM7A 3NXSA 1DJPA 1SCJA 4GZLA 1LRLA 1VHLA 1KEPA 3D5EA 4QPDA 5EZSA 4HNAA 4IIJF 4QZVA 2Q28A 5HRAA 1XLVA 2OZPA 1NOIA 2CWDA 1WNTA 4BNVA 4AY6A 3Q6MA 3Q5DA 4L50A 2WG0A 1NX9A 3W2TA 1GKKA 4OGLA 1EX1A 4H27A 3K2IA 2WZDA 2WTXA 5A9SB 5FX2A 3HJHA 1JRLA 2C4NA 2I1VB 1SK8A 2YWBA 4JASB 4ZVNA 2PX5A 5DDIP 1RTKA 3UENA 5BORA 4FLFA 1RM4A 5J2UB 3L5OA 3U6BA 2IS6A 1Z7EA 4NTZA 3PNMA 4ZOLA 2BMJA 1MVLA 2CVHA 2WJ4A 3RU7A 1E1NA 3KOYA 3NYQA 1GQRA 4EG8A 5KSZA 4Q02A 2BTQB 1RAHA 4OXXA 4ZCMA 5JMPA 4WDRA 1GPBA 1QC5B 1X8XA 4JITA 4LZPA 4EKDA 2YWRA 5BQXA 5BV0A 2D1RA 3QVSA 2O7QA 1HETA 4NJEA 3OBBA 3BCHA 1IVNA 1WVIA 1PT5A 2YN0A 3MJCA 4AJOA 4BO2A 2V8BA 1GVHA 2W98A 4KR0A 3EXHB 3JRWA 4D0GA 1G6OA 1IDOA 4TMZA 2ZE7A 5E7IA 2OO3A 2HBRA 2QL7A 5E3JA 3NNDA 2Q5IA 4C4OA 3DT6A 5B4TA 3NANA 4INOA 5EJ9A 1WMSA 2PV0A 2KM1A 2W6CX 2E9SA 3TN7A 4WBNF 2X22A 4ZT7A 4QQ8A 5E4YA 5CA1F 5KOJA 3QLUA 4FXOA 4RA6A 4RIGA 3QKRB 2OCIA 1WULS 2REQB 5T5QA 2CEAA 4OHRA 5L3QB 1ST3A 4EY6A 1QHHB 5L7YA 3NTOA 5DHQA 4GOKA 3AOEA 2LE0A 4IICA 3SC6A 1F14A 1SUSA 2AI1A 3RC1A 1M8JA 1ZMBA 2CXPA 3WRWA 3JX9A 2VAVA 2X40A 1QPGA 4X20A 2WM9B 3JTMA 4G5OA 4PPFA 2JEOA 1I3LA 1KPIA 4N6GA 4R51A 3DT8A 1DWQA 3PD0A 2YVAA 3EZGA 4ZI2A 2X0NA 3IXMA 5I7EA 1ZX1A 1ZSNA 3T3GA 4FU0A 4DCNA 3EZYA 1XBTA 5JXJA 5LYJF 4F9TA 1UXJA 4YECA 1X7YA 2JGDB 3NJ8A 3ESYA 5K0SA 4J0QA 1HLGA 1J24A 2A0YA 4DIOA 1FQKA 1RHUA 1DQPA 4G63A 2KLBA 4CNQA 5H02A 2WSSA 2CJFA 1MTZA 3BULA 1YQWA 3WLSA 3R3ZA 5FUQA 2I03A 2NO5A 1T1IA 1T0PA 4YFVA 5EIAA 3SYRA 3UFXB 3EPJA 3IHKA 1BE6A 4QVIA 3S2SA 4ETNA 3DAHA 4AKTA 2XUJA 2QTTA 4Q24A 3ZV4A 4B9AA 1LLUA 2BBTA 3G9TA 3B6ZA 4R83A 3OVMA 2DPLA 3UMRA 3V2GA 5JZBA 3GJTA 5LZ4A 5B7NA 1TM5E 4LPKA 1YOVA 2CLEB 4KU4A 4Y1RA 5HZGA 3RR2A 3K31A 2QAGA 4FHCA 3DE4X 2OOSA 4ZOEA 1U6KA 2DECA 4LFBB 3C8UA 3HABA 4QOFA 4HQKA 4KGXA 4XIJA 1EG7A 3B48A 4Z4IA 4XVUA 1WE2A 1VM6A 1Q0HA 4HO1X 4LQDA 4M7PA 4MVJP 5ESDA 1QP7A 2EP8A 1U8CB 3B3GA 2H2WA 2TSYB 2XODA 3CPJB 5BNWA 2QW0X 2DAPA 2AC2A 2F48A 3D7NA 4IF4A 4OLJA 4JN6B 1A77A 3DMNA 4MW1A 1UBGA 4N5DA 1XZJA 1IUKA 1JEQA 3U7RA 3UM9A 1U0GA 4QL3A 3HEBA 3UAZA 1UH5A 3Q15C 2JEYA 3GGGA 2RHWA 3GELA 2HR1A 4WUTA 3TRDA 5E38A 3BAFA 3HBNA 1L5VA 4TUYB 5B30A 1YR6A 4RKFA 3ZQKA 1V4BA 3CXUA 4J7CA 1NW4A 5FAXA 3AONB 3FOEC 3JVVA 3AIMA 4HLDA 2Y1XA 2QX7A 1ZGZA 5HR5A 3H8JA 1DX6A 1SBYA 2COEA 2GHTA 3OQ6A 1DCFA 1GQFA 4IMIB 2RSLA 4OJYA 1W36D 1N6KA 2MSDB 3LWDA 1L3BA 5TGDA 4FD2A 1JQLB 4YCJA 5DRYA 3E53A 2HJVA 3N2GA 4DLPA 4H2DA 2GJ9A 2ILVA 4O3FA 4E15A 3GLIB 2FN7A 1XDSA 2BCEA 3EA5A 3KP1A 5FWXB 5A5GA 1EWQA 2XQFA 3TNJA 4E2FA 2Y1DA 3GDFA 4ND4A 3P9PA 1WRBA 4NE2A 3HZRA 1QM5A 4KIGA 5EJGA 4Z3KA 5CYFA 1DT3A 3GQBA 4GQIA 4DMGA 1I2CA 1E3TA 3M81A 4OB8A 1DP4A 2FPKA 3JALA 2IYXA 3F5FA 3T1YB 2H59A 1N0UA 5FPYA 5SZHB 1T9DA 5EG5A 3V1UA 1JVNA 1Z0DA 1DIOB 4LV8B 3U40A 3WKBA 4ZI7A 4LXTA 4A8TA 1M6HA 4RPHA 4D45A 4YXFA 4PO3X 3BCUA 4NMWA 2XMQA 4BNFA 1L7PA 5AJWA 2G40A 4I50B 4YCNA 1EVZA 3OPXA 4JBYA 2QYSA 3DBVO 2R1VB 3C7AA 1G8PA 5G4LA 1YZLA 2GKGA 2N47A 4O5OA 2ZUWA 1A4RA 2YMQA 2BCGY 2W2KA 1P9WA 4PLGA 2VYVA 3PYLA 1E8DA 1E4OA 2CFIA 3EZXA 2OUKA 1KYVA 3ESZA 1A96A 3RABA 4UTNA 5K0TA 4TKZA 1X92A 5ESXA 5BNZA 5KC8A 4XPIB 2WC1A 1GRRA 1AKRA 1R0CA 3LF2A 1FYXA 1WCIB 1PDWA 2NQTA 3WLMA 4AULA 5JQGF 2OCXA 5JFGA 1C4WA 5EQDA 1TAHA 1T9KA 5B53A 5IAAA 4LBVA 1K92A 3WGYA 1BROA 1A9TA 4ZIRB 5JVDA 3OZGA 4Y9UA 1UF9A 5LP6F 3CUSA 4A26A 1XNRB 1DAOA 4WMLA 1GA6A 1QCCA 1E6LA 4OAQA 2BFCB 3RAGA 1KAMA 3BFXA 3LZ6A 1K88A 4O1MA 3EVAA 2E2WA 5A5EA 3O95A 1ISIA 1OXBB 4YPVA 2WTMA 1FUYB 1MU0A 4K1XA 1OHHD 1G2PA 1X7WA 2ZSAA 3QW4B 2R7MA 4L75A 4TXHA 2V3CC 2X7JA 2ACWA 3D3EA 3EGWA 4YMSA 3PA6A 1WD7A 1A88A 4L4SA 3IOEA 2YOHA 5JH7A 4UM5A 3JQ8A 2HHLA 1P74A 4ZAZA 3Q7RA 2VHYA 4PEVA 2HJHA 3TNLA 5EJ7A 3DT9A 3LUAA 3ILSA 1HQCA 3G8DA 4AU1A 2K6GA 3CBGA 1WD5A 4BZQA 1KEEA 1M34E 1ZVMA 1RS0A 4JMPA 2ZYWX 3Q7PA 1FTQA 1WB5A 2I6TA 4LGCA 1E58A 4JK3A 3D3WB 1JIXA 2YN4A 2ZXFA 5J4KA 4FNMA 4HRVA 2WTUA 3WK6A 1K9SA 1SD1A 4H35A 4Q3AA 1YA8A 4J0KA 3U4QB 1CPYA 3UCXA 1M2JA 4KQJA 2YIVX 4A23A 1J49A 3E9QA 4RMIA 4N3GA 4B81A 2NTNA 3MSXA 1T4BA 3MT0A 1YFZA 4RGBA 2Z1DA 3LCJA 4OVKA 2FNAA 4M1EA 4Y2SA 4YIKA 3DXXA 1MEJA 4QODA 4TWIA 2FEKA 1OROA 1SXQA 2QZZA 3AHCA 2HA5A 5C1BA 3W7VA 4HN2A 4RABA 3HEAA 1D4ZA 2F9FA 4GAEA 1VC2A 5JJ5A 1E2MA 3RVJA 2Q4EA 1G9XA 3K4HA 3L93A 3GGCA 4RJJA 2EU8A 3H19A 4XYBA 4JL5A 3HKCB 4C6TB 3L6OO 1C9YA 4WFQA 5AJUA 5FUMA 5INTA 1OSNA 3M2PA 2Y93A 2FQ1A 3BF8A 3COWA 3TBHA 3DFZA 4L5YA 2B99A 3AB7A 3C3EA 4K8OA 2WAMA 2VDMB 4PRYA 4QJBA 3V5NA 1DAHA 2UU9B 2WV7A 1VE9A 3UK0A 1KERA 2QR3A 4JVNA 1LBIA 3IESA 4OXRA 4QUIA 4V0MA 5G53C 5CCDA 3ZTTA 5A3QA 1L9KA 2GSDA 4OQMA 4MPTA 3H4VA 1EUYA 1Z37A 2PY6A 4MPDA 2HPHA 3LA8A 4RVHA 3ONNA 2VHJA 5JQWA 3M4YA 1R0WA 4KWIA 4TSRA 1P2UA 1K7SN 4F6LA 1YB2A 3DKRA 3GHYA 4IG4A 4V0NA 4UMVA 4PC7A 1QK3A 3NLLA 5E9AA 5ITWA 2CJWB 3IQIX 3KSRA 3SR4A 1ZOSA 1BE1A 1PZXA 1RKVA 2IF2A 1DPGA 3OLQA 4I9HA 4EX6A 4KXLA 4EI7A 1U8YA 2F7SA 4IIJA 4BNGA 2W71A 1ZD3A 4YT4A 3SHVA 2VF7A 4N5MA 1Z08A 4W63A 1B16A 4EHBA 5JUWA 2O19A 1D03A 4HPWA 4GRDA 1I4EB 4DCOA 4DXHA 3ZJ4A 4KXNA 1W36B 2F3TA 3RI3A 5AUOB 4NHOA 5LU8A 2PLFA 2VF8A 3CINA 4DDKA 2OHVA 3AV3A 5DK4A 3KZVA 1Y1QA 4YC7A 2O1WA 1VHQA 3JZIA 1CVLA 5DCLA 3GG2A 2AR0A 1KXZA 5JDIA 2QN9A 4AUNA 1VE6A 5IAEA 1GZ4A 3LY8A 4H18A 4GYKA 4QNNA 4KNVA 4EVQA 3EFOA 4WZZA 3DZKA 4YWJA 3C8DA 3PUVA 5C31A 1WY5A 2L0XA 3DYVA 3Q3EA 5BUCA 3T9CA 2QRGA 3CNLA 1QGYA 4NQZA 3TOSA 4JLUA 3M4ZA 1LKZA 1VL5A 4BMCA 1VIYA 1U0NA 4HVTA 2AN9A 2ZW9A 3DQPA 5DH9A 3X1KA 2FFAA 1NNUA 4ALMA 2W6QA 2EKPA 3NMUF 1CULC 2OHOA 5AUQA 1RKXA 2AR7A 2O0MA 5IZCA 4S0ZA 4RTRA 1IZ8A 3SZMA 4UUOA 3TTVA 3N2KB 3BJEA 1ZNZA 3S4YA 4B7ZA 1W29A 3TZHA 3LGAA 3W78A 3DL4A 2QE7D 1SOAA 4CG2A 2R8BA 1ATIA 3DF9A 4HGNA 3UOAB 1CUZA 4NZNA 4BVLA 1J9ZA 4G56A 3VBEA 3NC0C 2B83A 4EYOA 1SPXA 3BIXA 5AD1A 1SVNA 2AZMA 4YRCA 2YYYA 1V95A 2G5CA 1U0JA 5AXDA 3RSOA 1XKXA 1EVKA 3ONVA 1HG1A 2N0SA 1Y80A 1I32A 4KO2S 3N28A 4DCVA 4ESOA 5ALQA 4XJXA 3KVNA 2CNWD 5CNJA 3G89A 2SKEA 2YW9A 3Q7EA 4PO8A 3ZV5A 4LE2A 2MIIA 1U8XX 2VJAA 3LCCA 4GT1A 4WKGA 1BH6A 3KQUA 2NMVA 1YVUA 2BOVA 1I14A 3KXPA 2FOXA 4ZQCB 4AJPA 1TMYA 4A2WA 1NMXA 4QO7A 3E2MA 4PHTA 4X94A 1T2FA 4N0DA 3DKVA 4OM7A 2A33A 4E94A 2F55A 1SIOA 2BISA 1LCIA 5TARA 1JHMA 2WJVA 3IQGX 4D92A 5C4IA 1KA9H 1OTXA 2J9FA 4EPTA 4L7VA 1S9DA 2ORYA 3HDGA 2ZB7A 1L5MA 2PKEA 3AY7A 3FYTA 5C35A 5LYJA 1JWLA 1AKTA 1J22A 3ZOZA 5IK2D 3HFSA 2BJVA 3JQAA 2I8AA 3EQ2A 4OHMA 3W6UA 2V0NA 3ONEA 4I3GA 4O33A 2ZIGA 1NBOA 4S35A 1EM8A 5TMPA 1RHQA 3TRIA 4MWSA 3F3YA 3MMPA 4GZ3A 2V6BA 3AESB 3T95A 1BWSA 5EHQA 2Z1MA 4GYYA 4CLDA 2ZYVX 1E1QD 3V4OA 4Q9IA 3WG9A 4QX6A 4JYBA 3G2HA 5CX1B 2J46A 2PIDA 3VPSA 2VJDA 1YJCA 2Z83A 3AHGA 2P4SA 4RKRA 3M5PA 4YCSA 2J4CA 3WAKA 1II8A 1QJ4A 1Q16A 2PMFA 5HS6A 3S81A 2XCIA 4ARZB 3N6RA 3NHLA 4CHGA 1GGMA 2F8TA 1R6UA 4W5OA 4BRSA 3OTOB 5AW8A 1F3OA 5J2TA 3WL5A 3A11A 5TB5A 3RVNA 3ZD9A 3L4BA 4D41A 1J5PA 1Z6YA 3DLHA 1DTSA 2C20A 4YH1A 1E60A 5B1SA 2H8KA 3KVYA 2PQ0A 4NZOA 1RYDA 1TNDA 2DBRA 2Q5FA 4ZPXA 3LQQA 4TMTA 4EW1A 4CEIB 1KTVA 3NTVA 4FS8A 4URUR 4AG3A 2XRZA 1PZHA 3JZAA 4FIZA 5F2KA 3ACCA 1QZXA 3ZCVA 3BXZA 3TRKA 2XIJA 1CUCA 1A3CA 2G25A 4C0QC 4L8YA 2FAXA 5C1IA 5IASA 3UKDA 1SQFA 2CB9A 5CM8B 3WGQA 3ENZA 5ER9A 4D26A 2IWHA 4YCAA 4YRRA 1UBCA 1QDUA 3GLTA 4WZ6A 1Q0LA 2PNJA 3B7PA 3R7WA 1Z5ZA 3KEOA 5DHTA 2CF5A 5FBHA 3MUNA 2DT5A 1SZJG 3G8BA 3GXBA 3LQKA 3JARA 3VYVA 3IL2A 1YR1A 1T26A 3CKKA 1X1CA 4D42A 1Z0KA 5BUZA 5FNVB 2FG5A 4EB6B 1Q92A 2P2NA 4LJKA 4EY7A 4W7HA 1YL6A 3CNQS 3GZJA 5D3MB 4ODIA 4AECA 3TL2A 3CRQA 1SJ9A 1H0KA 1Z5OA 4OXNA 2AG0A 3QITA 5ALXA 2ERCA 1T6YA 2VXOA 3V3TA 3I0NA 3NNSA 2CXSA 3RS0A 4U7TB 5EGNA 3CUTA 2NV6A 2NZVG 2I7XA 2ZIFA 1LF0A 1NOJA 1G41A 1Z5NA 4MB0A 1SOMA 3SYTA 3S2IA 4DV4B 1J99A 1OXKB 1MRZA 4QDZA 3ROEA 3AL3A 5AKZA 4M0KA 4Z2YA 4A15A 1HE4A 4HGPA 5CH5A 3AUYA 4LJSA 4TKMA 5A4JA 1JGTA 4RVGA 1KO4A 1M2EA 2X9QA 3K2EA 5GY7A 2O57A 4DLWA 4CMJA 1LJUA 4F2PA 4FVTA 4O8ZA 5EMHA 4GOXA 3GP8A 2IX3A 3ABRB 1K7FB 3I83A 3DFIA 1A5BB 3T1OA 3LHFA 5ERXA 1H1LA 3VVBA 3FHJA 1NW9B 4MUJA 4QG7A 2IYTA 2M98A 1NWCA 2O7RA 2IYNA 1O9BA 2CD9A 1SUFA 2VTDA 4GM4A 2NO0A 4PZPA 2D59A 4EX7A 4RPLA 1NNI1 3P0EA 4G41A 5E8JA 4CLOA 3BHNA 5KUTA 3PL5A 1AMUA 4WZAA 2XUDA 3ZXYA 2I3AA 2F43A 2R6CA 3INNA 3KVRA 4QLBA 3HA3A 1BVUA 1P5JA 2R6AA 3AVXA 5LP6A 3ZWCA 1Y3BE 4A92A 1CB0A 1Y3DE 4QDJA 3FNRA 1JAXA 1TIPA 1U7XA 2Q7DA 2H4JA 3TOXA 4E2WA 3TW6A 2XB9A 1J8FA 1QPBA 4IJ5A 1XA0A 1YZNA 3AVQA 4PC6A 4BO0A 5JAHA 3GARA 3UJ3X 5AVSA 5I9SA 2WF8A 4ONEA 3PUXA 1Y81A 1PU2A 4DY6A 2I2BA 1JEYA 3TOCA 1NUHA 2YYAA 1Z83A 3DSRA 4HX9A 3RC9A 3NKLA 1SBHA 5HUQA 1HMPA 1QK5A 1RI5A 4KTTE 3U19A 2FW8A 1ZP6A 1NNLA 2QTGA 2W42A 2IA5A 1DJLA 4JOSA 1J42A 1BNCA 5KSPA 1NLFA 4YNBA 5KQMA 2NYUA 4B3GA 5B57C 1AS0A 2IXEA 4IKEA 1KZ1A 5KNCH 2X5NA 3HVUA 4NEQA 2LUOA 2AZDA 4MLCA 4LXYA 1NUPA 3F3MA 4EFNA 1S2IA 1SC9A 3VR4H 4OB6A 5KYWB 2O0HA 4EI8A 2OGSA 2MR6A 4KQ9A 2BCJQ 3BTVA 3KWJA 3LHKA 1U2DA 2ODQA 3KJGA 2EJTA 4QDUA 4ZU3A 2OYRA 4GBMA 4LNAA 1L5WA 5EKXA 1R8JA 3A70A 3ZTWA 4ED9A 1QV6A 3TSZA 4YLEA 2H1HA 5KJFA 2BFEB 1E7YA 4QKQA 3T3IA 4TTAA 4TVOA 3NJRA 2B4YA 1I4DD 4TLEA 2ID9A 4U7WA 4ENTA 1MABA 3PFKA 3SXPA 3DLTA 3K96A 1TYBE 3R5JA 5ALWA 4KK4A 4NCXA 3C3XA 4RZXA 1R9GA 4ZEOA 2Y1WA 4S12A 4AF6A 5KSOA 5ECWA 2FX5A 1C50A 4DV5B 2ESRA 1N9KA 2XD9A 4C29A 5AVRA 5EI5A 4H3SA 1RCTE 2PMDA 3NV9A 4DQKA 2IEAA 3BYZA 2GD0A 4TLBA 3WFIA 4DRXA 1Z62A 1LPSA 4G6ZA 2WTBA 3PNBA 4EHDA 1Z88A 3NR2A 2R6R1 3BIFA 1X77A 1WWKA 1ZHHA 2EF0A 3F5DA 4RACA 4ZYZA 3IPAA 3ZQUA 2UYCA 4EECA 2QIPA 2Q45A 4H1TA 2WVGA 5KHOC 1QHSA 3NS7A 4GC9A 1NT4A 4GBED 3FFWA 4DARA 2FKAA 3GD7A 3OZXA 5L53A 4BMDA 1PSWA 2DBVO 4R6WA 3A1NA 3RIYA 3VAAA 5HJEA 3AQ4A 5I7WA 4XSGA 1FIUA 3QSYA 2C5FA 3M4NA 1W8DA 3G88A 4GI7A 2HBYA 4ZT2A 5K01A 5ESWA 1NW6A 3BILA 1VG1A 2JD0A 1AOXA 1PQYA 3BJRA 1N3IA 3P8ZA 4BNTA 4WXHA 2YFQA 1NR5A 1CJTC 5CNKA 3QG1A 1JT2A 1QZTA 4EF5A 2IP2A 4OOFA 1E9RA 1M7GA 1P39A 2UZ3A 3HUDA 3PUJA 3T4UA 3O26A 8ATCA 3A9CA 1ZRHA 1SVLA 5LQMA 1M2VB 2ZYSA 5BR1A 3LW7A 1G6KA 2GA8A 1PF7E 3K9NA 4QUEA 4Q6BA 4X9XA 3RTDA 4D0LB 1AMNA 1RADA 2OGZA 1H9BA 5K0GA 3E5MA 5MN4A 4MMYB 3AEQA 3MBKA 1KVQA 1K6JA 2GJSA 2QHXA 2DX7A 1H22A 1QONA 1RYEA 3GJYA 1OU4A 4JL6A 4AWAA 2QTFA 4BPRA 4P81A 3NVAA 3FETA 4U63A 5BY2A 5SYMA 4ZHQA 1MO2A 2ZR8A 1PJRA 3ORQA 3ANXA 4WINA 1FNMA 1TF2A 1E9DA 2JIZA 3P32A 2YHAA 4M7RA 3VR3A 5EIWA 5BPFA 5K8VA 3AI1A 3RASA 1K3UB 1NTRA 2AR9A 4MHSA 1CCWA 2GEFA 4YAEA 2EZ8A 1TUBB 4KO1S 1GZ7A 3GROA 3TLMA 1J5EB 4N49A 1FNNA 3G49A 2PT7A 4OY3A 1EZZA 4EPRA 2BY4A 4MVJI 5U4QA 1PFUA 5BV2P 3PXAA 4GSKA 3HDYA 5F1OA 3IS3A 1YDWA 1Z73A 3A1EA 1N5KA 3Q7TA 4MJ7A 3HL4A 5IBQA 4DSAA 2CT8A 2YR0A 2ZCVA 1E3WA 4YBZA 521PA 2IDZA 4MPRA 3EGCA 3G0DA 4ZC8A 3W4KA 4UQLA 3FOBA 1VPWA 2IZ5A 1ZK1A 4Q0MA 4L5JA 4TS1A 1EWVA 4H3HB 1ZU4A 3UUGA 2I4NA 1N7IA 1RZUA 1XTRA 3L7JA 3RIEA 3WDMA 5B58C 1FJHA 5SZKB 3VPFA 1STOA 4CDMA 1PWYE 3LA6A 5E1MA 1NPDA 5L9AA 1RWPA 1J8MF 1G5RA 1DO8A 1DUVG 1FVOA 1XTSA 4GM1A 4U7DA 1WZNA 3E82A 1A27A 4IO1A 3L6EA 3CEPB 1MB0A 4G4GA 4EAAA 3DZFA 4J1QA 3ZDDA 3MIIA 3RVKA 1G8HA 4NS4A 4KPUA 1O97D 2A0UA 4JI8B 4OX9Y 2WFLB 1GTZA 1UFQA 4G3XA 5CFLA 1OA1A 4OFXA 4B43A 3CVXA 3D43A 1L4FA 4Z4GA 3A2KA 3LPCA 2XLBA 2GBIA 1B4DA 4JVMA 4YCBA 1IIBA 4LCEA 5DISB 4TYWA 1KYZA 1V8ZA 1J21A 1JDPA 1M3SA 4QDOA 2DWPA 5M5BA 1CUBA 4Q1BA 2XVZA 2XNJA 1K63A 3K16A 1IRXA 2IPMA 2RK3A 3ZK7A 4YCLA 1Z4PX 1C1DB 3RJ9A 1XA4A 2QUJA 3L7NA 4XI9A 1U28C 3FF4A 3K3PA 5D1HA 2J67A 3E05A 3HFGA 2HK8A 1HGXA 1A95A 3ZWAA 4D4MA 1N4AA 4K9RA 4E1AA 4NBTA 2PUEA 2QUBA 2UDPA 3EPKA 3STVA 3L6RA 4B7CA 3QH4A 1M67A 2HB6A 4R41A 1MV8A 2B30A 1GGKA 3NHYA 2JI8A 4NWIA 3QPAA 1XMPA 3EGOA 1NVMB 3PQFA 4GU5A 3T15A 5I5EA 2WYWA 4AJNA 4MDHA 1JP7A 2I99A 2ZR7A 5HK9A 2HUNA 2JF0A 1FP2A 4U39A 1ZOOA 5F4ZA 3HV2A 1YS4A 2WVJA 4X7RA 1II0A 1VB5A 2YCLA 2P7IA 4CWAA 2QVLA 2CV0A 2G80A 3R3UA 3KOOA 4G0PA 5HGJA 2VTVA 1WS6A 1UWVA 4XZ3A 2O14A 1DBQA 3JQ9C 1PJ2A 2DQZA 4L73A 4UHEA 5ALJA 3V46A 2V45A 4Y2VA 5TSDA 3ZHOA 2V4UA 1RWMA 1OBFO 3L8CA 2HRRA 4PZZA 2R60A 4FR5A 5AOVA 3VU9A 3VU8A 1T43A 1Z4NA 3LCRA 4BLTA 1Q84A 2HYIC 2Y3IA 3KQVA 1PW7A 5AM5A 1VLVA 3AF0A 1QK4A 5SZJA 4ALJA 4B3IA 3WLRA 3PQCA 3ENKA 3QEJA 4A8JB 4IJQA 5DV9A 5A3RA 4BRUA 1LJ8A 1FU7A 1YRYE 1ZCFA 3EVCA 2DTEA 3GZNA 5MFPA 1OX6A 4HRAA 1RXVA 1N2JA 2J09A 2PR7A 3WAGA 4FZVA 3SX0A 3WIDA 2OV3A 4DSNA 1ONOA 1AQYA 1RM3A 1U2EA 1R0ZA 4HH4A 1L4BA 3OOSA 2QQFA 4C6SA 4BNUA 4Z6KA 2BEKA 2E6KA 3DW1X 2FWPA 2VRNA 5THXA 4D8WA 4DREA 4ZEXA 3RC7A 2R7LA 3PSHA 2OILA 3A6HA 2K4MA 3JQEA 2WU8A 2JD1A 2IK8A 3OEED 4GHWA 4EY3A 4N3BA 4B3JA 3W0LB 1YBMA 4M21A 1C5KA 1M1UA 3DDUA 4CFSA 2X5XA 4MKIA 3KZ1E 4RVDA 1GFIA 2VQDA 1Z2OX 3RRBA 4GZ5A 4HNVA 1E94E 2RHMA 4L4RA 4UFNA 2PTHA 4REMA 1T2VA 2VP6A 4F2HA 1GKIA 1HNNA 3I1IA 4ZYVA 1NR7A 2F8LA 4B2IA 5ARDA 1ADGA 2C2BA 2Z0MA 1ZIYA 3E0QA 1KDPA 4OQFA 4ND6A 4EHKA 4G5XA 1IPHA 3L1HA 3PIDA 1ISJA 4WADA 1MORA 3FWNA 3WYGA 3LL4A 1A1SA 3HSKA 1H8EA 2W4MA 2HMSA 4ZVRA 2Q1XA 3A1SA 2JHCA 1BQ4A 1JPUA 3CNHA 5FLYA 3OZTA 3GLQA 4RZ2A 1DTWB 4B1FA 1IC6A 1NJ8A 2XJ9A 1UT6A 2YCBA 2UV8A 3R74A 4P08A 3O1HB 3IO5A 4YREA 2Z8YA 3MTAA 5GINE 4B8YA 1DEOA 2Z56A 4QGFA 4UARA 4DEYA 3EFEA 1FW8A 3U4QA 5I7VA 3DAPA 1OBOA 3HCAA 4X45A 5KWJA 4X1YB 1XALA 1MKYA 4UVDA 3U0BA 1TCAA 2DWUA 2Q8QA 1RHRA 3SICE 1P7PA 3VJLA 3DOCA 2I2FA 2Q4RA 1E32A 2FZLA 4NU6A 1T8YA 2JGNA 3K1AB 3THSA 4UUQA 1Q1ZA 4XE5A 3MK31 1NX6A 1CUAA 1R5BA 2HQRA 4E07A 5AKYA 2DBZA 2XYRA 3LFUA 4RS4A 5EIFA 5ERGB 2O6LA 3ZGXA 1X38A 1O4VA 2Y6VA 4D9CA 3FJOA 2V97A 4CL8A 1R0SA 1YRAA 2V6MA 4HUJA 4M54A 3EODA 4N03A 4WNAA 1Y7HA 3BGIA 4JUBA 1KDYA 5K0LA 2Z08A 1W52X 2HLNA 1RQGA 3Q2OA 3EZ6A 3RS8A 2ZWIA 3VKFA 4CE6A 2R1ZA 3TAUA 5C4GB 5JIBA 1QYVA 2C96A 1OI2A 3BMCA 3H05A 1J00A 3UJPA 4HGOA 3W05A 4LE1A 4F06A 3OIYA 4QGHA 5L95A 1KP9A 2GN4A 1PR6A 1ZGBA 4Y1FA 2J1LA 4QJIA 4HV4A 4DJ5X 4ITVA 2ZFUA 4CCYB 4JDUA 2HMAA 1ID1A 1OXTA 2K2QB 2EVWX 1B6TA 2GAAA 3KSDO 3D1VA 5IJ9A 5A3VA 1I10A 3EXG1 2ES4A 1YE5A 4YPOA 1FDWA 1FMTA 2GT1A 2J3DA 3DL0A 5JS6A 5LQAA 5ECYA 4L0DA 4OCZA 2PUHA 1ULZA 1WXXA 1QH1B 5LC1A 2YVUA 5D01A 3CSUA 3PCTA 3WGIA 3NBZC 1FFDA 1P9LA 1ZGCA 4O2AA 4MQ4A 4JNKA 3V32A 4B3BA 3V80A 2BUCA 4IWXA 1C8KA 5I8PA 1UAYA 3HDHA 2EBHX 1Z8FA 2AMFA 1YDGA 2XMBA 3NP7A 3T4XA 5B2FA 3L1JA 2CL5A 2W9XA 3KQKA 2VHZA 2B2XA 2DH5A 3ZVMA 4PWZA 1WW2A 1QHIA 3JWGA 4LJYA 4CMBA 2VS1A 3DAYA 4YVFA 3F97A 2UVQA 4UEJA 3BK1A 1FJGB 1TK9A 4FB4A 1EUDB 1XDUA 3H9GA 1K8ZB 1V0JA 4XSVA 2COKA 5AKKA 3B1JA 3BHMA 5DIZA 4YV7A 3FYCA 3LK6A 2XYQA 4MIKA 4QBFA 2FOLA 2BFFB 5KYUB 2X8BA 4XFKA 3ZWMA 3ZVLA 4DL9A 2YRWA 5K8IA 3RJZA 1PVVA 2WJ3A 2HSZA 3GJ6A 1M0WA 1R0LA 3H8WA 4MKZA 1WAMA 2UUPA 1OLUA 1OJ7A 3FNBA 3PBKA 4GF5A 3WV4A 1ZNXA 2GPJA 4TL8A 2JJ8A 5CT4A 2CVFA 5KOHA 2HYDA 1CUFA 1SBQA 3QVXA 1GSHA 4K03A 2C61A 5E1DA 5HZKA 3REQB 1YF3A 4TWAA 1CETA 3B8EA 2XDQB 2Z2IA 3IDZA 3CIOA 3F96A 3D9QX 1BS9A 1H2YA 4BO3A 1S8NA 2BLNA 3QM1A 3VDXA 1IB6A 1QAMA 5BWMA 5CB6A 1VFNA 2E4UA 1KZ6A 2H63A 4LHVA 2ONJA 2BFMA 2A3NA 5A7FA 4GOMD 3EC2A 5T4EA 3COVA 3DXFA 1WDWB 1E3QA 1HDZA 1TI7A 3M6UA 3A1UA 4FYKA 3UHAA 4P4SA 3WGOA 5EVCA 5K6AC 2REOA 4TV9F 5C3UA 4KV9A 2AN1A 2ODWA 4I8DA 4IS3A 1I36A 5KNBA 3RADC 2PAAA 2AQ8A 1ICIA 4CEJA 2PSSA 3HN6A 4I5DA 4N40A 5FB3A 1B73A 2PBLA 5H8WA 3IVRA 3RHZA 3GUCA 3EC1A 3FKSD 2H2IA 3JQDA 1IWBB 3JVEA 4R0VA 3QA9A 5CIWA 1YJ8A 2JH3A 4C05A 1A8HA 3CX4A 3IURA 3OFNA 1PR5A 3ASZA 1F5NA 3WV5A 1ZOPA 1Y3HA 1GUBA 4HKTA 3EXIB 4HRYA 3QSGA 4H17A 4I5FA 5FTLA 1NDHA 4P3KA 4TVBA 2ID7A 1LJLA 2IGBA 5CIQA 3ABOB 3CJTA 1Q17A 1QXSA 4MP6A 1IBRA 1U9JA 4JP5A 1OH8A 3PL1A 2FWMX 2XBLA 1GPYA 2DJIA 1JZSA 4K3UA 1FFXB 2BH9A 5CCBA 1BHSA 1KPHA 2IXGA 3E48A 3EUFA 3I1FA 3OU2A 4TL6A 5FPTA 5JPDA 4IL5A 5G41A 4R6XA 1Z38A 3FE2A 2ZAYA 4MQ6A 4BQIA 3IV6A 3VU1A 1JDTA 4MS1B 2FEMA 2QIOA 3R7NA 1PT7A 1A1VA 4NE7A 3Q2KA 3R0ZA 1T13A 1W30A 1N6HA 2OB1A 4EL0A 2VATA 3CONA 3STWA 4NAHA 1D04A 2KHZA 4JI6B 3BEOA 2AG5A 5FEMA 3PF8A 5JNLA 1ZJ5A 2BEVB 3T3EA 5HDQA 3ZDCA 2A78A 2CNOA 5E7QA 4LDAA 4UVIA 3CZMA 2PGAA 5G3ZA 3RO7A 3OJ0A 5YASA 2CD7A 2Q5JA 4I3HA 1NHGA 3DCIA 3VZRA 1PD0A 2Y9MB 1UMKA 2FPSA 4FN4A 2VT7A 4FQ8A 4INAA 4TRNA 5KYVA 3ABQB 5GGYA 3SVTA 2WSMA 4NV1A 4IHQA 4Q01A 3VTKA 4PYJA 1JSCA 3CYFA 1JKXA 4UM9B 4RA9A 1OH5A 1UDWA 5DB4A 3TLGA 5DBEX 3ZG6A 3KYCA 3AKYA 3I9NA 2BZSA 3CH5A 4QOSA 1XWWA 1VA4A 4B6JA 3EXHC 2HU8A 3P45A 1XYVA 4J29A 4J43A 4RETA 4RQAA 1Q91A 1NBAA 3WMFA 2J9YB 4K9OA 4ER5A 1VI5A 2UZ1A 1M2NA 2WEKA 1PYDA 3ROZA 1M1NB 2ZRCA 3DMFA 1E5LA 3I2IA 3NH6A 2CUZA 3HM2A 3UAVA 5FPSA 1WDKA 1CFZA 1EQ2A 2Z3ZA 3H0CA 1HL3A 3IILA 1LNSA 3RS7A 2A9KA 3ZDBA 1JLMA 2O3QA 3IP7A 3M49A 3Q3HA 4HB0A 2PLRA 1Q83A 1FRQA 4MQFB 3LMKA 4YQFA 3PC6A 4XIFA 5M34A 2FPUA 3ZLTA 4C4XA 1V5IA 1IHDA 1EFKA 4KGDA 4RESA 3BT7A 1KDOA 4PZ9A 1OFUX 5F1KA 1AGXA 3WS7A 3W2FA 4DLBA 1QRDA 3QTLA 4LOAA 1ST2A 1U98A 1R4AA 2OO7A 4J94A 1O03A 3DOHA 3DZGA 4JKIA 4OMFG 4ZOBA 2O9JA 3UMYA 4OGGA 3UJHA 3VTFA 1ZJ4A 2ECPA 3TTUA 4NCIA 5H16A 2XJ4A 3F90A 4XM1A 1K8XB 4AUMA 7ABPA 1G2QA 3KQLA 4PQGA 4LVNA 3I01A 3U0VA 4E33A 1YZHA 4W8GA 5BOVA 2CK3D 2X5KO 2VL7A 1WM1A 1FVHA 4MQ5A 5HTKA 4QXRA 5IYZB 3H5OA 3RAEC 3OIWA 3HNRA 1SXJB 3B5EA 2WTAA 2BBSA 2NO6A 1WF3A 2FXIA 4HAIA 3G7SA 3PYXA 5AJYA 1KKLA 1UFOA 1N2OA 1EP1B 1T4CB 5E7MA 1PGQA 1ZYUA 4ZEMA 5LOVA 2WNHA 1EIWA 1ZUD1 3K09A 2EIXA 1GQQA 3M3HA 5DI9A 5GPBA 3SZ3A 2KMLA 1IQ0A 4FCVA 1IATA 2OCAA 1W4ZA 2C2OA 3PX2A 4P4LA 3GA5A 3LFTA 4R05A 2VHTA 3NRJA 5FTWA 3O8OA 1WMEA 4C7VA 2ATVA 4BAUA 2QAJA 4OHYA 2W6JA 1SZPA 4HLQB 4YI5A 3ZWNA 2IUFA 2WMYA 3IC5A 3T5TA 1L4LA 5CVUA 4PV7A 4H7FA 1X87A 3QI7A 5DSZA 1JQEA 2BF7A 3I9KA 4EEKA 1VB3A 3M6IA 4GQBA 4IO0A 2X7HA 4M8KA 3IEUA 1VQ1A 4C08A 2QK4A 4G8BA 4OSEA 4HLUC 5DK6A 5EMMA 1WMDA 1W2GA 3LH5A 4L3WA 4R2KA 2VF5X 4M1KA 5FTMA 1ZMXA 4QATA 4IV0A 3GVIA 4MR8A 1U5BA 3CVOA 1T35A 1P29A 4ARIA 2XWQA 2XUAA 1I24A 4QQFA 5LZ8A 2OO5C 4K9LA 4LZWA 4UM7A 2DC1A 2F1JA 3LRTA 2ZT8A 2TMYA 4GW3A 4LZLA 4MLDA 3OZVA 4E21A 3EZ9A 2JBWA 4XCVA 3U56A 1A7JA 5JT1A 2NAFA 5ANRB 3U3KA 2C94A 5DYIA 2D5LA 2C7RA 2YN2A 3ZYCA 3EOAI 5CFMA 1D1QA 3TR5A 3UWKA 4KW7A 1DWOA 2Q99A 1R8XA 4OQLA 3WYCA 1QH0A 1X7GA 3OKCA 5TMDA 2IZ0A 3THWB 1O0SA 2GYUA 3Q6IA 1RWVA 2ZUDA 3PGXA 1G60A 3HI4A 4D79A 4H3KB 5DN6D 2JK0A 5CVDA 1N3LA 1ZUWA 4HSEA 4R69A 4DM4A 4F0JA 3ZHRA 6LDHA 1AMOA 4CKEB 3ZXUB 1CQPA 1V16B 4BOYA 4F4UA 3THXA 1WKBA 1YZUA 3DBRB 1M34B 3WISA 4KXQA 2I62A 3WMGA 2H52A 2O8FA 4OQQA 1M10A 1SMKA 5DM60 4IDFA 3JYOA 1KFJB 4EYEA 5KVAA 5JDCC 2HRDA 4Z8XA 3RSLA 4D4JA 1Z13A 3NTRA 2O8CB 4EIWA 2BN4A 1AXGA 3SSMA 2WWTA 1CQWA 2VUSA 1U1CA 2ZRAA 2IUEA 3D5TA 2IIQA 4QUHA 4D57A 3IKTA 3TLBA 4LHSA 1XGKA 1JG3A 2PO5A 3QBTA 4HNSA 4O4HA 3FLAA 1TXGA 3HWX1 3LFHA 3OE7D 1TU3A 2N42A 3PJGA 4YJ3B 4C78A 4A4DA 4D02A 1CE8A 2H5LA 2HSWA 5CLLA 2RGDA 5EXTA 1E5XA 1MFPA 4MUHA 3A9VA 3ILVA 3MYYA 1Z7BA 3P2YA 4LRTB 1BVRA 1JKIA 3BSSA 3VKWA 221PA 5F35A 1P2TA 4BFXA 3EDYA 2B20A 3ZI4A 1FS6A 1Y7TA 4WESA 1J1IA 2RJNA 4FFSA 4PSKA 4JA0A 2B34A 3M3DA 2HJRA 2Q8NA 2CE2X 2QRVA 2ZPTX 3GEMA 3M6AA 2HTEA 4UBJA 5I9TA 1PJ4A 2BP7A 4PAOA 2WUEA 3TK1A 1JLLA 4DJDC 1W0JA 1RFGE 2OPBA 1UJ5A 2H6EA 2VNAA 5C8YB 1IJEA 2D06A 4JU8A 5GONB 2Q3EA 1N1GA 3D8UA 1TO6A 3F49S 3B9PA 2GZAA 4GP6A 4U4AA 3SY8A 3TM5A 4CM4A 4NK4A 1ACMA 1ZGGA 4DCPA 5C53B 2HOQA 5KKAA 3ZZ1A 4PC1A 3WY9A 4P3NA 2ZIXA 3L4EA 1HY3A 1YJQA 4R7GA 4PGMA 3R8CA 5C8DA 3RVPA 2V7QD 1G42A 2CSUA 2VP3A 1H93A 2MOKA 2EKQA 4YJFB 1LS6A 4DHWA 5KVSA 2FZCA 4C2UA 2VBCA 3ECCA 1L4NA 1PEYA 1SQSA 5C34B 5JCXA 3PWSA 3DCYA 5JASA 3IQZA 1CLEA 1J9EA 5ICGA 1E2PA 2HDWA 4JLPA 1SRQA 4RNDB 2W8ZA 1VPVA 2AL7A 1P4HA 4Q00A 2J3HA 3C70A 4WASA 4WFIA 3UKOA 3IAS6 4BTVA 4LF7B 4Q12A 2QI9F 3IBSA 5D3KA 3QBEA 3AQIA 3VSDA 1NI5A 5JZSA 1MVNA 2GVNA 2VRCA 3C74A 3SDBA 3B7GA 2GM3A 3D3JA 3A6JA 5HKAA 2A5YB 4ZO7A 2NLOA 1QQAA 3L7LA 5FLKA 4Q5IA 5ALOA 3SOZA 1UWLA 2GN2A 4R5MA 4HNQA 3E9RA 8LDHA 1TKCA 4CT5A 3ABZA 5KCZA 1JTFA 1GZHB 5DYNA 1ZVQA 2IT1A 2ODAA 3W34A 1YSCA 2PRIA 3VSBA 4F4CA 1GG8A 1V2GA 3VR6A 3EVBA 4Y6PA 4W5QA 1FSSA 3GA7A 3F8WA 1NULA 3OTGA 2ZWMA 1FXWF 1UBOS 1KC1A 9LDBA 3E9ZA 1FP4A 4DRYA 3HMQA 4ND3A 2Y9PB 4LJ7A 1HDCA 3ZHZA 5CDYA 3IIJA 1P4SA 3QX7A 4TLMB 1HDYA 4RMHA 4I55B 4F4IA 1N5OX 4Q4AB 2D74A 3K0HA 4ZOLB 5HK8A 1G7SA 3HJNA 1T9BA 3DXYA 4X7PA 4ENVA 5JV5A 3KSUA 3G0HA 3EXFA 4TV9A 3JWEA 3SIRA 5KS2A 4R9RA 4I81A 1C1YA 4BFWA 1SWVA 3P9SA 5HRUA 2B4QA 5JXWA 3UC5A 3IUEA 1X0XA 2NXCA 1HA3A 1QIEA 4NJEB 2R0QC 2E37A 3J81A 1G63A 1HLDA 3SHFA 4A8PA 1LK5A 1KI9A 1QE0A 1WXDA 2RHBA 3FDZA 3H6GA 2QLNA 4RVOA 3WXMA 4KYUA 2YRXA 3OP4A 4R1NA 3BHIA 3ZY5A 2TECE 4FFVA 4RJ2A 1XCJA 3PXEA 1IU9A 1YZ3A 3LKZA 4DUGA 4YMHA 5BWOA 3OTHA 3LCVB 1MC1A 4C4TA 5JISA 1ZBQA 2FSVA 5EP4A 5BSEA 4P7JA 1NIJA 5K6RA 1R9JA 4LCBA 2FN4A 4OL0A 5FBVB 4CIDA 3KBBA 5A0TA 2IGTA 2HX1A 3OECA 5JNTA 1CP3A 2PDAA 4Q21A 1Z0ZA 4XUCA 2BSAA 2ZBRA 5A02A 5KDDA 1L5YA 2Q0HA 2E85A 4F4DA 4DY4A 3GC6A 1JJFA 4KGZA 2FLWA 3FZNA 4Z9FA 3OURA 2GHQA 1N57A 2Q6IA 4R7TA 4NBUA 5HPYB 3CVUA 4X20B 1W36C 2A9FA 1IN6A 5TQ2A 3P2MA 4HAZA 1QKKA 1XUOA 2ZYAA 1VHTA 4C2AA 4RL6A 1YQQA 2BKVA 4C0WA 4C22A 1DO2A 5JE8A 2W6ID 1PWZA 4PAMA 4M1MA 2JGJA 2HHCA 1W5AA 1AQ6A 3A9UA 3UQYS 2C2WA 1X7YB 5CM9C 1EBBA 3V7FA 5BW4A 1W75A 4L95C 1P19A 3L8DA 1SULA 3L04A 2K2WA 4CU2A 4IH1A 2ONYA 2QS9A 4KMRA 4QIHA 2WA2A 3PGA1 1E2IA 1Q0UA 2KQUA 1FFBA 2GEDA 1ARZA 4P7BA 4IZ6A 3EY9A 1N7GA 1TZCA 4OI2A 4AIRA 4ZICA 2ZJFA 1IPEA 4AJHA 1S4MA 4RD1A 5DT2A 4RORA 3SEQA 2A92A 2PZKA 4TZTA 1X14A 1REQB 4LRXA 5EZYB 2RAVA 1WUTA 1YOVB 3QUSA 5J5VA 3WMRA 3GFQA 4JEUA 4LNHA 1I7DA 2A1TS 3AKDA 1DXOA 3C6YA 2PKQO 2VWQA 5IH7A 3T5PA 1GN9A 2E7ZA 2QAGB 1ACLA 2ZB4A 2XWSA 2G0AA 1F0PA 1GY8A 2HHAA 3UBTA 4QXMA 1FP1D 2HAEA 3IBGA 2CSXA 1X94A 2NVOA 4IILA 3HO8A 2GF0A 4YWHA 5JDCA 2FPPA 1D8AA 1WXEA 4EFDA 2IEYA 4OK6A 4EKEA 3L79A 3WYDA 1QFXA 1I01A 1BFUA 3GMDA 3MINA 1YOBA 3GRZA 2R68A 1BDJA 1AKWA 4G5HA 4KAAA 1CUSA 3GVCA 3BK7A 2X2PA 3ZNPA 3B6MA 4YONB 1ADYA 1V8DA 3ROG