4LMAA

Crystal structure analysis of o-acetylserine sulfhydrylase cysk1 from microcystis aeruginosa 7806
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
318
structure length
318
Chain Sequence
b'MRIAHDVTELVGRTPLVQLNRIPQAEGCLGRIVMKLEGMNPAASVKDRIGTHMINSAEKAGLINPETTVLVEPTSGNTGIALAMTAAAKGYRLILTMPETMSLERRAMLKAYGATLELTPGSQGMKGAILRAQQIVDSIPGAYMLQQFRNPSNPEIHRLTTAEEIWQDTEGQVDFIVAGVGTGGTITGVAEVIKSRKPSFQVVAVEPFNSPVISGGNPGPHKIQGIGAGFIPEVLRTDLIDEVITVSDEEAFQFGRRLAKEEGLLSGISSGANLCAAIQLAQRPENEGKLIVVIQPSFGERYLSTLMFQNIEERELTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analyses of Microcystis aeruginosa O-acetylserine sulfhydrylases reveal a negative feedback regulation of cysteine biosynthesis.
pubmed doi rcsb
molecule keywords Cysteine synthase
source organism Microcystis aeruginosa
molecule tags Transferase
total genus 123
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2013-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lmaA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lmaA02
4D8TA 4QYSA 1K7EB 1TZJA 1C8VB 2O2JA 5KZMB 1E5XA 1Z7WA 1CX9B 2J9XB 3VSCA 2DH5A 1VE5A 4D96A 1UBSB 4JBLA 3AEYA 4D9CA 2J9YB 3DWIA 5DBEX 4D9FA 2BHSA 4D9BA 1J0AA 1K8ZB 5D84A 5JISA 5IW8A 2C2GA 3AEXA 5CGQB 3FGPA 1P5JA 3PC3A 4ZU6X 1WTCA 1RQXA 3SS9X 4D9GA 1KFJB 3IQIX 4D97A 2ZSJA 4L0DA 3IAUA 1UIMA 1TYZA 1K7XB 3T4PA 4I1YA 4H27A 3PC2A 5I7OA 4D8UA 1K7FB 3SS7X 3VC3A 4D9NA 2ECQA 2TYSB 5C3UA 2Q3BA 5B53A 2JC3A 2EGUA 1KFCB 2GN0A 3DWGA 4HO1X 1VE1A 2Q3DA 3L6BA 5BW6B 4HN4B 1TJPB 5KINB 2BHTA 2RH9B 1TDJA 2O2EA 1V8ZA 4D9IA 5DW3A 1C9DB 3IQGX 4XUGB 5D87A 4ZQCB 2DH6A 2ZPUA 1TZMA 1J0CA 2CLIB 2WSYB 3L6CA 3R0ZA 1V71A 5D85A 1A5AB 3PC4A 5I7AA 1QOPB 1A5BB 4L3VA 4D9EA 2D1FA 5CVCA 3X44A 3PR2B 3CEPB 5IWCA 2CLOB 4D99A 5DBHX 1KFEB 5T6MA 5DVZA 4LMAA 3L6RA 1PWEA 2C2BA 2CLKB 4HPXB 1BKSB 1UINA 2GN2A 1VB3A 4WX2B 1F2DA 2ECOA 4AIRA 3FCAA 4L28A 2Q3CA 2CLFB 1O58A 1FUYB 1KFKB 4IL5A 2CLMB 4D8WA 3RR2A 4OFXA 5B3AA 1J0BA 2J9ZB 5I7WA 1BEUB 2V03A 4D9KA 1TTPB 5B1IA 5D86A 3VSAA 1CW2B 1V7CA 4COOA 3VSDA 4KKXB 5J43A 4OREX 5B36A 4Y6GB 2GN1A 2PQMA 1QOQB 2CLLB 4NU8X 3HMKA 1K8XB 4LI3X 3IQHX 4NEGA 3TBHA 1TZKA 1D6SA 2RHGB 5IXJA 1J0EA 2RKBA 1X1QA 2CLHB 4LMBA 5E0KB 3ZEIA 1TTQB 1WBJB 2ZR8A 1K8YB 5HBGA 5B1HA 5I6DA 5I7RA 4D92A 3R0XA 4JBNA 1J0DA 2TRSB 2EFYA 3X43A 2TSYB 4L27A 2ISQA 1K3UB 1WDWB 4ZU1X 5EY5B 1OASA 1PWHA 4HT3B 5DW0A 1Y7LA 3V7NA 4F4FA 1FCJA 1A5SB 3SPXA 5JJCA 1Z7YA 3DKIA 5J5VA 1JBQA 4PCUA 4AECA 2CLEB 4D9MA 1TZ2A 1A50B 3VBEA 1WKVA 3BM5A 5B55A 4HPJB 1C29B 1KFBB 1KL7A 5I7HA 1M54A
chains in the Genus database with same CATH superfamily
3EPRA 1GG8A 2F9FA 1SUAA 3RUAA 4YRTA 3U3JA 4J43A 3SXUB 1QF9A 1S2IA 3PZBA 1KO1A 2X8BA 4FYKA 4RYLA 2VYVD 2OFFA 5K2OA 1YDEA 1TM4E 1QE0A 4TLDA 4P7JA 4BN0A 1CJMA 1H2HA 2OQRA 4JLMA 4IV8A 2Q7DA 1T36B 4AI6A 5CTAA 2RHOA 4PX2A 3RVNA 4XGKA 3G8YA 1EBBA 5I9LA 1EH5A 2C1EA 2C3UA 2D7DA 4BO3A 1VKNA 3EF3A 3ZY4A 4P3XA 3I0NA 3MJCA 3X1JA 3H3FA 1PI3A 4XGQA 1RJDA 4BRWA 2CB9A 3HK2A 3Q9NA 1WZUA 3DEZA 1K88A 2J67A 4NECA 2ACWA 4QUAA 2ES4A 3WLQA 1I80A 5GQSA 3QKUA 4YUVA 1Y6GA 1R9NA 5GP1A 2F8LA 4PTYA 1GG2A 1K6JA 1YB6A 1RXUA 3A32A 5KSWB 2Q29A 2QRVB 4KQIA 1XRMA 3SJCA 4A6EA 8LDHA 2JLUA 2TYSB 2PUAA 4Q6BA 4L6CA 5FNVA 2MOKA 4L4YA 4EEZA 2GJSA 3MLEA 3L6BA 2H00A 2QVXX 1AQ6A 5JW6A 4ZC1A 5EZYB 4MUYA 3UHOA 4Z0NA 1VGQA 4KH1A 1FC0A 1SRRA 2R8OA 4NZNA 1WXHA 2VUTA 1QX3A 3VGJA 4OU5A 5LUBA 3EXEA 2VH1A 3QPWA 3IX7A 2NO6A 1OBFO 2AK2A 1QG4A 2QM0A 4F3CA 4ZZ0A 1N5LA 4LZJA 1KNQA 1TX4B 3EQ2A 3NHFA 1WABA 2G0AA 3MS2A 2NACA 3A1NA 1CEYA 3W7AA 3ETHA 4BZQA 2XZOA 4E03A 4V0MA 4ZCIA 1DAHA 3VR5A 1HWYA 1KAEA 3LVBA 4A36A 2HFKA 1CF2O 2W6JA 1C0PA 1IQ0A 2OPBA 5T8KA 3TZQA 4DR7B 3C24A 1DAKA 4NULA 4L3WA 4P9NA 1MA3A 4DLYA 1VHWA 4I81A 1OC2A 1YMQA 4CG1A 5G2OA 5KJ1A 1J0BA 3VO8A 4OYLA 1ZR4A 3P9RA 1U81A 2GJ8A 3B1VA 2NWQA 4COOA 1ATZA 5JAPA 3IR6A 2AQHA 1JTFA 1C7ZA 3QG1A 3NC1C 4RJKA 4U6SA 2AOWA 4DBVO 2QGZA 3MG9A 1X80B 2XQKA 4ZOBA 4OHOA 3X2FA 3F73A 1NATA 1AD2A 2IEYA 3A05A 2R87A 4C2TA 1XAJA 2WIKA 4GBGA 3VJMA 3VAYA 3GOHA 4DG9A 1O4WA 1P2FA 2OUKA 3QHAA 4PPFA 1UPTA 3NCTA 5EHIA 2Q3JA 3M4XA 5HFAA 3DOEA 5JSQA 3K5PA 1NONA 4YNBA 3VISA 4FWBA 4A0RA 2Q5QA 2X3FA 3F4BA 2VHQA 1V4BA 1AKWA 2BSAA 3PPVA 3N0TA 5CEJA 4YRJA 1TK2A 3OZCA 1FYDA 1JX6A 2YJTD 4OL0A 4HX9A 4YJHB 2FE1A 3P2JA 4BMSA 1XTTA 3QXXA 3WLAA 1PFYA 4IKOA 1OU4A 4RL6A 4X24A 3LCCA 5U9CA 2ZBRA 4X91A 2BGLA 2ZITA 4QRDA 2HIAA 4QO8A 2GPSA 4IXMA 2XMZA 2YQ4A 4ZAXA 2O0LA 3QI2A 4OD0A 1G20A 2REOA 3M9LA 1OXXK 3JYHA 4HB3A 4ZU3A 3AR9A 4A8HA 5JNRA 3H4MA 4AUEA 3L92A 2O2ZA 1GPDG 1V11B 2O3RA 3LLUA 5E1DA 5H82A 3TQIA 3CF0A 3BIJA 3LC2O 2UZ3A 4R3WA 1D9ZA 2H1WA 3WAJA 1X3LA 1NF8A 3F2IA 2IP1A 1EUYA 2SNIE 2XVXA 2ZUSA 4WKPA 1YNSA 1ZZGA 2P27A 2Q2QA 4ZEXA 3MCAA 3PU6A 6REQA 1D0VA 3AEXA 4J03A 1NUAA 3GT7A 2CD9A 1RQXA 1Y5NA 3B3AA 3KIPA 4CU2A 1PX2A 1X8XA 3PQ4A 3F90A 1OOEA 3GEBA 3OM0A 2AUNA 5THXA 3Q7PA 3PC2A 5LPNA 3N1UA 2II6A 3GEDA 4JYMA 5DV9A 3G2KA 3A3OA 3D2CA 1T15A 4JBHA 3PXUA 5F64A 2B82A 5BSKA 3F8SA 4HGZA 2X6QA 3DM9B 1NVXQ 2ZJYA 4IBOA 1YA6A 2CXRA 2Z08A 2AQ8A 4NG5A 1X9HA 3PQFA 3ROXA 4QUBA 3KTFA 1TZMA 4DCJA 1AT1A 2PJZA 4HGQA 4H0CA 3H2KA 4DA9A 4IIBA 1YTLA 1QTNA 4JGBA 3O47A 4FDLA 4GPTA 4JELA 4PSCA 5TJ9A 4R1OA 4D99A 4EUNA 2OKCA 3P52A 4KI7A 4BO2A 2JI4A 4O2BF 5JSKA 3ERCA 5ERYA 4N5MA 3ISVA 3WGLA 3EY9A 1EUQA 4AICA 1W35A 1P5RA 2QLMA 4RH1A 3L4BA 1TNDA 3FWHA 4RF2A 2DULA 1J1ZA 1FTQA 4OFXA 1XMPA 4YALA 5GAJA 3TM4A 2I1LA 3F7NA 1M2OB 1TO2E 3MFQA 1EVLA 4HYQA 1N2IA 5LZ5A 3HKDA 2C4VA 4K87A 3TLAA 1E99A 3OI7A 3WAGA 1GEEA 1V3UA 4BHTA 3FB4A 5FWNA 2C4MA 1JUDA 1R50A 2V97A 4N3AA 3DPSA 3QUBA 4FLFA 2QROA 3FUUA 2CLDX 3WP0A 1J0EA 2PGLA 2WNHA 4AJPA 4KVFA 4MOWA 4C6HA 2OZVA 2ZRLA 1TTQB 2J0UB 3C43A 3R5HA 1Y34E 2P5YA 2YDYA 4JLDA 5LQNA 3LIIA 4WCFC 2C83A 5FNZA 4EMTA 1YVRA 3IRUA 5FR1A 1LBHA 2YHSA 2UYCA 3ADOA 5L6LB 4JC4A 2BGWA 3BFJA 3K05A 3A28A 1W6RA 2PX2A 5ITSA 2NSHA 3KUXA 3OBIA 4LY6A 3SYRA 3CNLA 4NOJA 1AQUA 1UPBA 3PA8A 4L0CA 2PSFA 4GW3A 5EXDA 5EIFA 4CV2A 3FOCA 4GP6A 1A9SA 3ZZUA 2NVBA 2F3UA 2GA8A 2KLHA 2BBOA 5IXSA 2CHVA 2VHWA 4P2GA 721PA 5KNDD 2JATA 4OJNA 4Z0PA 1DKLA 3Q87B 3AVXA 1WCYA 5D01A 3PXDA 2NU9B 3ORFA 4XWYA 1L5MA 4RD1A 2C07A 2YC2C 1ORRA 4H7JA 1W0JA 4Y2UA 2R7LA 4XJVA 3R77A 3D7LA 5DT9A 2G88A 4RZ3A 1ZVMA 5F3DA 3ZZ1A 1OH8A 5I5GA 2QRQA 2HLHA 3O90A 4ILEA 1E3WB 4X8OA 5AXDA 1S6YA 2PO5A 2NM0A 3H9CA 4XLTA 4ZU6X 2RHRA 1G18A 2OHJA 2WWWA 3FYTA 2ON6A 2HC9A 1NE2A 3TFOA 3H9GA 1SVOA 3ETJA 2JLVA 1I3NA 4OJQA 5B7NA 3FIUA 1N32B 4BEJA 4D9JA 6YASA 2PFKA 2HHCA 4K9PA 3GP5A 1W94A 1LS6A 4Q16A 1MVLA 4CE6A 1T1GA 2FYTA 5F76A 2ZTSA 1Z6AA 4IQ4A 2RGCA 5TGTA 4AY2A 5D3KA 2XUHA 1EESA 4JJFA 1VE1A 2IUYA 4XTRA 4B3GA 1Y37A 4Q9IA 1C81A 4XWGA 3OZUA 1UBFA 4KRYA 3RSFA 3DV0B 1D8TA 3P71T 3ZDZB 4JJ8A 1M74A 4GX0A 2XDQB 5D87A 4A92A 2P9EA 3E3LA 4RK1A 2C5AA 5C32A 5ISMA 2AJCA 2DXIA 4LBYA 3VHRA 3KETA 5C5CA 5BR7A 1PTKA 2HMYB 3I3OA 3RSOA 2ZXUA 2ZIXB 2NXWA 2AI2A 4ENUA 3O95A 1BAPA 3LW7A 3PGJA 3CNQS 1YR7A 1A27A 1TF5A 4KV9A 1PR5A 4TTIA 1ZH4A 4JNCA 3V2UA 4KAJA 2QI9F 1H8EA 2I76A 4MS4B 1C30B 1P9RA 1E6MA 1ZXXA 2Q3CA 4AMYA 3CO0S 3ZUPA 4DXDA 2VQEB 3JVUA 3USES 3C8HA 2BLNA 3OMXA 1UBCA 2FUCA 3RR2A 4GBMA 5K4HA 1K68A 1HYQA 1MPXA 1P6XA 5EWJB 4O6VA 3S3TA 1S8OA 1GKLA 4KMRA 4M0FA 2AYXA 4II7A 5IEBA 3CONA 1UJ6A 3FDXA 2ERXA 3MERA 1PO7A 3G82C 4JB8A 1OHHD 3D4LA 4FU0A 4NU0A 2Y4NA 4O0MA 2OT3B 3M6XA 3IOMA 4HMPA 1LLQA 1XZIA 3KLBA 3GRPA 4G5FA 2XYRA 4HLDA 4W1QA 4TWAA 2DERA 4CLDA 2PL5A 4EP1A 3UBMA 2JIQA 3KPJA 3T1YB 2RGRA 3VZCA 4M9XA 2FMIA 3JZMA 4E1VA 1VPWA 1FNDA 2BGMA 2D06A 4LMBA 4AZ3A 4EB3A 1DRKA 2WE8A 3MGKA 1QV7A 1MIOA 1RI1A 3D4BA 1TT7A 4CKCB 2RGAA 1GCIA 4ND3A 1OASA 4G2NA 4KO4S 4KMSA 1OBOA 4LRTB 5L3SB 2IW3A 2C0PA 5FV7A 4G63A 4LY9A 3NHSA 4KPGA 1N6RA 3TBFA 2IS4A 4O4JF 3BMQA 4I9UA 2GZSA 5B7GA 1RRPA 3TK1A 2VJLA 1Y6QA 1D4OA 2IYLD 1P7WA 3VKWA 3GAAA 4KQJA 5DPMA 2AFRA 4MJXA 4HQFA 4KGXA 2CVFA 5AYVA 5IHXA 2Z30A 3SJ7A 4DR2B 1M6NA 1EUDA 3R7NA 1QHYA 3G3EA 2XHZA 4HH0A 4RLFA 5DLYA 5A7GA 2X6TA 2M6KA 4ZJZA 2BFOA 3K4PA 1UBSB 5ICFA 4Q93A 5JAZA 1V41E 3Q5GA 1L9XA 1C3JA 2LRHA 3OOHA 1VL8A 2HMSA 2P2SA 3HV2A 3LE8A 2QAGC 1P6UA 2PD3A 2AFIB 3FMGA 4RNCA 3VNBA 3GBSA 1V95A 2PSDA 2C5HA 4X8HA 3G79A 4ZOCA 2MJLA 1JFFB 5J1TB 4F5YA 3EVCA 4YPOA 2UZ0A 3HABA 3LFHA 3OT1A 4FFRA 4JCCA 4ZOLB 5E9AA 2ZSUA 4BN5A 3THYB 1B8PA 2IT1A 3H11B 3PNKA 5DTMA 1CFJA 1P60A 1WP4A 4V0NA 2YZGA 3RUIA 5IKXA 3TOZA 3WZMA 4YH1A 1SXJA 4X62B 3JVVA 1B42A 1I33A 2OM6A 3IJPA 2HXGA 4QC2A 1KDVA 4O59O 4TQUS 5JYCA 3HDQA 4UD2A 2ZFUA 4XEHA 1I2DA 1VL6A 1EHCA 4ZARA 3UK0A 5BY2A 4WBNA 1PYDA 2B61A 2QUAA 3GFBA 4POAA 3SJBA 1QYCA 1FZTA 2DCMA 3D43A 3PGA1 3Q1LA 1M76A 1Y9AA 4FEAA 3QVOA 4L7VA 4Q9JA 4ITUA 1XTUA 3MVEA 4CKYA 3R3ZA 5CDHA 1C4OA 3GDFA 1EFVB 1YCHA 4GL4A 3T7EA 4M0KA 3OF5A 4FK8A 3TVDA 1TFRA 1RYFA 5D7BA 2OV4A 3OTGA 1J7KA 4FLMA 5DK4A 1UIRA 2IOFK 3KV1A 5KOHA 4YIHA 1GT6A 3E5MA 4YQFA 1EUCA 1SCIA 2HXSA 2O8EB 3E1KA 1YRYE 1EJBA 3IAHA 3VC7A 1IRIA 2W2QA 1XALA 3W2TA 4ZAZA 2JJ8A 1R7RA 4RVOA 3RNLA 2XW6A 4JYZA 4HG2A 4JT4A 3A9VA 4J6FA 6LDHA 1XZPA 3PZRA 3KEFA 5KAMA 1C80A 1Q92A 4OEHA 3MIZA 3OPVA 1YB7A 3TLZA 4WK2B 3K6SB 1YCDA 2JIBA 4WLUA 5CVJA 4B46A 2JIPA 2P3SA 4RZ2A 4ZT5A 1CERA 4B40A 5AESA 3L7LA 2GK3A 2UXCB 1XDWA 4W5OA 4WGGA 1WLYA 3ABRB 3V4ZA 1EG2A 4CTOA 2H29A 3EDOA 1MH9A 5CX4A 5G40A 1YZVA 3AW8A 3NHMA 1QCZA 4MX8A 1VI5A 5C8ZA 4X7MA 3GDGA 4Q03A 1R16A 2QX6A 5DMHA 3RFCA 1DX9A 2PNJA 1ZJ6A 4LRQA 4F5WA 5LM3A 1M67A 1LBEA 2O4UX 3CLSD 3QLUA 5J63A 3VV2A 4WBNF 1WB6A 4HFNA 5K0SA 2O59A 1ZNZA 4H15A 4XGRA 4KJZA 4ZZ3A 4MQEA 2VDWA 4HL6A 4KWEA 4RF4A 3TLGB 2JFWA 2NZ2A 1CR4A 1JKIA 3NAZA 1DT5A 4OTZA 4GMDA 3GK3A 3GPLA 4RQTA 1UWKA 1E32A 1G5PA 1Y6JA 2P1RA 3HRKA 1ZWLA 3GLUA 5A6SB 4DT1B 1IN5A 1YOVA 4P31A 1ECGA 2Z8XA 3DONA 4AJ9A 2EJUA 2NADA 2J3HA 3ZHXA 2RAUA 3PIRA 1M7BA 2P75A 3CZQA 1FTYA 3PD1A 4XR9A 1YTUA 4TN1A 4UATA 3RREA 1B74A 3G5UA 4H1VA 2OAGA 4Y9DA 4C0HA 4BZZA 1XTQA 4EFMA 5JRDS 4HWSA 1OAAA 1X7XA 1NRIA 1K63A 1HYHA 1T8YA 1HYGA 3VKFA 5KQPA 1Z2PX 3OX3A 3CJRA 3OAAA 1N2EA 2JJ2D 3HDGA 4XWWA 4Y2VA 3IB6A 1E79D 1H2FA 1U7PA 1N2CA 3T94A 1GKUB 1LC0A 1XHEA 1DVRA 3ZE9A 1WTCA 3WIBA 2ZWPA 5DHPA 4C2UA 4W9NA 4NZYA 3TOCA 3GJRA 4GOMD 3BXHA 3DQQA 4TLCA 3BA6A 2JAOA 1QHGA 4YRCA 2JCSA 3RC7A 1ZXBA 2WIDA 2QD3A 3PUWA 2WHPB 4PGHA 3TOSA 1GTL1 4CVNA 1LJUA 1KZ6A 4BFTA 3AI3A 4ALKA 1ZN7A 3AO0B 4URWR 4JZKA 5IJAA 4MLPA 5F5XA 4CCWA 2G4CA 2AYZA 3OFSA 4HZUA 2I2FA 2RGWA 3NBUA 3K9WA 3UWKA 1VRWA 1WMFA 1GEGA 1X77A 3W3AD 5KJ6A 1PWXA 2I4RA 1MJGM 3A3NA 4XYLA 2ANCA 3LLVA 2JGDB 4C4PA 4NE7A 3P96A 4OK5A 3EA4A 4WXPA 1BGWA 1UMDA 5DNYB 1NM5A 3AFMA 3X44A 3KXPA 2XNDD 2EV9A 4MJLA 2IP4A 4DWOA 1Y63A 4EMBA 1HFEL 3B7WA 1DIGA 1Z29A 5H7XA 5KTSA 2IZOA 2OECA 2WB4A 4J16C 5K45A 2XQVA 1XXHB 3MYYA 1EJ0A 2WWRA 2XVMA 3CVUA 1FOEB 1HL3A 4KUHA 4FS8A 1F48A 2DP4E 1TIKA 2VRWA 1C9KA 2XE8A 4G41A 2C82A 1OLSB 5CLLA 4JT8A 4S0ZA 4K03A 4Q6WA 4F97A 4WKNA 1HF3A 2GN4A 3S2EA 1CIPA 1PK8A 2DPYA 3E9ZA 2WT8A 1UFVA 2F3QA 3U81A 1DO2A 4GMGA 3LWZA 4XQ0A 1KMQA 3ZY3A 2HWWA 4F4CA 1NW8A 1RR6A 5DDIP 4BJ1A 4M99A 2IDZA 1NYQA 3HMKA 3THXB 3K0FA 4CEIB 2GNOA 4OQNA 3I83A 4P0TA 1ZGCA 4JU9A 1XO1A 3NT4A 3GGCA 2ZJAA 4DB2A 1PR9A 1ARZA 2IYPA 3IHKA 4UM7A 2TRSB 3N28A 1NMQA 3PGXA 5C5IA 4X20A 1U3TA 3A25A 4EGFA 1MZVA 1K0UA 2SCUB 1CU1A 4G8BA 4HUTA 3F6CA 4GOLD 4CKBB 2C96A 1SPXA 1ZD9A 1U9JA 4KLZA 1JKFA 3EAFA 3WWOA 2WA1A 2VJBA 2XE7A 1V6SA 1KJ8A 1D2AA 2PCJA 4MVJM 3HLKA 2BTQA 5BR4A 3R4VA 2ZI6A 3ESQA 5H0IA 3I04A 1UQRA 4WCFA 4XIIA 2ZAOA 5I7HA 1DDOA 5ILGA 2YJ3A 3WLSA 1OFVA 1MV5A 1OWPA 4TKUB 3ZE6A 3KTAB 2PRSA 4P34A 3KSDO 2Z56A 3IAM1 4EHHA 1DTWA 4EG0A 1GJRA 1GL6A 2EJCA 5I7VA 5EFOA 3X1WA 1EGQA 4LFBB 3ZWKA 4E2FA 2CVQA 4D46A 5JJ5A 4LQLA 1AHHA 4DBZA 3D0KA 3OTIA 3V4VB 4YAIA 1R4NA 1G291 1U3FA 1ODTC 3GLIB 1UK8A 2E87A 2YOHA 1ZMBA 1Q5PA 4BV2A 3FCSB 4FX5A 4LW8A 3EFBA 3SR0A 5B1DA 2HGSA 2BBWA 1MV8A 1ECPA 1RMQA 2QQ0A 3RIXA 4MPJA 3A4IA 2FXVA 4Z0HO 3RAPR 4OH1A 2J3QA 4OV6B 4YJFB 2VXCA 5EJMA 2OESA 3FHCB 1PFKA 2OL4A 3HBMA 4AKSA 1UQTA 3JQAB 1ZCAA 4GLLA 2B5OA 1MCZA 1I51A 1V1MA 3LBIA 1XDSA 1LLCA 2J9GA 1MC5A 2JIMA 3HO8A 4JJ4A 4Y2XA 3ZXYA 4D5EA 3GGGA 3EAGA 2PY6A 2FR1A 1JALA 1LD3A 2OOKA 3OLQA 4PAWA 3CLSC 2G9RA 1XD9A 3DBRA 3HGTA 3IKLA 4XE5A 2O8CB 1GZSA 3RF6A 5ADUS 2DMRA 1HDGO 1KY5A 1YRHA 3MB5A 4OMUA 2M98A 2VAXA 2YMQA 4D3FA 1EXDA 1JSXA 3K2QA 2BFPA 1JDTA 1CCWA 2D5AA 3CGWA 1K6EA 4N40A 5F2OA 4Z1MA 4AXBA 2B7BA 3WLIA 5CYGA 2UUOA 2AZ4A 1Q74A 1XUOA 3I5UA 4G1UC 5FLEX 1RXIA 1JH9A 1UINA 3OO0A 2ZCJA 4QA9A 4Z7OB 2IU4A 2NIPA 3FWZA 5JG7A 4P36A 5AI9A 1IOVA 2IHUA 1P9LA 3ADDA 1UXHA 3WGZA 4EI8A 4UBIA 5CVTA 1ZOLA 1FDRA 3MQFA 1P3DA 1NW4A 4RV4A 3VYSB 4P98A 2XUQA 4NCAA 1Y5IA 4FEYA 4W5TA 4U8HA 1ODCA 3DE3X 3NV9A 3F1KA 1R0ZA 3ILXA 5CM9C 2A57A 2XUAA 4KV7A 4Y6LA 2AN1A 2K87A 2Y0DA 5I3CA 5LR6A 1NXVA 2ZIAA 2HI0A 2QMZA 4M7RA 3TS1A 4M1TA 5KWSA 2YNMD 3ZCSA 1KXZA 5U4XA 4IIUA 5HUQA 5KJEA 5BN3B 5JJLA 5BXYA 2I6SA 3TLXA 4LBWA 3G5AA 4HTFB 1Z47A 2UVPA 4JQYA 4MRMB 4PHGA 2NUPB 4P0PB 4R1SA 3L9XA 5BRNA 1XFAA 2D7JA 2RIPA 3CF6R 4BPRA 4LF9B 4GKVA 1PSDA 3GH3A 5HQ3A 1CZOA 4JUDX 3G89A 2OG2A 2ZQZA 1FFAA 2RH8A 1XEWY 4BX8A 1NXTA 3WADA 2A9PA 4MKRA 5EXXA 1OGJA 1I2BA 4A2QA 1VCNA 3DZFA 5DM70 1UZNA 4I9FA 4IFBA 1M2GA 1SQGA 1CR1A 3NM5A 1A97A 1NQOA 2PX3A 1I7LA 1GIAA 2R96A 3FXAA 4FN4A 4QG7A 4HNRA 4ZVUA 4B0PA 4WLNA 1PQYA 4D45A 4CEJB 4ZHQB 1J5XA 2WNSA 4L7QA 4MHTA 1U8XX 4BTEA 5KYTA 1N6KA 3LM8A 4PNEA 1E2IA 1Y81A 3R0JA 4LWPA 3ZVRA 4YJGB 1XJWA 4OAQA 1N8KA 3ZQ4A 3M6VA 1Q1QA 3L4EA 3QKSA 3A37A 5JQGF 2BMJA 4JI4B 1U7WA 3BRCA 2PS3A 2IUEA 3P9ZA 2C0CA 1XZ8A 4JYBA 1D5WA 4PRKA 4RK7A 5TJHA 1CF4A 4JVSB 1S3IA 1GOTA 4TKMA 3RYCA 1B8OA 3HB9A 4FKBA 4XTCS 2PPLA 3KJGA 4N03A 5CGQB 1QRSA 2HF9A 3D8HA 3HJRA 5A3JA 5DMXA 3GJ0A 3N8NA 1ZP6A 3IQIX 3THRA 5KPJA 3SSNA 1RU3A 3MQ4A 2OV2A 1YJBA 4EVSA 4EY4A 1B4DA 2BZSA 4I66A 3HADA 2GRJA 1CY1A 2G9UA 3L0BA 4PAMA 5IDWA 4YBRA 1DRJA 4Z4IA 4C4TA 4LQDA 3EK2A 3KPWA 5F9HA 1Y1SA 1I36A 1AKUA 3UTCA 2DR2A 2ODBA 3H1EA 2NQTA 3KYDB 2J3MA 4KN5A 3VR2A 2OBXA 4AM8A 3GH1A 2Z4RA 5CU7A 1ZL0A 1CKEA 3L2OB 4EHIA 2Q1TA 2LBPA 1BW9B 2OHVA 2RHMA 4MMZB 4PO9A 3HN2A 4AC9A 4B4KA 4BNJA 3PE3A 4IOLA 3VX4A 2RGEA 4X7PA 1LQUA 3S2ZA 1R3DA 1JR3A 1UC9A 4CU5A 3SHWA 2I8CA 3IPCA 1II9A 3D3WA 1VE7A 1VPVA 2MIIA 1L7OA 2WDPA 5KKAA 3HP4A 5JO0A 4N8SA 2VSOA 3GIWA 3T34A 3DL7A 5HRCA 1E0JA 5J3JA 2GLXA 5GINE 2RGNC 1DIHA 1CQIA 1E1MA 3EXFA 5K8TA 5CHYA 3RU2A 4FD2A 3VTZA 3TB6A 1XOIA 1QHSA 3JSAA 1X14A 4QECA 4W8HA 4V24A 2A3RA 1TLLA 3GI1A 3S99A 1W8DA 3IJ5A 4QQNA 2AG0A 5I7EA 1RLMA 3LY7A 4WLFA 1C9YA 1R6DA 1XQ6A 2XGMA 3JWHA 4Z3OA 1JRLA 4D4LA 1EQ2A 3BORA 3F6EX 5H3HA 2OXRA 3ILSA 1ZGGA 3SG0A 4A0FA 3IVMA 2YJZA 2QM8A 2XA9A 3EIWA 2HHAA 2C2HA 5AVZA 3DNFA 3HKBB 4YAEA 2G40A 5CCEA 1RSZA 4CIAA 5AHOA 3B6EA 4PF1A 4GECA 4OLJA 1DXOA 4K6KA 5SYMA 3D59A 3MMNA 3OJWA 3JWIA 2DPHA 1N7GA 4ER5A 1TTTA 3NEAA 4O4HA 4Q4AA 2EFCB 2UUPA 4ONEA 1IEWA 4FCVA 4K9DA 2H4ZA 2A30A 3PUZA 3W6PA 6Q21A 3JWGA 4DLTA 3OZTA 3NVAA 2CK3D 3GV0A 1QLHA 1LK7A 3HI4A 3IT1A 13PKA 1ZH6A 3A1VA 3I34X 3GFFA 4E13A 4PLTA 2I6QA 1ISHA 1ACMA 2XE6A 3CY6A 1JI0A 4J2TA 4NENA 4ZEWA 1O89A 4GQIA 1UOEA 2CLEB 1H42A 2B7CA 3FHOA 3L5KA 5FO0A 2YFYA 4N0MA 4RADA 3TCKA 3WB9A 4EFKA 3HYSA 1OJ7A 3I6QA 4GX5A 3C6QA 1QIJA 1VLHA 2HJSA 1C4WA 4LYGA 5K6RA 3LUHA 2AZMA 2YQ5A 1U98A 3E9CA 4BNDA 3UG7A 3RHTA 2R8RA 1OWNA 2QK4A 3AC0A 3O26A 1K7EB 3PFBA 4QJ5A 1K7CA 3K8YA 4CQLB 1ULBA 3OCZA 5F7XA 1APBA 4PY2A 3I62A 1DOHA 3O8OB 4HYTA 1CUYA 2FSFA 5JCZA 1DCMA 1V5FA 5T4BA 3JALB 1GTG1 1QFSA 4HV4A 3CM0A 3MJ4A 2C9BA 3STUA 3I4FA 3UFBA 1QE3A 4H6VA 1SKMA 1K5PA 3R9WA 4H60A 4OSOA 2GYWA 2ZEJA 1F8UA 2JG3A 1BNCA 4YFYA 5M7EA 2QQFA 5IW8A 2HT6A 5IMSA 1RI3A 5F77A 4DZTA 5JFGA 5DI3A 4PU0A 3EEBA 3CH6A 2WT9A 1ONSA 3IUBA 1UDCA 4BVKA 1ZW1A 3LDFA 3QBEA 2AUTA 4HEA6 1KZGB 4KQEA 2GRUA 5ELMA 4JEHA 4JDPA 1OGIA 3DHVA 4GNRA 2L2QA 3UKOA 4A1OA 1NFRA 2N1BA 2W4MA 3NZEA 4GE3A 4O4HF 2HNAA 2HCRA 3FMFA 4OG2A 3DAYA 2YNMC 2XVYA 4N0EA 1SOVA 3GJTA 2CXSA 4QBFA 2AQKA 4RKYA 5AJHA 3S5JA 3ICEA 3T06B 1IBSA 4TS1A 3GDWA 2HT1A 1N3BA 1GL3A 4B3JA 4EHNA 1J2JA 2HJGA 2Q5FA 4CHTA 1IZ7A 3BZWA 1KYXA 2JFNA 3N53A 4WFKA 3LP6A 4X92A 3ZLVA 1AXEA 2YJGA 5ALSA 3U1VA 8MHTA 4GMHA 3D9QX 2BKXA 4MV8A 1UKEA 2C9DA 2J9RA 4FXOA 1W5TA 4C7OA 4ROSA 3SLGA 2QL7A 1T4DA 3WQBA 3SHOA 5CR9A 2J4DA 3JW8A 5TT1A 5DTIA 3NJ8A 2ZYGA 3H87A 1YUMA 3T3OA 1HDZA 3KQNA 4W5NA 1NKSA 2EJWA 2WWIA 2HYIC 2IYZA 4GZ6A 4EY6A 1BKSB 5AIAA 4A8JC 2OV8A 2CZGA 1TM7E 1S1MA 4DHWA 1YJ8A 2E1PA 1EVQA 2QWXA 2EQ5A 2ET6A 4RY9A 4WFJA 2IX3A 3NIFB 5DXAA 1SWWA 2G82A 4LCBA 1R9GA 2GHRA 1XRNA 3A4MA 4L22A 4FYJA 3TKAA 3ZG6A 5CAEB 5TMEA 1NSTA 1OWMA 1QOZA 1XRLA 2LVBA 3VZDA 3TQHA 1S01A 1B26A 2YHIA 2PUHA 5FTLA 3KHTA 1S89A 4FOLA 4E4TA 4JP1A 4D6YA 5K4GA 1UBTS 1HK7A 3WJAA 2WMNB 4EA7A 1ZIPA 5L95A 4Q7JB 3IKMB 4E6PA 2QYTA 3A6JA 4PR3A 2V7QA 3OQBA 4ZT7A 2C5FA 1YK0A 2XCQA 5LP1A 2G83A 2QT9A 4Z51A 1VIDA 1JKXA 3HXLA 6GPBA 2VHYA 3EZ7A 3IE2A 5EUQB 2VYCA 1A96A 2CLHB 1M8FA 4LDRA 4LYDA 2X7JA 2WD9A 4HNQA 5BVHB 1EJ6A 1FQWA 4XQCA 3RYIA 3M5CA 3U7EB 2GAJA 3UJ7A 1EXMA 2HU2A 2GFQA 2P35A 1QO7A 4MPRA 4MW7A 3OCWA 2BM9A 1FXWA 4BLOA 4IZOA 3DMYA 2FPSA 2QG9A 1YVDA 4GS5A 1N25A 3EZ2A 2AC4A 1Z7YA 4GLFA 1HC7A 1BN7A 4OUDB 3RBAA 1DCFA 5LVAA 4E15A 3E35A 4IRUB 4KREA 3IPYA 4J3FA 1EP9A 1XD2B 3E2IA 3QUCA 4M4SA 3RJMA 4C7KA 1US8A 2QD2A 3GMTA 1ODJA 1DKNA 4N54A 4HNHA 4RETA 2CZCA 3L05A 3L1JA 3G2HA 4KYUA 3D64A 4B3CA 4BASA 4UEWA 3ANXA 3SZ3A 1J2UA 3OQHA 3ITDA 1X7ZB 7REQB 4Y2TA 4C5BA 3WS7A 1N7IA 4FNAA 2AJDA 1FFCA 4ASUA 3BH7A 4XR4A 4TTPA 1QQBA 2HBYA 3WSTA 3DLPX 1RE1A 1VKRA 3AMVA 5JISA 1DADA 4OHRA 3PBKA 3N39C 1AHIA 1OZGA 1EWVA 3DKRA 1SKYE 3JD2A 4GXTA 1QGED 2BFNA 3B78A 4Y0VA 4G5RA 4V39A 2RBKA 3H86A 2WPNA 3A9RA 4R1PA 4K1LA 5BWLA 3T4PA 4TTSA 4ETIA 2VSFA 2FW1A 3W2FA 3BSFA 1G9XA 3HZHA 2OBBA 5AKIA 1YVUA 4N8DA 5LDGA 3RVQA 3N2GB 2XB4A 1FFWA 3K1AA 3HEBA 4NBKA 4PGMA 2H7VA 2MTBA 4Q9DA 4IIYA 1QSGA 4UAVA 3R6DA 1L3IA 3W78A 4HN9A 3U4QA 3BGVA 4FM9A 5EI5A 2F1JA 3B38A 3LUKA 2XCTB 1J99A 1FXWF 3AH8A 4AN4A 1EFPB 4PG8A 4PV7A 1PIWA 3I23A 2ZT6A 3WKCA 1I5EA 5LZ7A 2ZI4A 4WY2A 5AK3A 4QJ3A 4LVNA 3OPYI 3PC4A 3EMBA 3V8NA 4RPLA 5BV1A 2COKA 3EPLA 1UDAA 3FIJA 3WHPA 2XCSB 3UJ3X 2CLOB 3CPJB 1P7YA 2XPCA 3M70A 1F8FA 1DDIA 3O2QB 4Q1CA 4RJ2A 3ROQA 5IPFA 2FR8A 1XZGA 1VE9A 1XAGA 3FYUB 3KR0A 4RTKA 4N7RA 1QU3A 3DDNA 1VA4A 5FO1A 1P81A 4O63O 5KYNA 4KIUA 4RVHA 5ALUA 3MSCA 4C9BA 2P1ZA 4ZYWA 3D1JA 2FWMX 3GAFA 1Y42X 4LBZA 2CL6X 2PD6A 2QY9A 4AJJA 4L8WB 3D6HA 5I9MA 1RACA 4G86A 5D7NA 5AUOB 1HQDA 1CUAA 3K5HA 3B36A 2I4MA 4OAPA 3IE0A 1AXRA 4V1CB 1AS2A 4Q3EA 3L1IA 4HWPA 1ZVJA 1TW3A 3JAKA 4NU8X 2G72A 4EH1A 5FTJA 6ABPA 4RXUA 3T3DA 1FQOA 5F1KA 2BR3A 1Z8FA 1NUSA 2C59A 4FB4A 3OA2A 4OHWA 3SICE 2RGDA 5CVDA 1V25A 1U6JA 1G1MA 3E3MA 1N6IA 4ZVVA 2GUWA 1JHQA 1PDWA 4FCCA 1L4MA 5MHTA 3P94A 4MARA 1DJOA 2JJ2A 3JAWB 4I5DA 4FE3A 4X9XA 5G0VA 5LNK1 3T3IA 1E79A 2Z8YA 2SICE 2O54A 1N9GB 4X6LA 4QU9A 2AN5A 2OENG 1XGKA 3V8BA 4G4SO 3RAJA 2HCTA 4RV5A 2D2XA 1M6HA 2VT6A 3E7PA 3LQQA 5L53A 2X2EA 5IS2A 1ZR2A 2H16A 2A5LA 2Q2OA 3GPCA 4AP5A 3R5FA 2CFSA 4PO3X 3N3BC 4OL9A 1ICIA 2I62A 1U9CA 2XMGA 4YP1A 3S2FA 2FRVA 3R3XA 4AN0A 5DN9A 1QB8A 2F1HA 3VI3B 4BGDA 4K88A 3OTOB 1H2BA 1REQA 2Q41A 1ZH0A 2WD8A 3A31A 4WEQA 5E9WA 1Q77A 3ETGA 3G0GA 1PFVA 3N7UA 1QS0A 2V6GA 1L8XA 4KK4A 4R7GA 1RYZA 1R8SA 3D5EA 3FVTA 2VH2A 4UU0A 4XI9A 1PFUA 3EUFA 1TCCA 4MINA 4KSYA 5CLGA 10MHA 1NW9B 1BXKA 1X9IA 3CT4A 3IBTA 4NRDA 4TTQA 5AK4A 2PH7A 5UKDA 3IMEA 1XRQA 4AROA 4DBLE 3Q41A 4D44A 4OHBA 3AKDA 4KUGA 4OOFA 3RIMA 2A7XA 1LNQA 1DO0A 4XOIA 3N58A 5EE5B 4WVFA 2GJAA 5EWMA 2GEJA 1MXFA 1LFAA 2C2MA 2C77A 1J07A 4DUGA 5BV2P 3ZXSA 2YR0A 3PHBE 3FJOA 5DGCA 5K3FB 1EPUA 4ZALA 3H6HA 3ND9A 1HZZA 5E7QA 5ESRA 2AOTB 4ECAA 2IXAA 3ACBA 3K5IA 3PC8C 4HN4B 1RPAA 4FFNA 5TQVA 4EZEA 1BFKA 1J4AA 3U13A 1RXWA 1KWGA 4XVHA 1C9DB 2JGFA 3NWEA 3HYNA 1W85A 5J58A 1U9YA 2AW3A 1KJZA 5JAUA 1EE2A 3B53X 2E4UA 4FFPA 3SX0A 1DOAA 3F3YA 4D8XA 3BWMA 2JGKA 4XIJA 2BELA 3IEXA 2GHTA 2E49A 3I05A 1NQVA 2FMXA 4NJOA 1UT8A 3TKYA 1OPXA 2DQYA 1JSCA 5BWNA 1X7HA 3QXSA 2ADOA 1LKZA 3ZHCA 3ZY2A 3LG2A 3W0LB 3D2BA 1E63A 1ZK0A 2C9CA 4EO7A 3OZAA 2JA2A 2GCEA 4DW8A 4JP2A 1C1YA 2LV8A 4BGUA 1LRKA 2W6IA 1QRAA 5IJ9A 2D5LA 4IL5A 3HZRA 2XXJA 4QYXA 1P2UA 5I9BA 3LOPA 2O7NA 2FWPA 4QYWA 3CCFA 2CNBA 2I4NA 2KJQA 1O95A 2FOIA 3DMTC 3PFWO 5DGDA 3WBFA 2I2WA 3EZGA 3O7WA 2WABA 4AY5A 1SK9A 4CM7A 3PHGA 1QWOA 2A88A 2WYOA 2VZLA 3HWWA 4PC6A 3FSRA 4IEIA 3RIYA 4F2DA 3V4PB 3SQMA 5AW8A 4RZQA 1VL5A 1SIOA 3DDSA 1Z08A 3SFTA 4CQJA 1CRQA 4JQOA 4DCNA 4INOA 1QIHA 3COZA 4AZVA 2IY9A 4L2IA 3J81A 5JMWA 4DDHA 5GOZA 3P2IA 5AQ1A 5EJ9A 3EZNA 5IDQA 1L5YA 1SQFA 1M6VB 3RRXA 3UJ9A 2FPLA 5IVDA 3ZX5A 1TPZA 2YYAA 3RS0A 2F4VB 3AHCA 5JQGA 1RKBA 4LV6A 1ZJWA 1L5FA 3REGA 4EI9A 1JDZA 4HBZA 5JQWA 4L15A 4BNVA 5EIWA 1G6KA 3KXLA 1O6GA 1NP7A 1XWWA 2WOOA 4LECA 1ECFA 2Z9CA 4MLDA 5BUSA 1H9CA 4FKZA 3C7KA 5A4IS 4B6OA 1BC5A 1W88A 1QH8B 2W7TA 4H35A 4X54A 1Z2CA 3ZWBA 1KOJA 2FW9A 2IU6A 4DNFA 2ZW9A 5TRTA 4YK7A 3Q9SA 1NF9A 4R68A 3L0OA 3SM9A 5CNKA 3FKSA 1LBSA 2AHOA 3VC2A 5KKNB 4OP3A 1VI6A 5EJ8A 1UZAA 3ROKA 2REBA 4IH1A 1Z4MA 3NT5A 4BNLA 3FJ1A 3OE1A 2I7VA 4AWAA 1JVBA 4X95A 3WGMA 3L7NA 1OFUX 4FBLA 5HIJA 2ONYA 3MS7A 4L07A 1WPXA 4UPDA 1SVSA 3GCZA 5H4HA 5HILA 1VP9A 1JDSA 3MILA 5BN1A 2ZLBA 3RUDA 1EWQA 2V3WA 4I9HA 2DFLA 2AVNA 1VKZA 1IMJA 2P6OA 2XAAA 1EDEA 3IR7A 4YI5A 4EHFA 4X65B 1DEOA 2WUFA 4FXPA 2FWRA 2R25B 3TH5A 3N9IA 4XSGA 3AFIA 4KLCA 5CHEA 4B4DA 4ANFA 3E9NA 3ULKA 1SOMA 1EA7A 1NP3A 1Z4QA 2D1TA 4WOJA 5DYYA 2I87A 4M46A 2OQVA 3DDUA 4L5IA 5IZ4A 3AHDA 5JHGB 1GPBA 2XCIA 2YC4C 3GFVA 3O1LA 4IUDS 1UBOS 1MEJA 2PUTA 4CMEA 3RGGA 1SZJG 2EC5A 2CHGA 2V4ZA 4Q4HB 2PIDA 2Y8EA 2ZRHA 3AEKA 4FYXA 4JJZA 3KKQA 2BGUA 3SP1A 3S7ZA 1NOIA 3EGXB 1GQ2A 3FLBA 2NSLA 2RH4A 3F6PA 3K6RA 4H3SA 4KDFA 4BQOA 1VG1A 3NI2A 2BEVA 2DH6A 1G20B 1WLSA 3A6EA 1C1DA 2V54A 3C3JA 3CZMA 1O8BA 1IJEA 1Y4SA 3JYOA 4O2BB 4PHTA 5BSTA 2IKQA 3LHIA 4HGYA 1VLLA 1JQLB 1P0CA 1RBMA 3AB3A 2NT4A 5E2BA 1VCOA 1DEAA 3SYTA 4CUZA 2YNMA 4JSYA 5BUCA 4JLBA 1YIOA 4FGZA 4CMAA 3OQJA 4OP1A 2Y05A 3ZHRA 1YS1X 1TZBA 1MQ9A 1YFKA 2QPOA 2QZPA 2Z95A 3ME5A 3B3FA 4XARA 4JL6A 5IBPA 1MAHA 1H94A 2YUIA 1JPUA 2JBWA 3H1AA 3R3SA 3H9QA 4Q9HA 3SZUA 3UY4A 1MAUA 4FYVA 4AJHA 4YLGA 4BO0A 6REQB 2RAFA 2CMKA 3I1IA 1O94D 3E05A 2ZANA 3EXIB 4TKVA 2X5OA 4WNIA 1W6UA 5HQTA 2PL3A 1KYTA 1PR1A 5HR5A 2JLZA 1KK3A 3CX8A 2NX2A 2ZWVA 2ZYSA 4EFNA 3EQZA 4ZZIA 2WFAA 2RE8A 1TMOA 2W2LD 1YZGA 1TM1E 3DEKA 2J31A 3FRHA 3OZRA 3SHTA 2GPTA 3DOIA 4DJ5X 3RUCA 4CM9D 3W5CA 4NSNA 5AI8A 2JJ1D 4FEGA 1FFYA 1GDDA 1EP2B 3L1UA 5E4FA 3V2IA 1Z34A 2VNHA 1Q3HA 2ZRGA 1LDBA 4GZ5A 3L0CA 2JKYA 4MMYB 3ZH2A 1JHDA 4ZA2A 4F5EA 4PFKA 5ALHA 3H5IA 3ZEIA 3C8DA 2O3TA 1NVFA 4QDKA 1XPRA 4V0SA 1KQGA 3EISA 4CG0A 2KS6A 2A9QA 3IUJA 2IXTA 4G1EB 1WDTA 4EB8A 3QUTA 2VRCD 5F2KA 1Z75A 2ZIZA 3B6JA 3B6MA 2QTHA 2WQ7A 2FWNA 3VO1A 1SEVA 4BFUA 2FG5A 4PICA 3UMGA 2WZCA 4IX9A 1E92A 3PC6A 3KQSA 4LE0A 5CRIA 1HTWA 2X4GA 2NG1A 1CEXA 5GONB 1W73A 5HW0A 4JV5B 2PKCA 2Z3WA 4MQFA 3UO8B 1H4QA 1ZN8A 3IV7A 3Q8LA 1L4BA 4ZXFA 4EHJA 3ORYA 3KQQA 3GCDA 3MTIA 5FUYA 1AF7A 5DP2A 4Z53A 3AV0B 3RTCA 2C2OA 4WXYB 5CXSA 5MF6A 1CX9B 4ESVA 1SUDA 2OFXA 3GC6A 5JLAA 3WGNA 4DZRA 2WSBA 1UMBA 3MA0A 2WFLA 3HKDB 2P11A 4FEEA 2YWEA 3AKZA 2VUHB 4PSUA 3TLEA 1Z2EA 4EIWA 5A9SB 3LAWA 2F3PA 4G81A 3RWOA 4MR7A 1BVUA 5EINA 4ER7A 3EIEA 3W2IA 1TK9A 2GAFA 4TQGA 3H5LA 5EVCA 1JHMA 2VJKA 4RKRA 3C4JA 4M9CA 4HMQA 2UU9B 3SMVA 3KT0A 5EP3A 2Q28A 3CNBA 3O31A 3QNMA 3TTSA 1FX0A 2J3JA 2A14A 1K89A 1SXIA 3ABIA 4NMHA 1AKQA 3GPIA 1BXGA 4XUDA 5LYJA 1JDJA 3T1TA 2RD2A 3GD5A 2HQ1A 5BSFA 5JE8A 3TO5A 5BSVA 3MGGA 2C2KA 1DI0A 3F46A 4EW6A 1ZGBA 5K0EA 1T0JB 2QENA 2HLDD 2AMVA 1E5LA 1M2WA 4CQMA 1M8GA 3NJ4A 4OYRA 3JD4A 3VUEA 2J9FA 4RFLA 4B3TB 3E70C 3NEYA 2VFAA 5KMGA 1U2ZA 3QPBA 1N1DA 2Z2KA 1WF6A 4G2TA 1J2TA 4B2YA 3Q98A 2QMEA 2Q3EA 1EINA 1JEQB 3KE8A 2VEOA 1IBLB 2WTEA 1E0KA 1D0SA 1NAHA 3WLEA 2JCXA 4FSHA 4A73A 3FFBA 3GOQA 1QPGA 5BN4B 4JLNA 2BFDB 4K9SA 1FMCA 5L4SA 3QOWA 4FFMA 1W2WB 4IIJA 3A4TA 1V9SA 3KZ1E 2H1VA 1DBRA 2HK6A 5AK0A 2QMOA 1GRNA 1QHHA 2VAPA 1GV1A 3NO4A 3B52X 4MA5A 4QODA 2HJHA 3GEPA 4WFQA 5AM5A 2IE0A 5K3SA 1V1JA 1IZZA 1EVKA 1A9OA 4IXDA 4YONB 5JMOA 1O77A 5KNDH 4GWKA 4YGXB 2MSNA 4FGJA 4BNZA 3SBDA 1QTRA 1JXOA 1Q2UA 1U3WA 2Q4OA 4XPIB 4BC1A 4A8TA 4HQRA 3NBFA 2B4KA 1G8PA 4JKYA 5KOYA 1K1EA 2B7LA 3UT6A 2R6ZA 2FP4A 2ZSEA 1HLDA 3DBOB 1LPPA 1LI5A 1KZHA 3SXJA 3U39A 1CY0A 3FYHA 5A4KA 1JIJA 5JJIA 5LYJF 1WQ3A 1GXSB 3PFHA 5L9AA 3ZIAD 1V8DA 4ZQHA 3L8MA 1KIMA 2CDAA 2LNDA 2ORED 2HA4A 2QKYA 2YZ2A 1ZSNA 2DKOA 2GCOA 3C4QA 2X4IA 4O4JB 4QOHA 4DCPA 1D6MA 3KG2A 4BX9A 2JI9A 4FNMA 2QRGA 2IOFA 5AKXA 4CEHB 4RHCA 2IC5A 3EVTA 3JPWA 2FNAA 4KOEC 5BN5B 2ZJFA 3EIFA 1WZIA 1J8VA 4AWBA 3SYMA 1YI8A 2JW5A 2NLOA 4OLAA 3O82A 2RJ3A 2ZCUA 1MJHA 4C4XA 1P39A 2Z5VA 3RW9A 5JZMA 3OSZA 5DX1A 1JLSA 5AOVA 5HUJA 5ELXA 4RZIA 2JIDA 4HVAA 1WW2A 9MHTA 4GI3A 4LGVA 4IIJF 4FGUA 4Q19A 3KJIA 3MJDA 3AIMA 3SEFA 3TLBA 4BO1A 4DJJA 3K1ZA 4GRAA 4HLCA 1OYWA 1W49A 5DRTA 1VG0B 2J8ZA 1AGPA 4FNGA 4TMTA 2VRBA 3UWPA 5AI4A 5ADWA 3E0XA 5K0CA 3UJNA 3EZFA 1BFUA 1O94C 4BBPA 4BJ3A 1YH3A 1U7TA 1WL8A 3GVCA 4U9IS 5EKTA 3UMRA 3UGJA 2RBGA 3G1WA 1ECLA 2KSQA 3NTLA 2ODWA 1V39A 2P3LA 4AZ3B 3ZW8A 2HBZA 2ZSJA 5TVGA 5AFSA 4OMDA 2O7SA 4KQKA 4MDHA 4AKHA 2OR3A 3KQTA 3OFKA 2VHJA 1NKVA 1RZRD 2B21A 2NV2B 4UUPA 4L02A 4MB6A 4MW9A 3W5UA 1U9IA 1T24A 3IDFA 1QF7A 4BP3A 2M6LA 1NBME 2Y1XA 4HNSA 1S3SA 4OFBA 3V32A 3OU7A 4HR7A 4DM7A 3P9YA 1H6CA 3BMQB 4CHGA 1ZA1A 4ND8B 2G1KA 2WC1A 5EUCA 3I1YA 4N5HX 1DQNA 4TN5A 1RADA 2WM2A 3VPCA 1BZYA 4IDDA 2ZRKA 3OKCA 4ARAA 3NVDA 3WLKX 2OHHA 2OVBA 2PRKA 1EUDB 3HCWA 3GJ7A 3RBXA 4U7HA 4XM0A 3UA3A 5CVCA 3ED5A 2JIRA 3IULA 1RPTA 3PE4A 2P6MA 3FGNA 3OUTA 4TSRA 1Q44A 1Y6ZA 3KELA 3TZLA 3WG9A 5CFRA 1E94E 2A0KA 3CF4A 2VP3A 4M7WA 3P4YA 4EPVA 5JWOA 1U2SA 1PSZA 2D5BA 2F3TA 1B8VA 1MJ5A 4PC2A 1Z8HA 4B34A 5DBOA 3VKGA 3KQOA 1DRUA 1G1AA 1OTYA 4FTWA 5LJLA 4AURA 3IR5A 2CVZA 1FNNA 3HJNA 4O02B 3CH4B 5BW5A 5K3EA 2P9FA 3F97A 2V1UA 1UMKA 2Z3VA 2EBUA 2WF5A 3OJXA 4DN6A 3QVWA 1POXA 4URZR 4JUBA 3ZEAA 4FI3C 4EI2A 4BFVA 3H5VA 2YFHA 2DLDA 2NSJA 3WRXC 3MHPA 1LH0A 2JHPA 5FT9A 4WBNB 1KF0A 3FA2A 2HSWA 5K20A 1ECCA 2RHGB 1ESMA 3M0EA 2FI1A 2I3BA 3DAFA 5C7YA 3HB4X 1QRRA 4F4UA 2XMRA 2GM5A 4AMGA 1FP4A 1PZFA 3BDVA 4B3MB 1X8LA 3DKKA 9LDTA 3OKAA 1E9DA 4MAAA 1PJLA 2A0WA 2NTJA 2ASEA 3N70A 3A9UA 3TMAA 4DJEC 2A6PA 3L0IB 4A10A 2YX1A 5DNUA 4R8LA 2IYFA 5IH3A 3O91A 1XYVA 5C0OE 1JAZA 5KOHB 3PFNA 1T6BY 2EW2A 5DCLA 2XITA 2ZIVB 3G5TA 3GLFE 3PEYA 3LPAA 1TYAE 5DASA 3T9BA 1JSRA 2NO5A 4H31A 4NJMA 3TSCA 3UMCA 5B55A 2X5KO 2GT1A 5AW5A 5C4GB 1RQGA 3ADPA 3WQHA 3AM1A 1RBYA 3OLXA 4Q1EA 2OGTA 3BWCA 2WUEA 4YJ3B 5ADHA 4TROA 3CRW1 1FEZA 2D54A 1XNRB 2C5EA 1ZYUA 1XZJA 4KFTA 1M66A 3WLPA 1GLGA 2V4MA 5EIBD 5K05A 4DIDA 1O5IA 4H7PA 3AIIA 2O14A 2XUFA 3CH5A 4X71A 5AMXA 3SGLA 2IBSA 1KI8A 2PKRA 3KHUA 16PKA 2ZRJA 2CNWA 1J9ZA 1G8KA 5BUZA 2FPGB 3RANA 3HR7A 2WWYA 1U9ZA 1XC7A 2FETA 2GYUA 5IEJA 4K05A 4CV0A 2JD0A 2O3QA 2PT5A 1FLVA 2GD0A 4MP3A 4INPA 4L6AA 1P1BA 5KNCD 1VFPA 1W1IA 3FTQA 3PA6A 2W8BA 4MQEB 3RSSA 1HX7A 1SUFA 4I6JA 3GNTA 4MI6A 4EMUA 4L5YA 3NKLA 2CFIA 4Q01A 4D3XA 2IZ5A 5DSTA 3R76A 3VR4D 2HF7A 3VX3A 5JMPA 3GN2A 1YOVB 5KTTA 3WR5A 2OZPA 4WUVA 1R5JA 5G0TA 2I22A 4J7CA 4LDPA 4Y2SA 3UF0A 2QTVB 2EOAA 1N0UA 4IHAA 2ZYTX 3Q12A 5SV2A 1WV0A 2GHIA 4UOZA 2G4VA 4ZV9A 5GJBA 1UL1X 2V59A 3I9JA 1AZTA 3ZV6A 3SR4A 1CQPA 2CDRA 1G38A 3HEAA 4UVDA 2D2IA 1U0JA 2W43A 2NW6A 2ZUWA 2OO5C 1JIQA 1LNSA 4JXKA 2ODTX 1NVVQ 1IK4A 2WYHA 2AX4A 3EZLA 3Q8WA 3LYHA 1N2CB 4H4EA 4QXQA 2BFEA 3M4NA 3F6SA 2JK1A 2VPZA 4E14A 1MNAA 4CQLA 5E0OA 2I71A 2NV0A 1VHTA 4UMEA 1ML4A 1LSOA 1XZFA 2ASVA 2GVDC 4LUCA 3T7CA 1N92A 1IDOA 1J20A 1RXEA 2HQBA 2YCBA 2POQX 3NT2A 4HXYA 3NHWA 1B93A 4MI3A 2C5BA 3ITKA 3T7KA 1PR3A 3ENWA 4B75A 2C7PA 3E15A 1SBNE 3HTXA 3D6TB 2CZQA 1ZM9A 3G1TA 5CGZA 3KJFA 1KU0A 2FLWA 3HN7A 1W75A 4MGIR 1MO4A 3RUEA 3KV3O 4TYWA 4QUHA 5GADl 3IQHX 3DZBA 1GZ6A 4ZZ1A 1N2XA 1P7PA 1I3OA 1RHKA 4LOKA 5HJ5A 4ZVQA 5CYFA 1P9WA 5E0KB 5L3ZA 4AKGA 4CJXA 5LQSA 2ZR8A 2CF6A 2IZZA 4LYEA 5BOSA 4ARZA 3KOXA 1LBTA 1XNQB 1NLYA 1QNLA 2O2XA 1OWOA 5TMBA 5ALJA 4AP9A 4KFCA 3MEQA 4X44A 1KERA 1P45A 1UMCA 4OGKA 5ILQA 3CIFA 2Q99A 5JS6A 2OO7A 3LD9A 2WYWA 2VTBA 4FWTA 5AHWA 3L6UA 4KQFA 1GQQA 1K6MA 2RC5A 2Q46A 3DV9A 5DF1A 3ZZNA 1MJGA 3A6DA 1FP7A 1NUQA 3WK9A 1J25A 1COWD 1XAIA 4EX7A 4HS9A 5IVIA 3EFEA 2C92A 4LYYA 3M8KA 4M7OA 3P0HA 1W36B 3W3AH 3V9AA 1SBQA 1W0KA 3L43A 8OHMA 1PQUA 4HX5A 1JIXA 1VB5A 1CIJA 4MKIA 4E22A 2Q0QA 3L07A 1MT3A 1KIFA 1ISPA 1KJ9A 3TB4A 2UZAA 4ZO7A 3NBXX 5ERXA 3TW8A 4QLBA 3V3KA 3Q2IA 4RY2A 3U9TA 4IMRA 4X5OA 5K6AA 1BS1A 1L7QA 4TMXA 5BMVA 5LJIA 1Z0ZA 5IJ0B 1H3NA 1VPLA 1QC5A 4M1WA 1C50A 2CE2X 4RVSA 3V1NA 4LZLA 4P84A 4YCDA 1QH1A 1X70A 5ES3A 4A5SA 4PTLA 2J45A 5HA5A 3UH1A 4Z1OA 5EIXA 4RE5A 1QGAA 1ADJA 4YAJA 1YI1A 4KMMA 3VAAA 2AWNA 2PZLA 2YN2A 3FH0A 3AEZA 1B6GA 5LP6C 1OXVA 1KVQA 1SIUA 2ZB4A 1JDPA 3FSJX 4YMWA 3BKXA 4ZWNA 4DGSA 2GXAA 2HCJB 3TIXB 4Y1EA 3EIUA 2VRNA 3A7DA 5ECWA 3ZJYA 1XTVA 3C7AA 3ZGNA 2R6JA 5K09A 4PZPA 3NPAA 1QUFA 4ND5A 1IUNA 3CF4G 1GY8A 1OAKA 3I6YA 3I8XA 2D5CA 1IBMB 1A4IA 2YZMA 1LS1A 1QDUA 3M1AA 1IIRA 4MVJA 4CT0A 3ICQB 1KQFA 1P7CA 2YJ5A 3NHKA 1BOFA 2VHZA 2WU8A 3STWA 1ZIYA 4YRKA 2BZ0A 1XB2A 3GVXA 2PKYX 3I73A 5JXJA 1OROA 3E8SA 1X7YA 4M37A 4QT0A 3UJ6A 3II6X 4A6XA 4UUBA 1URPA 1R4NB 4PSVA 3E53A 4Q9NA 2HJVA 1O58A 3OCXA 2WUDA 4UMFA 5ALEA 5JATA 2CNDA 1OCEA 1M8KA 1PQWA 1VLVA 2FG7C 2C3PA 2H1FA 3A10A 3B1XA 4FIZA 4MSUA 2PWYA 2B5VA 4M2LA 3DZCA 3HSYA 4HX2A 4XVUA 3U61B 5EIBC 5BMVF 1SHLA 1AMUA 1GTZA 1AS0A 3HS3A 4ZGGA 2PJUA 3QKTA 4X7RA 1AKYA 4LRSB 4MYSA 5HGJA 3DAHA 1YZYA 3OJFA 1W5FA 1Z0IA 4R1MA 1V4NA 2P91A 2GOYA 2XYGA 4XKJA 3ZV3A 2XUIA 1AO3A 1ND5A 2P9YA 2ZT7A 3LX4A 4LTMA 2ID7A 2WILA 2PE5A 5EE9A 2VJYA 2V7BA 4DJTA 1CSEE 4CFZA 1PVOA 2OCXA 3DDZX 3PCXA 3CB4A 3IKJA 4RA6A 1SXQA 4BZWA 1EWTA 4PLWA 4CL8A 4JEUA 5DTJA 1DJLA 1RHJA 1CRLA 1U0GA 3IVGA 3WB0A 1C41A 4Q7MB 5J2UA 2O0MA 3DC7A 1LK0A 1KSGA 5F7OA 3P4XA 1J1IA 3C97A 2AOVA 2Q4EA 2A9OA 1K97A 5EXEA 1VFNA 1GGFA 2O1WA 2GEDA 5F2EA 4LJYA 4BB9A 1MB2A 4MYHA 2P6UA 1YGYA 1JBQA 3EDYA 4NLLA 4MVJF 4UJ5A 3AR3A 4GE0A 3EOBI 1UBGA 3K7EA 4JKIA 1HE4A 3EXAA 4AIIA 3JQCA 5J23A 1DTSA 4GXNA 1MNQA 1N0VC 3DGFC 4HDNA 4JXZA 5JVDB 1SBTA 3HY3A 1MABB 2CXNA 5GZ3A 2N0SA 4MP6A 5A3QA 4F6CA 4OK6A 3DLTA 1SVLA 1YONA 3UXMA 2BVNA 1FP6A 1ORWA 1TEXA 2HCFA 1NBIA 3QLVA 4MH0R 3RHFA 5ALMA 3RJ9A 3E9RA 5CA1B 1DMRA 3FRIA 1AV7A 1DV1A 1XLUA 4FT2A 4RVUA 3LHKA 1I3CA 1XLTA 1O0SA 1FDOA 3RIEA 2PZ8A 2I6UA 3TEJA 1KBQA 4LWQA 2IWRA 3S1SA 4DIMA 3A1DA 4X84A 3HV0A 1YBVA 2X5JO 2DFTA 1UXJA 3CZ5A 4RD2A 3T4UA 5HVNA 3RAGA 1LZKA 4BTVA 1CQWA 3ESDA 1WVIA 2B99A 1D2MA 2PX6A 3GZ4A 3VNSA 4B84A 4V02A 4GC5A 5HQ3B 5K8CA 4RTPA 3JQ8A 2EBWA 2QHXA 1NVMB 1OAOC 3KOWA 1WD5A 3KFLA 3HZZA 4DIFA 3UPUA 3AYXB 2WJWA 3INGA 1Q1NA 4FGSA 4EITA 2Y68A 3UHFA 5J2UF 2IUUA 2GILA 4S1PA 4ZMBA 3KVOA 3ZHUA 4DTIA 3TD6A 3F5FA 5JR3A 4MW1A 3TRDA 2BEUA 1Q0LA 3DEYX 4FMDB 1JHAA 4G0XA 2QRPA 1LPAB 3GG9A 1S0UA 4CM9A 3WGIA 3TLYA 5K0ZA 5COQA 5CD9A 1JN0A 4I9GA 3ROFA 1ENOA 1QYXA 3QLTA 2ZWMA 1KMCA 1V3VA 2WK1A 2MDTA 4FFBB 4YAGA 2P0EA 2H8GA 4PYOA 2HPVA 2JFVA 1YI0A 2DSTA 5CLFA 5LL6P 4DC9A 3OQIB 5HXAA 3HSKA 3DTYA 3B12A 3O8QB 521PA 3HPQA 3M6IA 2YRWA 4IHQA 3RC3A 5TQJA 1NMYA 4DDWA 4KCGA 1XHLA 1JZTA 4YROA 5C5EA 3UANA 3P4UA 1G98A 3KB6A 5M29A 2BH2A 2V03A 4JGIA 4PCAA 4RFSB 4YO7A 3FLEA 2IITA 4GPEA 4CG2A 2ZGVA 2CJWA 1HNNA 3N6RA 4LN1A 3HFGA 2IGBA 5LQMA 1OE0A 1XWIA 2VPXA 4G1BA 4MWBA 1EGHA 4EJSB 5JS8A 2W6OA 3H4VA 2NSYA 1E61A 2P9TA 1CBUA 1AF4A 1AMNA 4N6GA 2OXTA 1XSEA 3ZV5A 1FXSA 5A03A 4IDCA 4R6XA 2RI0A 4KPUA 1QZUA 4YP9A 2PLRA 4MGEA 1FUUA 2LP4Y 2QPTA 1GSIA 3GFRA 4N5IX 3TPCA 5CDYA 4ENWA 2CSXA 1NFFA 3VH4A 4TVSA 3OP1A 1DBIA 4IVQA 4NP6A 3CUTA 4PO8A 1C8LA 4IV5A 3HM9A 2WB2A 2F55A 1A8SA 3O92A 3UAGA 1OYYA 1X19A 3D6NB 1XZCA 4Z2AA 3IGFA 3HDJA 4LCEA 2Z6VA 3EXFB 1CQIB 2Y1FA 1ATIA 2HMWA 5ES4B 1CZRA 2H1SA 4G23A 2EJTA 4MIYA 2PLAA 1MRSA 1M2FA 3I5MA 2ONJA 2PYZA 3K9GA 2C20A 1X2EA 3OEYA 1NSYA 1E6EA 3AY0A 4IRMA 4RK4A 3AIKA 2HWKA 3E61A 3EOZA 3W2GA 5KC9A 3QPVA 5KWIA 1ICEA 2IEBA 2GYYA 4KXUA 4QNMA 4QWWA 3QITA 2FRDA 3ZN2A 4EPYA 1SZCA 2PRZA 1HT2E 4REOA 3BL6A 3L4KA 1DJNA 1G7CA 4FHDA 2PANA 2GR9A 3WJ2A 4MUAA 3L06A 1FS6A 2ZRFA 3ON5A 3IUSA 4E12A 1PJSA 3GA5A 2OLKA 3QVMA 5FPQA 5L3RA 3WFZA 5JASA 1P7VA 1Q6ZA 1GTJ1 1FUEA 2K2WA 3JQQA 4P4TA 4JROA 2HJ9A 2H2WA 4BNIA 1K8ZB 1WDMA 2VH5R 5D84A 2Y66A 1ZM2A 4MQ4A 5ENVA 1HL7A 2P2ZA 1NV8A 2QJRA 4DLPA 4JUIA 3CUUA 2C9ZA 3VJLA 2Q1XA 3OE4A 5HMMA 4C07A 3N3AC 4AUMA 5A0TA 1E9BA 1G7TA 1M2VA 1ZXLA 4HQKA 2H63A 4F3NA 2GNAA 3MUFA 1E64A 4N1AA 2XDAA 4RIFA 3WMFA 2G06A 1GUFA 1QONA 2IBTA 1L7DA 4IS2A 5IDVA 3E22B 1P3Y1 1TT5A 4H27A 4MITA 3A1EA 3JQ7A 4FKMA 3PUKA 2AFIE 4G56A 4JKOA 4O25A 4DRZA 1ENPA 3VZPA 1JG1A 3W9BA 1EGMB 5JJBA 3UJBA 3MOGA 2BRUA 4MVJG 4WBXC 3Q8KA 5HF9A 3AR4A 5TPZD 3CB2A 5DKFA 1B15A 3LLCA 3U4DA 4A1FA 4CIXA 3MS4A 4K6CA 3BK2A 2P0AA 2A84A 2ZQ5A 3KZVA 4M98A 4V2UA 4S1TA 4X1KA 3WTCA 3I61A 3WDLA 3LUBA 3DAPA 1ZHOA 4WNYA 3ZZMA 5MN5A 4V3BA 1HKUA 4HAYA 2CEAA 4EPTA 5I7AA 3HZOA 4IJWA 3PEUA 4MWDA 3NLLA 2O8BA 2FSVC 4M1MA 2CHUA 2OPHA 1WXDA 3FCXA 1GSAA 4NF2A 1C2TA 2B3DA 2QB5A 3T4EA 5EP2A 3V55A 4FDAA 4CKEB 1RP7A 4WI1A 2CUKA 4HXEB 1JXAA 3RQIA 4M9UA 1NBMA 1QGYA 4GLOA 1AKEA 3ET5A 1I14A 1I2CA 3O5AA 4KACA 4AAYA 5EESA 3J81k 1XN4A 5LWQA 5LZ4A 5DI3B 3SX2A 4Z6KA 1W52X 5I4KA 2BM1A 5G02A 2ZJZA 8ADHA 4A0QA 1NQAO 5C1PA 5TIIA 1SEPA 1XMJA 2AA3A 2C5GA 1PZXA 1H0HA 3B1JA 2IQ5A 4MV5A 3BHIA 2FQ1A 3VMFA 1EWYA 5L3QB 1OI3A 2ODAA 3D02A 1DEHA 1XU7A 2ZVDA 3G0OA 3N2KA 4GICA 4JLWA 4LWZA 1NVAA 3ESAA 4NMWA 3K9NA 4JSTA 1E2BA 4X1IA 2OC9A 4CR8A 2I3DA 1FS4A 3DF9A 4F3TA 5LMUB 3R8XA 4S05A 3DXYA 1MX3A 3IURA 2ETVA 1P73A 2G77B 3SKXA 2XA2A 2FWBA 3DO6A 4IXNA 4BNFA 4BKQA 2FUG1 3H0EA 4Q48A 5AJUA 4DQUA 2I6FA 3ASVA 1NASA 1QK5A 2R62A 2AG6A 1HURA 2D3WA 2BP7B 4ITRC 4TGLA 3IBSA 1E20A 1N8SA 4MW6A 1MC1A 1V6CA 2ZDHA 1DCKA 1GFZA 1Y3IA 1YS2X 2H4JA 2R65A 1M1NB 1E1QD 2XR1A 1SQ6A 3QVGB 2D5IA 3UAYA 4DJDC 5KYGA 4Z9FA 3PXAA 1YT5A 1YR1A 1M1XB 3L9WA 1TKBA 3PX2A 1J06A 4HBGA 3DYIA 1YVEI 2HREA 5FA8A 4JHXA 1EGVB 2DQ4A 1QTIA 1BHQ1 5HKAA 5JSZA 2BTOA 5HQJA 3FPFA 4KAFA 5CMLA 2QPLA 4IDQA 1MDFA 2DH5A 5KSOA 3B1FA 3E8MA 4Q1AA 3ZHVA 2OV1A 2VQ6A 1I1NA 3PHIA 2OKGA 3W1EA 4BAUA 4D0SA 1KDRA 3OQ1A 2OCKA 4NR0A 2G6BA 3TQFA 4NL4H 4ZFNA 4JDUA 5K0GA 2I9KA 1M8JA 5H9VA 2YYZA 2ZVPX 3H1FA 3HNPA 3GLFA 3ER9A 3SS9X 5AXCA 2JGRA 2AYYA 2AJ8A 3RF7A 3VR6D 4B4UA 1H93A 3AEQA 4L0DA 2UAGA 5FPYA 4BCCA 2UUAB 1XMIA 4PYKA 1L7MA 3OQPA 2DSNA 4RGYA 5COBA 3JD3A 4P53A 3SC6A 2O5EA 2BMDA 1UZMA 1WEHA 2NGRA 4N9WA 4PZEA 4LI0A 4RHFA 3WICA 2QNIA 4CM4A 5FHQA 5K0FA 1G66A 3RRFA 1XMVA 4C1NA 1ZUWA 1M0WA 1UKCA 2NZVG 3C16C 4YLYA 1VIYA 1HT3A 3A11A 1HFJA 1HOXA 1KFCB 3LXMA 5B57C 2C29D 4KR2A 5J59A 3AUSA 1ZCBA 2VQSA 5DYTA 2ROQA 1PZMA 5K6TA 1X2BA 3HA3A 3DSRA 4Y6PA 1PE0A 3ANTA 3BD7A 1SRQA 4BWFB 3IHTA 3WQSB 3SQNA 2I6TA 5CDFE 2C84A 2YZ7A 5KSYA 1T36A 1W4RA 4R9VA 2JD2A 3AU8A 1II0A 3DCYA 4YRGA 1SVMA 4IFIA 2VTVA 2R1VB 3TUIC 2IS1A 3SD7A 1JFSA 3NAGA 2ZE6A 3OEED 1WCIA 3QXCA 1H4VB 1NLUA 5EEGA 4DF3A 3AILA 1TL7C 1D6NA 3BK7A 3QKRB 2J7PD 3MCTA 2RKWA 3WL8A 4G84A 1XJ0A 4D79A 3FTFA 4C4OA 3AERB 4TQ9A 4YAUA 5IBCA 3ROEA 4TM8A 4V03A 3AHHA 1BE1A 2B8TA 2O4CA 3OIGA 1JDBB 1FUYB 2HK9A 1N2JA 2QRVA 4U2KA 5T57A 2B0JA 1IG3A 4FHCA 4R8RA 4BP1A 4I55B 4ARCA 3AWIA 3B1ZA 2IVFA 4BKUA 1XXHE 1UJMA 2ZTMA 1GPJA 1NNUA 1U2RA 1E7YA 4OOEA 1O97D 1IZYA 1PU2A 3AJ9A 1QDEA 2QG6A 4RDCA 4CL0A 5EZYA 1A1SA 3H4TA 3F7OA 2R84A 1BQ3A 2XZPA 3EVGA 1IXYA 2ODEA 3T99A 3OMWA 2PWPA 1F3OA 1CS4C 1TECE 4KRXA 3HA7A 2DHCA 4M38A 5F51A 1IXRC 1UZLA 3BFXA 2MT9A 2HBRA 1CJUC 4QJBA 1Y8RB 1TYCA 2IU3A 1PGOA 3UPDA 4UOEA 3S8EA 2VHVA 3E27A 3JCZA 3CE6A 3HUFA 2PZAA 2QZ9A 1VDMA 4QSMA 3V46A 1VXOA 1E2JA 4IV0A 4P7BA 1XJQA 2KHZA 3G8DA 4N39A 3WQQA 1YASA 1TM2A 2EX0A 2AXPA 4PFJA 4QOJA 2BDUA 3OIDA 1M33A 3A1WA 4FZRA 3HJUA 4LMPA 5CG1A 3GXOA 3VHXA 3K2EA 3GX1A 2KB0A 3AR6A 5JBIA 3Q7TA 4HPJB 4M1ZA 4UPVA 2Y1EA 1JFLA 4U4AA 1R0BA 4HB4A 4HFRA 4WERA 3GHHA 4TS9A 5D51S 2X2PA 3K0HA 4F9TA 2P2DA 3COPA 1EJ2A 1E5XA 1PK7A 1VLMA 2CFTA 1Q7EA 2VPWA 3LHFA 4J0KA 4MULA 3WNBA 4TZ0A 5L7TA 2O2SA 1G0OA 1G5FA 2G1AA 4N49A 3I45A 1W19A 1DOZA 4KK3A 4GR4A 3ZWAA 3QELB 1UBHS 5IK2A 4BNTA 5CIQA 2BJHA 1LPBB 2QZ4A 2DF8A 1U4SA 2TMDA 1U0LA 3VYRB 5EZYF 3KB2A 1KVRA 2P9BA 2IODA 2VSYA 4YAFA 4RVDA 3BQMB 2P1DA 4YJHA 2GCNA 5DE3A 5FKJA 5FH9A 1H5NA 3E81A 3H2IA 3WKAA 1GAXA 2OV3A 3VR3A 3ONWA 4MZDA 1UBMS 4YX9A 1W93A 3JQBA 3CXRA 3W5HA 3FHLA 4EW3A 4CL2A 2G6TA 4QYIB 2JB9A 3QG5A 5AKEA 2IYXA 2Q3BA 3L8HA 3LKZA 1SUSA 4HXGA 4EF4A 3GLIE 3NDPA 2KBFA 4G26A 5CFNA 2O5VA 2EZUA 3RV3A 3U7JA 3C3MA 5ED4A 1XVUA 2OCIA 2XI4A 3S81A 4P82A 3N5CA 5JNWA 3DZDA 3GRKA 1UXKA 2QTMA 2JI7A 2C8VA 1Z8NA 2CLIB 4KYIB 1JAHA 1RAEA 2QOEA 3AJDA 1XAHA 2N46A 3E4DA 4G0YA 1OAOA 1REQB 3U16A 4MVJP 5DULA 1N4DA 2C8JA 4N6OA 4YP6A 3GARA 3QF7A 2CL5A 4LSGA 4MDEA 3FTDA 4OLBA 2X0FA 1X94A 3ZOKA 3O0TA 4CLEA 3CUEF 4Q3AA 1JA1A 5BQXA 1NQUA 1JIKA 5DP1A 3IPXA 3IUPA 4GR5A 2G8NA 1GZ4A 4NIMA 3FNGA 4HNAB 4P32A 5L7YA 1GZ5A 1BGXT 1YQWA 3DXZA 4HDQB 2XRZA 3AQIA 2P78A 1UXOA 3GGDA 4KNVA 1LX7A 5TQ2B 1EIWA 2IYTA 4OM8A 3HN6A 5FAXA 1ZM7A 5CH8A 2OD7A 3AEUB 4ZCLA 5EJ7A 5I7WA 4LC0A 1I7PA 1BMTA 2B9VA 1YS6A 4C5AA 1I2MA 3GYGA 3TQCA 1XYYA 1YQXA 1T3HA 4UXIA 1JSZA 1DRWA 1P2BA 4KHZA 5IT0A 5KSPA 3X2EA 4QYTA 1WMBA 4D5GA 1PWZA 2Q50A 3KR2A 3ZCQA 4NTZA 5LIPA 4NX2A 1M1UA 2WAXA 5AO9A 1YC2A 1D6SA 1ZBDA 3AOEA 3L4SO 3Q5DA 1XFDA 4NEHB 3ZU3A 2VDVE 4BQEA 4R71A 2ZM5A 4FYIA 4J1TA 3RYTC 3BTVA 4FDMA 3UGKA 3TGWA 3GLKA 2CLCX 2YTZA 1Y3BE 3FROA 5AVWA 1NWCA 1BRTA 5P21A 4MS3B 2IF0A 3EVDA 2G0NA 1B16A 2VHCA 5CT6A 3UMVA 1CC1S 4BFLA 1AQLA 1J0XO 1XZKA 2BFMA 4AYWA 2VF4X 1P9NA 2WSMA 5DYIA 3E7DA 1Q7BA 3QE0A 4QTTB 1DWOA 1L4GA 2NYUA 1ULSA 2A4KA 3EIHA 3MTEA 1E2MA 3VYWA 4JI6B 1XTRA 2ZXEA 4DDKA 1OY1A 1IOLA 1GP2A 4UNRA 1OH5A 3BM5A 1Y3FE 1M2OA 1YHNA 3RSZA 1PT6A 4RF5A 3BWBA 3FETA 5EL0A 3WNQA 5IJ9B 2VI5A 3WGJA 2PTGA 4Y9RA 3BZUA 4C4SA 2RGBA 3DM5A 5HP4A 5FBHA 3DR3A 3W2EA 4H77A 1VHLA 1C5KA 5BP7A 3U6KA 3P45A 4WLEA 1XPUA 1YZFA 2P5SA 2H1LA 4IIGA 3P0RA 2XZTA 3VDQA 5ITVA 5CB6A 1WMSA 3PDHA 4BUCA 1CNMA 2J3LA 4D96A 4F2HA 3K6JA 4GMKA 3L6OO 4LMRA 1PN3A 4N3NA 4TYPA 5FYQA 7ADHA 1VL1A 2I4IA 3LPMA 1GL7A 4CLRB 4L95C 2J0UA 3QY9A 2GCIA 5CD1A 4JVNA 4M0UA 1C0EA 4F4IA 4NG4A 2W48A 1YZQA 1UT5A 2PMDA 2XSZA 4TLAA 2JFBA 5CNJA 5FOVA 5I8ZA 3RD5A 3WOVA 4L2IB 3B9PA 3NIGB 3UHPA 1GFSA 2ZTLA 4YEDA 3Q2OA 3GRRA 1Q91A 4JOBA 1RAFA 1YRLA 2QYOA 1O97C 1T3GA 2BEKA 2VF8A 3KLMX 3LU1A 4L4ZA 1QIKA 5CDSA 2GHQA 5KDDA 3HA5A 5D3QA 1WD7A 1K7FB 2Q49A 4HVCA 1KP2A 2HKIA 5JQGB 2NPOA 4ND7A 3U9SA 1OC4A 3ZBUA 3Q0IA 3FZNA 2VXYA 4TYYA 1ZS9A 1ZJ4A 2C94A 3R8CA 3W7BA 2BD0A 5T4FA 2VDLB 4J9UE 1N6OA 1AMOA 5D1HA 3PWTA 1W88B 1AZWA 3TIIA 4EG5A 4HDOB 2Q2VA 3DULA 3UH0A 1G2IA 1V37A 4HDMB 4ZPJA 1J8QA 5TF4A 4EKNB 3RBVA 3EE6A 4K6HA 4Q9LA 4UTNA 4FZVA 1KVTA 1Y1KE 5EMJA 3L6EA 3FYDA 3OT5A 1I10A 1NJ5A 1E3WA 1WMDA 2AG8A 2OSVA 3HH8A 2QMQA 5DO9A 2QTNA 2H17A 3UCXA 1F7UA 1BS2A 5FF9A 1JKJB 1YE8A 1ELOA 2FZCA 3C7TA 1U63A 4KXQA 3STTA 5CLHA 4ZGWA 3NM4A 2H57A 4NAHA 3URKA 2XQFA 2QLJA 2YBEA 1N36B 5E7JA 1MLDA 4CMIB 1M5RA 4BKMA 3BE5A 1NT4A 2CLFB 3E1GA 4WDQA 3ZWPA 3MW8A 4EG7A 4EKGA 5SZJA 2FEKA 3P5BA 2HRRA 3H5WA 5D86A 1AUQA 2WWVD 3E18A 5DSXA 1I1OA 1GR0A 2VKQA 4OHVA 4EKEA 3TYXA 1GQRA 1YAHA 2FQXA 2PEZA 3HWX1 4GG1A 4RM3A 5JYDA 3DV0A 1YV9A 2IHBA 1M2JA 4GZMA 3EWNA 3IBGA 3KKKA 5D5PA 4Z99A 3UA4A 1P5ZB 4DY4A 2XDQA 5EP1A 3LX5A 5KU7A 4MRPA 2C7VA 4B47A 2NNLD 4XDYA 4J6EA 5JIBA 4LS3A 2AD5A 5J5CA 1Q7RA 2ZIXA 2PV7A 2J3EA 1J24A 4YJ2B 1GYQA 2YXNA 2BEVB 3UOAB 4N65A 5AKGA 3P9SA 3EPJA 1Z26A 1A98A 2YV5A 1GITA 1W4LA 2WR8A 3PGVA 1C7IA 2R7MA 3KE9A 1QG6A 4YTEA 1JILA 2PMEA 3X43A 1MX1A 4Q3DA 4J90A 2V9CA 3KKZA 4MS4A 3F1LA 3GJSA 1SC1A 2R47A 5IARA 1T34A 3AR7A 2YXBA 2QD4A 1G3RA 2OOSA 1TZ2A 1BMFD 1ULHA 1XV5A 2O8VA 3GA0A 3I53A 1U11A 4JUCA 2CCKA 4J75A 4Q24A 5F1OA 3SNKA 2P2NA 4N41A 3CPHA 3QYPA 3WZLA 1DB3A 3IRVA 5IX8A 4BVJA 2UXDB 3D8UA 2QTWB 3H2BA 3K92A 4LOHA 2V5UA 4UEOA 3LQKA 4N47A 1RQNA 3BB3A 2Z0MA 1RZ3A 2GO1A 5EWLB 5IUJC 1YA8A 4YB8A 4AJIA 2Y0BA 4UD6A 1WUHS 5AM2A 3RABA 1XA0A 5BR8B 5BNFA 4WZBA 4WY8A 2X1HA 3IOEA 2FPOA 3F3KA 1S4MA 3HL0A 4ZQEA 1ADGA 3T38A 3TINA 2NOAA 3IAM6 2ODNA 5L40A 5L3SA 3VC1A 1GCUA 2CXPA 3BJEA 3UB2A 3ZDRA 1JHOA 1G9SA 3BA1A 4YUYA 1PX0A 3TI9A 5I8WA 4GYJA 3TQOA 1Z4PX 1V8BA 4K9LA 1QJ4A 4FT4A 2XMDA 1L5HB 4R2WA 1IUOA 5AP9A 4UJ3A 2Z1DA 4MPTA 5AKYA 3DCNA 2VO1A 4P4GA 3EBOA 4YLEA 1DDGA 1G8SA 5FQNA 2Q4TA 3C5WP 2P77A 2ZAIA 2YN0A 4INJA 2QJWA 4JJKA 3TDMA 5EGSA 1OV6A 1Y3AA 4HRAA 4WVLA 2LIVA 1R27A 3AT1A 1Q12A 4OHFA 2F43A 4ZQCB 1R18A 3EXHA 3KU4A 1KTVA 1TE2A 3W90A 4EQZA 5CBKA 4CIDA 1GA6A 2DLCX 1E6CA 1Z2NX 1XEXB 3R6LA 5JLJA 2UDPA 4M9SA 3NVKI 4LWOA 2AFIA 3AR2A 2VP6A 4XGNA 4DMKA 2D4AA 3KWFA 3WYFA 1JFFA 4N9QA 3ST7A 3T3NA 2JIOA 4UHHA 4ZOLA 3THYA 5HPYB 2M1ZA 1KKMA 1NI4B 2DPMA 5G4LA 2C88A 1FZQA 2AB0A 3UBTA 3RC9A 3I9OA 4TWIA 1IZ0A 2O5CA 4WACA 4Z0TA 4OB8A 1ZC4A 3ANMA 1BXGB 4U8GA 4BRUA 1WSBA 4KIFA 3OQVA 3MJRA 4MGZR 4BWYA 3ZQ6A 3P20A 4XDGA 2ZWAA 2I6GA 3OFJA 5A4DA 3HYCA 1D0IA 2F67A 4BE9A 1S7GA 3CISA 4Q4JB 4CQMB 1EFVA 2PKQP 3K09C 1YCGA 1H4SA 1P1FA