1TQHA

Covalent reaction intermediate revealed in crystal structure of the geobacillus stearothermophilus carboxylesterase est30
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
242
structure length
242
Chain Sequence
PPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTGPDDWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEMEKFKQTPMKTLKALQELIADVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESLDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxylesterase precursor
publication title Covalent reaction intermediate revealed in crystal structure of the Geobacillus stearothermophilus carboxylesterase Est30.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 95
structure length 242
sequence length 242
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tqhA00
1J1IA 1HLGA 2Y6VA 5EHXA 4HXFB 2J3DA 1ZJ4A 1X70A 3C5VA 2WU3A 1ORVA 1UZAA 3L1HA 3BF8A 4DLNA 3QZUA 1CUJA 1BEEA 4G1FA 1JT2A 1CUBA 2ZVDA 5A2GA 2GBFA 4B0PA 5ALYA 1MNAA 4MEBA 1LNSA 5LZ2A 4GBGA 5CXXA 1MN6A 4AB1A 4U2CA 2Y6UA 2XUKA 1P0QA 1BU8A 2CMFA 4LIPD 1XZLA 5LYYA 5FP0A 1DWOA 1EXWA 2AJ8A 2XQIA 4UHEA 5K3BA 1H2YA 2ES4A 2HA0A 1MX5A 1AC5A 1BCSA 3HYSA 3PFBA 1OXMA 5EHQA 2WJ4A 3CN9A 1QOZA 5IKXA 3CN7A 1F6WA 1Y37A 2EDAA 1ZD3A 2WIFA 5LZ4A 3O4HA 2G63A 3C8DA 3G9UA 4OU5A 3D59A 4HS9A 3VKFA 2O7VA 3H2GA 3I1YA 5ALLA 1CUXA 2XQFA 1ZGBA 4UBLA 2XUPA 5DJ5A 3UUFA 1HDEA 4J3JA 4N8EA 5K5EA 4EY4A 4HTAA 4JUIA 4OYLA 1BS9A 1K63A 2B61A 4QZVA 4X7BA 5ALKA 4EUSA 4OU4A 3G0BA 1XZBA 5ALIA 1KU0A 3N2ZB 2DFPA 3LS2A 4QDXA 2DR0A 4QWMA 5DYYA 3AZPA 2QMQA 3OG9A 2RHWA 1QIMA 4W1PA 1VA5A 1AQLA 4ARBA 3G9XA 5CT4A 4UFOA 3FVRA 1QFSA 1W52X 4FMPA 1FSSA 1Q0RA 3NGMA 1MO2A 4W9RA 4Y2PA 3RARA 4I3FA 4Q3OA 1GZ7A 3S2ZA 3T52A 2WKWA 3RM3A 3L1JA 5HK9A 5HF8A 1WB4A 2WIDA 2G4LA 4X00A 1VJ5A 5HFAA 2WHPA 1C7IA 1UOPA 4UHCA 2Y2VA 2V98A 1G4HA 4UHBA 1J07A 2QTBA 4XVCA 3HRHA 5CT8A 2WHQA 4DMKA 1XZGA 4X93A 2CEKA 2WG1A 3O9MA 5FV4A 1EX9A 1TQHA 1C4XA 4OPMA 4Q05A 2Z3ZA 3M82A 1MAAA 3F8SA 2Z5GA 1XZIA 1JMKC 5AKKA 2QR5A 5ALGA 1XRMA 1P0IA 5CT5A 4FTWA 5AI6A 3FNBA 3JW8A 1UK7A 3NOXA 4KR0A 4E15A 2I3ZA 1LGYA 2XUGA 2JGLA 3AZOA 5JAHA 2ZJ7A 1MJ5A 2BKLA 2VA9A 4ZI5A 4C89A 5KWIA 2ORYA 2XUOA 1QGED 5DNWA 2JGJA 1QIJA 2AJBA 3KWFA 4L3WA 2C0PA 5JZSA 3RLIA 1YA8A 1ZI6A 1EINA 3ILSA 5FRDA 4AZ0A 2QOEA 1ZD4A 5ALRA 4NZZA 3V1MA 2WIKA 1UKAA 2QXUA 4WFIA 4X90A 4JYMA 5AOCA 2PL5A 1K5PA 2VJAA 4DSAA 1ZI9A 3KOOA 5JADA 5AKZA 3D4LA 4Y2SA 1G66A 5FPQA 3ZWQA 1CUUA 4FBLA 3AFIA 1LBTA 1HQDA 3IULA 1E89A 4ETWA 3D7RA 2EDCA 4U2EA 3T4UA 1R50A 4FDMA 1CRLA 5LKRA 4DMCA 2XMCA 3KXPA 1EB8A 1NU6A 5JAPA 5LZ7A 5LZ5A 4WCVA 5HQ3B 3WK5A 1CFJA 1IZ7A 3MUOA 3E0XA 3I2HA 2DSNA 4F60A 1DTEA 4J0DA 1ODCA 4QDOA 3I2JA 1FFCA 1SCQA 4QNNA 1I6WA 4QA9A 5DNVA 1UK8A 2YYSA 3VJMA 5AJHA 2Y2UA 1WB5A 3H1BA 1SFRA 2H7XA 1LPBB 4B0OA 4KE7A 1WB6A 5IVDA 3C6BA 3ICVA 1LLFA 4QDUA 3IA2A 5AM5A 4U2BA 3QBJA 5AHXA 2PSFA 2BAGA 4RNCA 4UPDA 3GBSA 5JAUA 3OPMA 4BZZA 5CT6A 4X3CA 1LZKA 1CUGA 5T4BA 2XUAA 1EA5A 5K3DA 2PSJA 3M81A 4BVJA 4HAIA 2XUJA 2C5FA 3U0VA 1ETHA 1CV2A 4P08A 3QMMA 2GBIA 3C5WP 4Y9SA 4Y2UA 4RE6A 3DQZA 4YX9A 3JYHA 1PJAA 1AKNA 1W6RA 4KAJA 2XQGA 3G0DA 4EB0A 3OTQA 3D2AA 5K3CA 2HU7A 3HXKA 1UKBA 4KRYA 2XLBA 3H19A 4JNCA 3KDAA 5K3AA 5JARA 5IVIA 2CKMA 3WYNA 5ALTA 2DCMA 4G4IA 1ZI8A 1EHYA 1YASA 2HA2A 4IQ4A 5AK6A 1CPYA 1VE7A 4KE8A 1EI9A 2XB6A 4EY7A 2VT7A 5I7UA 1PFQA 1O6GA 1JFRA 2OCGA 3PICA 1QO9A 1WOMA 3H04A 2VSQA 2EEPA 2BUBA 4K5QA 1ZD2P 4L9AA 4F5ZA 1JJBA 1DX6A 1WPRA 5AK5A 1XQWA 3QMVA 2VF2A 3OC0A 1QIGA 1BN7A 1CIJA 1USWA 1BEZA 2RONA 4J0HA 2ZSHA 3Q0TA 4N8SA 4J0CA 1U2EA 2B4KA 2RI6A 1YB6A 5AOAA 4B84A 2WLSA 4K6HA 3WK7A 5KREA 2VQ6A 2WUEA 4YASA 5E4JA 3R3YA 4M0EA 1QTRA 4X92A 3DDUA 3ANTA 3R3XA 5JZ9A 5LIPA 3EQ8A 2AXEA 2E3JA 5AKXA 2YH2A 1QZ3A 1AMNA 3QYJA 3WI7A 1YAJA 4MWTA 3BDVA 3ZLUA 3GROA 1UOOA 2CZQA 3NWOA 5DTJA 4KEAA 1XRLA 1K8QA 1K6EA 3GELA 2QKYA 2WFMA 1CUHA 3W05A 5AKGA 3WJ1A 2J4CA 4PSDA 1R9NA 2DQZA 3BIWA 4HXGA 5A71A 4MXDA 3QVMA 1B6GA 3AJAA 1WCYA 1THTA 1ZGCA 3GZJA 1JU4A 2B9VA 3KD2A 4LHEA 2XQKA 4EY6A 2QZPA 2W22A 3V1NA 1H2WA 3PFCA 3DEAA 1F0PA 4Q3KA 1R9MA 5AOBA 5FLKA 1YR2A 1A7UA 3LLCA 3HABA 3O4JA 5CH3A 4AX4A 4X6XA 3C70A 5LKAA 2K2QB 2HIHA 4PO3X 4X71A 3SK0A 2J4FA 1ODTC 2JGMA 4BP9A 4UBMA 5E4TA 2UZ0A 1YA4A 3D2CA 1U65A 2JF0A 3BF7A 3C6ZA 5AKEA 4C4XA 2VTVA 1W75A 3UMJA 5C81A 1TK3A 4S0XA 4BAZA 5I8PA 4BVKA 4WDRA 2HM7A 2ZYHA 3O0DA 3IBTA 1CUZA 1TKRA 1SCKA 2PU7A 5HF6A 4BYMA 2H7CA 1IUNA 5JASA 1QE3A 3FYTA 4Y2JA 3VISA 5DYWA 2R8BA 1XZDA 5AIBA 1E3QA 5CH5A 3VJKA 4CIAA 2ZJFA 1Q83A 6YASA 1D07A 1QIHA 3I6ZA 1CVLA 1L7RA 3VDXA 2I03A 5ALVA 4X95A 5CW2A 2FUKA 2DHEA 2HL6A 5IVHA 3C6XA 3KWJA 3WKEA 1EDDA 2FJPA 3D2BA 3ICWA 1W1IA 2X5XA 4QDTA 3TGLA 5AKHA 3E1GA 4Y2XA 1NX9A 4BZWA 3LP5A 4UFNA 4B80A 1IUOA 3IIIA 1LBSA 4BTLA 2Z3WA 2WG2A 1GKLA 5ALSA 4OCZA 3SX4A 4C4YA 1RP1A 1JI3A 2HA4A 4KRXA 1ZIXA 5HKBA 2AJCA 3O9VA 3QITA 2ACKA 1R3DA 3G0IA 3HC7A 1W76A 1OILA 5DLPA 5T4FA 4H7IA 1EK1A 2JGKA 3QH4A 1DWPA 1UT6A 1CUEA 2WIJA 4TPKA 4WY8A 1XZMA 4GLBA 5LZ9A 5HFNA 2J3QA 3W04A 4GXNA 4N5IX 1TCAA 2C58A 1VKHA 3FLBA 5JAOA 5HCUA 2HU5A 4F21A 3FSGD 1CUIA 4KE9A 1JJIA 3D3NA 3FCYA 3IUJA 3BXPA 4PW0A 1UK6A 2PSDA 4X6UA 3TJMA 3TRDA 4FLEA 3WL7A 1ZICA 4J0GA 1X2BA 3G9ZA 4DNPA 3W2TA 5DWDA 1U4NA 4OB6A 3QPCA 4M0FA 4BE4A 2LIPA 2QS9A 3AZQA 4BCCA 1JU3A 3NUZA 2OG1A 3ANSA 4KAAA 2IIVA 1S8OA 5JALA 4TGLA 2OAGA 4Y2YA 2BJHA 4OD0A 2WJ6A 5D3ZA 5ALEA 3C8HA 1B41A 3HJUA 4F0JA 5IH7A 1CUWA 1A8SA 4IHAA 3D0KA 1TIBA 3BL8A 4N5HX 4HXEB 1DT5A 5ALWA 1E66A 5A7HA 4XJVA 4ARAA 4UHHA 3DOIA 4QWWA 5HK8A 5ALHA 4GEGA 4KE6A 1IMJA 3DKKA 5JD5A 3DL4A 3PF8A 2Q0XA 5AI4A 1HPLA 3G7NA 1DU4A 4W1RA 3K6KA 1H2XA 1TCCA 3WWOA 1AZWA 3LIPA 2IITA 4CFSA 4BDTA 1FFDA 5ALMA 5HKAA 2OPHA 1ACLA 5AICA 1DWQA 1AUOA 1HKHA 2O2GA 3QPAA 2BCEA 1N8SA 5CT9A 5ALZA 1SC9A 3BJRA 3WJ2A 5AKYA 3ZPXA 1A88A 2PX6A 4Z49A 1L7QA 5EGNA 2FX5A 2WU4A 4H7HA 3I28A 4IH1A 2ACEA 2ROQA 1TRHA 3FSGA 3L1IA 2ZSIA 1CUAA 2CUTA 1O6FA 3I6YA 1F8UA 1CUVA 4V2IA 1ZJ5A 2XMZA 3YASA 3VVMA 1UKCA 2H1IA 5ALQA 3FCXA 4KYVA 3DCNA 2XMRA 2DQYA 1A8QA 4ZV9A 2PSHA 2ZJ6A 4N8DA 4MQLA 3N0TA 1XQXA 4L0CA 5AM4A 4UBIA 2WHPB 3HEAA 4D9JA 1T2NA 5D6OA 4M0MA 1R1DA 4A23A 5ALPA 1XZFA 1YAHA 3E3AA 4G4GA 2OXEA 2XQJA 2I78A 1EB9A 4FWBA 2RAUA 4OSEA 1QIFA 2OCKA 3B3QA 4B81A 4LXIA 4MQMA 5T4EA 3HACA 1LPNA 3WWDA 4QDZA 5CRIA 4B83A 1XKTA 4H0CA 4H7DA 1WHSA 3IUNA 4BP8A 2W6CX 1N5RA 3IUMA 3EBLA 2OLEA 2WUDA 3O95A 4C4ZA 1LPOA 1MNQA 4E46A 4YK7A 4H35A 1CEXA 1Y7IA 2HRQA 4KAFA 5A7FA 4W1SA 1QFMA 1VXRA 4J7AA 5JATA 3IUQA 1GQSA 3A2MA 2D0DA 4DSZA 5AH0A 4I4CA 3WL8A 3FOBA 1XRQA 5FKJA 4GDMA 2WUFA 4UUQA 1IUPA 4NMWA 3R3WA 5HZGA 3RK4A 4WFKA 1AURA 3BE8A 4HZGA 4BVLA 3EQ9A 2HA5A 3DJYA 4XWGA 1M33A 2H9YA 4BB0A 2XE4A 5ALXA 2V97A 2G5TA 1QIDA 3I2GA 1AX9A 1GQRA 3PDCA 1CUFA 4CCWA 3GFFA 3FVTA 1AGYA 1ODSA 4DGQA 4BE9A 3P2MA 2BFNA 5D3KA 2GZRA 1JJFA 1N5MA 1H2ZA 3EQ7A 5DTIA 1DQZA 2WFLA 4E14A 3IB3A 2GBGA 2XMQA 2JIDA 5FXMA 4TVKA 3H18A 4LXGA 4AMZA 4OB8A 3ZI7A 5JYCA 3WKAA 3O4GA 1VE6A 2QRUA 4UFPA 5BWBA 2QXTA 4RPCA 3WWPA 1XZCA 3KSRA 4G9EA 4DIUA 4BRSA 3O4IA 3FYUC 4FNGA 4IH4A 5IVKA 1P0PA 1LPMA 5T4HA 1CLEA 1XZHA 2IX9A 2C0QA 1XZEA 4ZWNA 1RYYA 1BRTA 3HLKA 2YXPX 4H7FA 2GBCA 4BCBA 1E8NA 2WILA 4EY5A 4PF1A 4J0KA 3H1AA 5AM1A 4ZXFA 1GPLA 3CXUA 1UXOA 5KBYA 1EH5A 4CG1A 3H2KA 1LZLA 3R3VA 2PPLA 4B9EA 3PUHA 4FOLA 2XMDA 4BC0A 1DQYA 1QIEA 3TEJA 1MX1A 3H17A 3C43A 3H2HA 3STYA 2ONCA 3CCBA 1XZAA 3I2FA 1XLWA 5A62A 3X3HA 1BROA 4C87A 1CR6A 3U1TA 4BRZA 3R3ZA 3SWWA 1MT3A 3R41A 4RE5A 4FNMA 1MPXA 2OGSA 3STXA 1KEZA 1XQVA 4A16A 5AM0A 4CG3A 2CB9A 3I6MA 3HZOA 2GYVA 4NVRA 3V1LA 5D7BA 3F9CA 2WTMA 3DYIA 1EK2A 1G5FA 1VZ2A 4AXBA 3AUKA 4QEKA 3BDIA 2WIGA 1U8EA 3EF3A 1E8DA 3W9UA 3OOSA 5AI5A 3R40A 2XMSA 4K2AA 3WA6A 3WLAA 2HA3A 1X2EA 1DINA 2ZYIA 4I19A 5JD4A 5C8VA 5KWJA 5E2IA 4UHFA 4G5XA 5AM3A 1VOTA 1QONA 3C6YA 4INZA 4AN0A 2PU5A 5AK3A 2XUDA 3WL5A 2YASA 4L72A 4Y2QA 4DMHA 5ALNA 3V1KA 2XMGA 3H2IA 4WJLA 4P93A 2I3DA 4AN1A 1T4MA 4B7ZA 4CCYA 3F67A 5ALDA 1FJ2A 3DL7A 4WDQA 4PSUA 5AM2A 5BWCA 4RGYA 3V48A 2V9ZA 3D5EA 5C8ZA 1K4YA 2OCLA 2VJBA 2C5GA 3AIMA 3A2NA 5JANA 3OM8A 1E8MA 4J0IA 2GYWA 2XUHA 4UHDA 2XI4A 5LZ8A 3DOHA 1EDBA 1VA4A 4EBBA 1GPNA 2JGIA 1CUDA 3ESBA 2WJ3A 4A5SA 2X8BA 4LKOA 5A6VA 3BWXA 3AIKA 5ALJA 1GT6A 3BJMA 1VZ3A 1QIIA 5ISMA 3STTA 2QUAA 3AILA 3M83A 4AQDA 1P0MA 5CXUA 3WMRA 4CI9A 3K2IA 3DD5A 4G8DA 3R3UA 3A6ZA 5CURA 1OCEA 1THGA 5YASA 4K6GA 2OAEA 3IDAA 1H23A 2QVBA 3STUA 1YSCA 5J3JA 3HI4A 1F0NA 3G9TA 1C7JA 3ESAA 5AI0A 4U2GA 4MEAA 4CG2A 1NU8A 5E4YA 4CCYB 1EVQA 4BATA 4K6KA 5FDFA 1N1MA 4GI1A 1J2EA 2ECFA 1LPAB 3FLEA 1Q0ZA 4WFJA 1E5TA 3GA7A 4MWSA 4XIIA 4J03A 2H7YA 2C4HA 4MYSA 4B9AA 2HFKA 3PF9A 3PE6A 5JZBA 4FLMA 4DNFA 3ESCA 1UK9A 4JH0A 3WK6A 5AKLA 1XFDA 4NS4A 4XX1A 5C8XA 5K3EA 4G8BA 2XDWA 1IZ8A 3CCCA 5BV7A 4Y2TA 4H18A 5EHZA 1YCDA 3WKBA 4BAUA 4X97A 3H2JA 2QT9A 5AO9A 4G4JA 1UFOA 1XZJA 2Z8ZA 1QO7A 3FWHA 1JMYA 3B12A 2R11A 3DLTA 4O08A 3ZV7A 1SOMA 5CTAA 4MYDA 5HF5A 1GPKA 3DKRA 4FKBA 3WWCA 2HADA 4E11A 5C7YA 4OYYA 4BBZA 4QE3A 5EIAA 5HQ3A 2WFZA 2NW6A 1TAHA 2JGFA 3HSSA 4MJ3A 3R0VA 2BGNA 2Z8XA 4H77A 1VLQA 1ZOIA 1UWCA 2C7BA 4AO6A 4Q1VA 2JBWA 3F98A 4WY5A 1QLWA 4P9NA 3QMWA 4Y2VA 1XZKA 4Y2RA 1LPSA 3AIOA 2XUQA 4LXHA 4EZIA 3MGAA 4DMFA 2VT6A 1Z68A 4JYPA 4Y7DA 2FJ0A 3PUIA 2B20A 3WYDA 1CUCA 1ISPA 3G8YA 5EIEA 5BOVA 2VEOA 4ITVA 2BGRA 2XLCA 1WHTA 5DNUA 4B85A 1UOQA 5JD6A 3I1IA 5SYMA 1G42A 4UBKA 3STWA 3WZMA 5I9IA 2RGUA 3MVEA 2VJCA 1QTIA 3MUNA 1FFBA 3WIBA 4GECA 4IH9A 2HA6A 4PSCA 2WUGA 5HF9A 2AJDA 4DM7A 5FUMA 4UBOA 2HA7A 4Q82A 3WL6A 4HRYA 2WSLA 1XKLA 1R4ZA 3E4DA 4KACA 1PV1A 2WG0A 3C45A 2GZSA 2HRRA 2HFJA 2JGEA 1BCRA 2ZYSA 2JEZA 5LP1A 4X94A 5ALOA 1MAHA 4H7JA 2WTNA 5EI5A 1L7AA 1A8UA 4DYHA 1KU6A 5SYNA 4OB7A 3WKDA 2PKYX 3A2LA 3EIOA 4G8CA 4AMYA 3S8YA 4Q3LA 4EHBA 5AI9A 3PI6A 5ESRA 4EA6A 4UBJA 1HBJA 3FAKA 1R88A 1QJ4A 4IO0A 4ZRDA 5F4ZA 5CBKA 4CIBA 5AK4A 3WQHA 2G5PA 4FBMA 4H7KA 2OGZA 1FFAA 2RIPA 2PVSA 3DYVA 3WK9A 2HHAA 2OQVA 1QIKA 4ZV7A 4QLOA 5AKJA 3WIOA 1EDEA 2V96A 2BUCA 3H0CA 1H22A 1ORWA 2PM8A 1VXOA 5EFZA 4C01A 1WM1A 3LIIA 2BUAA 4GW3A 4FFWA 1HL7A 3W06A 3F97A 2JEYA 1CUYA 4GHWA 2WHRA 4Q34A 3UUEA 4X85A 3VVLA 5ALUA 3OURA 1XRPA 1EVEA 2P8SA 4J0JA 2VJDA 1FFEA 2O2HA 2PSEA 1GXSA 3I2KA 5CH8A 1XROA 1XQYA 3ZLVA 2OQIA 5K3FA 2HDWA 5CMLA 4UBNA 1CUSA 1XRRA 1CQZA 1GKKA 2DHCA 5A7GA 5AIAA 4P92A 4X91A 4BTVA 4B82A 5JIBA 3G0GA 3F96A 1MTZA 2QJWA 2ZYRA 1YS2X 4BAGA 4OUKX 3B5EA 4DNQA 1XLUA 3W9BA 1ZD5A 2PUJA 2VAVA 2X76A 5AI8A 4BDSA 3A70A 3STVA 1ZIYA 2QM0A 3FBWA 3K9BA 1YS1X 2VAXA 1Y7HA 3QPDA 3LCRA 3ZLTA 1IVYA 2XUIA 5EIHA 2PBLA 1XRNA 2Y1KA 4BC1A 2AJLI 3ED1A 4U2DA 4DNOA 4B6GA 1CQWA 1W4LA 4ROTA 3FYUA 1TCBA 7YASA 3WK8A 5DYTA 3WWEA 3ESDA 1GGVA 2VATA 3V9AA 4QLAA 2QJRA 3I2IA 4GWLA 3GUUA 3G0CA 4G9GA 4HVTA 4EY8A 2CJPA 4ZGBA 3WZLA 4C6HA 2WM2A 2WFLB 5FOQA 1BE0A 3VXKA 2RHTA 5K3FB 1Q84A 1WPXA 3WKCA 3WK4A 1J06A 2WQZA 4DTCA 4C88A 3G02A 2O7RA 4X6YA 4PQEA 2OGTA 4AO7A 3DS8A 2D5LA 3FLAA 3DNMA 1ACJA 1RWQA 1JKMA 4LYEA 1DX4A 3IVMA 3AINA 1BN6A 3VJLA 4FFVA 4AO8A 5AP9A 5H3HA 4W63A 2O2IA 3C87A 5EHNA 1DT3A 2XT0A 2XMBA 2QUBA 4YPVA 1MU0A 4W1QA 3BIXA 4FHZA 4U2FA 3RKSA 2PUHA 4PNZA 1MX9A 5ALFA 5AKIA 4AZ3A 3QM1A 4PV7A 1SCIA 5FPPA 1LPPA 2HU8A 3JWEA 2GYUA 4H7EA 3SC2A 4BCDA 4LYDA 4JEIA 2OCIA 3FYUB 3WA7A 2XUFA 4FLFA 3M3DA 2CBGA 1XLVA 1YB7A 3IURA 4HRXA 5LLSA 4KJXA 2DHDA 4ZREA 3Q8WA
chains in the Genus database with same CATH superfamily
2VUHB 3RE1A 1Z7EA 3QFTA 1RLJA 3DVQX 3T7SA 1B0AA 4DIDA 1ZD9A 3AEUA 1K8YB 2J3DA 5KYNA 4NABA 1TVMA 1ZJ4A 4ETNA 4B2LA 1C50A 2VS1A 2WU3A 2AOWA 3L77A 2HYIC 2V5VA 2CLMB 4BEBA 2RHJA 2X14A 1YUBA 2GVDC 3BWCA 1JXMA 5TSDA 4QPJC 3T6KA 1DCMA 3RYCB 3AOEA 1EBBA 1VGRA 2WSSA 1XUOA 1W5EA 2BEVA 3JRXA 3L1HA 5KDOA 1V95A 1YDEA 3IFSA 4NYJR 3BMOA 2V9CA 3IIMA 1U4OA 1CUJA 1BEEA 2ZBGA 1JT2A 3A1EA 5GIPE 1EQAA 4KU4A 5A2GA 3H42B 2Q3JA 4EPTA 4YRNA 1XCPA 4MEBA 4V2UA 1YZGA 3KSBC 3M70A 1L1FA 2Q1YA 4E0BA 4WBNA 1K66A 4G1CA 4AZSA 4F46A 4JY7A 5T8KC 1ZAYA 4XYBA 1MN6A 2BLLA 2XUKA 1Y1QA 2ZJ8A 3EA0A 5A9RA 2VQFB 1P0QA 1UAGA 1UMKA 2O7QA 3U31A 2WVHA 5J1TB 1T8UA 4XA8A 5LYYA 4CN8A 4RVNA 1EWTA 1ZKDA 4BGUA 1XN1A 1K7XB 1T34A 1Z4QA 2DLNA 2H18A 4I50B 2IH2A 1QDEA 5K0TA 2OWDA 4BNNA 4RC9A 1SBZA 1A50B 1NNI1 4DR7B 4XDGA 2DWUA 2IOFA 2PLNA 3X1MA 1WKCA 4B3XA 4CM5A 4HNHA 2ATCA 3DYBA 1P7ZA 5BRAA 4CEJB 3ADPA 1C80A 3V7UA 4F5YA 1C1DB 3PXBA 3QLVA 3FCAA 1IHYA 1SOUA 1Z0FA 3FWNA 5HE8A 2J5XA 2QTTA 2JJ2D 2VZ9A 1UPCA 3GBPA 3PFBA 4G67A 4M6WA 4DIFA 2IHZA 1EBUA 3PUJA 3O9ZA 1GLGA 2C57A 3GUVA 4QFMA 1Y8CA 1Z08A 5AW9A 5KYWA 3GGCA 1HWYA 2ZYGA 1AQUA 4XQCA 2CC2A 4YJ3F 1WXXA 1II8A 1NSFA 3C2QA 2KMLA 1K7YA 3IT3A 3LYHA 3DCIA 5LU8A 3GUYA 2R6GA 2YXDA 3C16C 4IV8A 5KTTA 2OHIA 1SR8A 1PZGA 2ZE8A 2BFDB 2WYVA 3B1WA 3PUKA 1S8FA 2BHRA 1DAGA 3L4EA 3QTLA 4WA8A 3C97A 2LUOA 2WIFA 2AFVA 3VDNB 2W43A 5IAGA 3FOFC 1UBJS 2XDYA 4DA6A 3E22B 3C8DA 3O4HA 4MR9A 4MV7A 3TVTA 4ICIA 1UBRS 1NVKA 3VR3D 3AFNA 1BVYF 4OU5A 4MO9A 5FLEX 2R68A 2G9UA 3TB4A 2FSHA 1XMSA 2W98A 4NMHA 4H4CA 2ZRBA 4K87A 5ALLA 4P2BA 4X64B 5KWEA 1CUXA 3QTBA 1Z5NA 1ZGBA 4M1YA 4G0NA 2XUPA 3WRXA 3UUFA 4AKTA 3U16A 3K1YA 3L9XA 3D5TA 1YV9A 2B3TA 2Y67A 4IEEA 3P0HA 4ZTZB 1OFUA 4KMOA 5KJFA 2GFIA 4AECA 3RVPA 4PHTA 4HTAA 1PS0A 3BK1A 3PC8C 1BS9A 1ZRHA 1RE0A 1FVOA 3E82A 4GOMD 3GFOA 2BFPA 2GPTA 4IVRA 1XMQB 4M49A 4RD0A 4KXVA 1RQGA 1U1IA 3SZOA 2VBGA 3GV0A 2R1TB 2G25A 4EUSA 4EJ6A 3OQMA 4J9UE 4ZQCB 4IOLA 1J0DA 3GEGA 3KXDA 1NUQA 1X1AA 5G53C 4YUZA 5AVWA 4N5MA 3ZU4A 3I12A 5LQAA 3R5SA 3S2EA 5ALIA 5AW5A 4URXR 2VTKA 3LS2A 3T1QA 3AETA 3B8HA 1ZCAA 3JQ8B 3T95A 4BX9A 3FUUA 4QYMA 3AZPA 2PGIA 3AWIA 4XX0A 3WMEA 1XRJA 3ZE6A 3IKTA 2IZOA 4MW1A 2QMQA 1RQ7A 2IKSA 5DM1A 3ET4A 4G1MB 4EW1A 1AUPA 1QPGA 1WXWA 1OBHA 1RABA 2PH5A 2QD3A 2VZEA 3IPCA 3NDJA 3NHLA 1VA5A 3O73A 3QBEA 1K1EA 3N8NA 4PONA 3WYBA 2WD7A 5CB4F 2UYHA 5CT4A 1M67A 3QHQA 2CXTA 3N6VA 1RC1A 2MSEB 4MB6A 4UFOA 3WSTA 1UH5A 2ZQYA 1JVNA 3GVHA 3IBGA 1XKXA 5LYJA 2FB9A 4F93B 1WSWA 1P1HA 2PZEA 4FMPA 4J75A 3SXJA 3HYTA 3T1YB 3NGMA 2EG5A 1P19A 2E87A 2CD7A 1XNHA 4O4JA 3EWSA 1S0UA 1V8DA 1O7JA 2G4VA 1JPUA 2D1FA 2EWWA 4I3FA 2HD4A 3WAKA 4Z4QA 1SIOA 2AH5A 1MF7A 2EGGA 5KNDA 3AR7A 4KOEC 4QVIA 1GCGA 3PUVA 5KWSA 1M34B 4FEAA 2HIGA 5H4HA 3UOWA 2H4FA 1I01A 3T3DA 1WB4A 4ZIRA 1VJ5A 4BMOB 5L40A 4CIVA 2VBFA 4HDRA 4CHGA 1J0AA 2ZCVA 5HFAA 4YMVA 1PDWA 1PYDA 3DEHA 4Y30A 5HE9A 1C30A 1E3WA 1FDOA 4A26A 1XTJA 2XNDA 1KS2A 2WHPA 4PCUA 1X1BA 1C7IA 1HOTA 2H00A 4MJ7A 1N33B 2R66A 4XFJA 4DWVA 1NPDA 4DKJA 4WECA 4BV3A 3OA2A 2YVKA 4KQCA 2VUTA 1V71A 1G1AA 1UPTA 3LPAA 4AIIA 3ONWA 5FFNA 2O8NA 3PNPA 5BURA 1RWMA 4U02A 3QVUA 2YQ4A 1N7JA 4MMXB 4DMKA 2IH4A 2CEKA 4X93A 3ONEA 3O9MA 5FV4A 3SFTA 3ZZ0A 2CZCA 1TQHA 1C4XA 4YACA 5EE5B 2Z3ZA 1M7GA 3DEYX 3QVKA 1KEKA 3UYLA 1MAAA 3F8SA 4PANA 5KNBA 4OBBA 1XZIA 4C7BA 2QDKA 5HHTA 1ZIDA 3CVYA 1ENPA 1JMKC 3RO7A 2MYNA 5IBRA 1PJ8A 1AHNA 2C07A 3BKWA 5IF3A 2E21A 5G1PA 1B2RA 4KQ1A 3P4XA 1CJMA 2LW7A 3D4OA 3IAXA 1VSVA 3MINA 3NU1A 4L8VA 4W5TA 1M0TA 4E22A 4FTWA 1F6BA 2GI4A 2PZBA 5DLDA 3T15A 1QHHB 1UK7A 3NOXA 3KD3A 4Q12A 1GUYA 4MW9A 4NAVA 3GLFE 2O2DA 1ZEMA 2XUGA 4HOYA 1OX6A 4NV0A 5JAHA 3ADDA 3GDGA 1WIWA 2FE4A 1XB2A 2VA9A 4YVFA 4NOJA 2IRWA 2UYYA 3MT8A 3P2IA 3RTGA 1Z6XA 2J6IA 2CVOA 2JK1A 2QI9C 3UF0A 3U4AA 1QGED 1WUJS 3C41J 1O0CA 1SHLA 1OASA 1KH1A 1WF3A 4HY3A 3E9ZA 4IIJF 3S5UA 1U2GA 1BDJA 3OQBA 1BGXT 4GZMA 1J1UA 1QIJA 4I9GA 4TV9F 3ISTA 4II2A 5CJ2A 3TSWA 5JZSA 4LCEA 5I9TA 3ZE2B 1YA8A 3MTDA 4LN1A 4O2RA 3ILSA 3EMDA 2AWOA 2C2BA 3D6MA 3TD9A 2D06A 2H1RA 1NJ6A 4K05A 3TZKA 4AZ0A 4OHXA 2C2WA 3VH4A 3EA5A 3JQBA 2IYSA 1X9GA 5ALRA 2WC1A 8ABPA 3OIYA 3B6EA 3HLYA 1Q5PA 4UUNA 4LFCB 3QX3A 1E5VA 1QQTA 2WFAA 2D1YA 1QG2A 5EPEA 3LWNA 2RB4A 4JYMA 1V3VA 4JI6B 4E1VA 4EW6A 5CVJA 3F49S 1V35A 5DU2A 3CF4A 5B36A 4ZQBA 2FQ1A 5K0LA 4DSAA 2ZITA 4RK4A 5K3OA 3BEDA 2JAOA 1YBVA 5AKZA 4ASUA 4HGRA 2Y1WA 3D4LA 2JAQA 1G66A 1DIGA 1KAHA 1MD9A 2BHNA 2KPOA 3ROXA 1SZPA 4MI9A 3AFIA 3QE0A 4DZTA 1S3IA 3ABQB 3R5KA 1HQDA 3PHBE 4MQUA 3PPXA 1JR3E 5L3VA 4JLAA 1ZN8A 2OLJA 2P7IA 2UZ1B 5JBQA 1KEPA 3MFYA 1R74A 3KKOA 5KNCH 1SQ6A 2AI3A 4L6IA 2GLUA 4KDEA 4GPD1 1XBTA 5CU7A 3KAPA 1XDWA 3W4IA 4IHJF 2V6GA 2FX3A 4ZT7A 2BWJA 1FDWA 2C7GA 2F43A 5TEVA 4N0EA 2OQ2A 1T6NA 3DT9A 3TLBA 3O3CA 5DCYA 3QELB 4GUAA 2W6OA 3ZGZA 2NIPA 3NM5A 3Q7IA 5K0CA 1I80A 3K9LA 4OAQA 4EA8A 3IHTA 1YGYA 2XDQA 1S3FA 2ASVA 3KZVA 1PR0A 2O0MA 3PYXA 4J43A 3U7IA 3FJOA 3E15A 5EJ5A 2SKCA 3OPNA 2XPCA 4FCTA 1IZ7A 5HMMA 3MUOA 3PFHA 3E0XA 3I2HA 4KYTA 1P4RA 1TUGA 2R6HA 4ES6A 2CFRA 4HH4A 1DTEA 1ZBDA 2X6TA 1C7EA 2XNCA 4PHCA 4J0DA 4D9IA 2P6RA 4QDOA 1S2MA 2E7ZA 1TMKA 1ZUD1 1YRQA 3LQYA 4ZCTA 2CV2A 3I53A 1UQRA 1VRWA 5EJGA 2Q8QA 4QNNA 2GNAA 3PUWA 4CF4A 2B36A 5DNVA 2YYSA 2JKYA 1IIRA 5FUYA 2O59A 4WFQA 5AWFC 4GRIA 1EGMB 3EDOA 3HVUA 1SFRA 2PRIA 3RADC 4E5MA 2H7XA 2A57A 2VT2A 2Y0CA 1T9BA 2YFQA 4LCJA 4U7WA 1WQ3A 5D87A 4UQLA 4BXOA 3WQBA 1WB6A 4B6OA 2NUPB 4J90A 1LLFA 2XBUA 4QDUA 2ZIXB 5AM5A 4A0HA 3L4BC 4EJSB 5IG2A 3QBJA 5AHXA 2BAGA 2ZI7A 4UZEA 4WKPA 1D9ZA 1OSNA 4L9RA 4B3TB 1U7DA 3UJNA 3MJDA 5J2UB 1C8LA 1WXDA 4HH0A 5KKNB 2X0KA 3UC5A 1KWKA 3OPMA 4RO0A 3C8UA 4IYJA 5CB6A 3GQVA 5FLYA 2EGUA 5CT6A 1RLTA 4L2IB 3LXMA 4O59O 1VJCA 2NM0A 2AK2A 1PGPA 3MAAC 4C0SA 4D0RA 1U5BB 4V24A 1ONSA 1CY7A 1D4ZA 5K3DA 1T13A 3H83A 3M81A 3PFIA 3BWBA 3MRVA 2UUOA 3IPXA 4RZQA 1C8BA 3NHBA 5FOTA 2IV7A 4FDLA 4HAIA 2A1TR 2QU8A 3TKYA 3SHQA 4BVHA 2FLKA 3U0VA 3LQ1A 4OP3A 2UXCB 2X8LA 1CV2A 2VHWA 2Y0EA 4OTZA 4MV5A 3HKDB 3OT1B 1CQJA 1RBMA 3D81A 4FYWA 5JNRA 3PLAE 1EFVA 4QBIA 3ZBTA 4V0LA 3H3JA 3KZKA 3BL6A 4LV5B 3TLZA 1H6AA 1NY5A 3AM1A 4ZU6X 1CD5A 1M8JA 2I7DA 2VWGA 3OUTA 5AUNB 1FLDA 2CNNA 4CMHA 5CDFA 4C7OB 3V1TC 3KTAB 3L7JA 4H1VA 2B8TA 1PJSA 2NLOA 2H3HA 2JGAA 4JUBA 4C3OB 1KMHA 3BX1A 2IY7A 1CR4A 4EB0A 1YJAA 1Z2PX 3HA5A 4DM4A 2C3MA 4C2UA 1YRYE 1PVVA 1QHSA 3DB1A 3IE2A 1KK1A 3NCTA 4MR8A 1Y4DE 4WAUA 1MRSA 1V0JA 2EJUA 1GP2A 3RVLA 2R8RA 2DQSA 4M1EA 1PR1A 3M4JA 3PUYA 4JNCA 5A6SA 1LDMA 3NXSA 4EVSA 5I7FA 3KDAA 3FG9A 4HXYA 2D3WA 5E6RB 3V4ZA 5CFPA 1AN0A 4MWOA 5IVIA 2QZJA 1KGDA 2ZR9A 2CKMA 1E64A 2XEDA 4PHFA 2G1KA 1BW9B 1KZ7B 1UQTA 1Z0IA 3DFFA 4HN4B 3TB6A 3SQXA 4WQMA 1NJGA 2HEIA 3OQIA 1ZI8A 3HBLA 3P2KA 1EHYA 3TJZA 4UM8B 4XUDA 5LQMA 3O3MB 1L4LA 1CPYA 3HJHA 4PAGA 2XHEA 2OENG 2XXJA 2XZPA 4KAJA 3ZE9A 2BGGA 4K0KB 6ABPA 1K3TA 1O6GA 3GEDA 2WK1A 1PDOA 4KJZA 2JBAB 1R4NB 3OPVA 4P4SA 1HQCA 1V16A 2N47A 1TVEA 3IH5A 4JA2A 4IF6A 1TLLA 2GF2A 2YIMA 3MCAA 3ODGA 2HEGA 4CM6A 2ATXA 1JB9A 1KDOA 4TWIA 2VOEA 1XWWA 2CDCA 5EOVA 3RHSA 3PQCA 2QAGA 2OESA 2O0KA 3RS9A 1QG4A 2FFRA 1QCDA 3QMVA 1UJCA 1HDGO 2HK7A 2VF2A 3OC0A 3ZEIA 5HPYB 2JLZA 3RRXA 2NU8B 3VNRA 3QV2A 1JG6A 1G3IA 3F4LA 1GLNA 3PITA 4RKWA 4Y6QA 5CBPB 5IBCA 1DAFA 1GIAA 2RONA 5HKOA 3U37A 4WGFA 4YGXB 4HVLA 1B23P 4A27A 5K8TA 1BDIA 2J3IA 2NU6B 3Q0TA 1G2OA 3EZ9A 3HPQA 4EHFA 4N8SA 2WD9A 1YBAA 3NKFA 3M1LA 2JLWA 1PV2A 2W9XA 1G20A 1G5HA 4IQ8A 2JI9A 1N6LA 2C99A 4Q9LA 1SVMA 5JJ5A 5KREA 4RTRA 2I5PO 3Q98A 2GEJA 2ZTUA 1N7IA 3NNDA 4GSKA 2F8MA 1KH2A 2PZMA 5CM9C 3R3YA 1U8CB 3MMXA 3PXEA 1U7WA 1D6MA 1MDFA 3HEBA 2G9RA 2X58A 3NVDA 3WV4A 2W2XA 1BX0A 1VI2A 2NXNA 3R3XA 4LYAA 2RK6A 1BQEA 3G1WA 3DZCA 3JARB 2WWRA 3PZRA 5F77A 3T99A 2Q2OA 4B5LA 4EELA 4F4CA 5JZ9A 1EGAA 1RWPA 1U7TA 3CNNA 3OIDA 3SVLA 5KO2A 2YH2A 4OYHA 3WC4A 1S7CA 5JYBA 1DIOB 1GUDA 4K8OA 1ZW1A 4P84A 3VZQA 1H2EA 2R97A 3AOGA 1K7FB 5KKAA 1QHYA 4R84A 1MQ8B 3T35A 3GROA 3LRTA 4CL3A 3KRTA 3OEEA 1D2EA 3D6UA 3SOZA 2A35A 4EPYA 4MHOA 1YBHA 2WMDA 4PFJA 2FZCA 4U6SA 4EYEA 3A6GA 2JAWA 5B2EA 5EZ5A 3V46A 4KEAA 4C5BA 3G5LA 2B8WA 1XRLA 2PLAA 3JAKB 2AT1A 3ORSA 4DDWA 1XTZA 3JRNA 5DSTA 3Q8XB 4YJFA 5IXSA 4HJRA 1VDZA 2JZOA 2QKYA 4WV3A 5BQOA 1PFWA 4JUAA 4B3DA 4ER0A 4EF5A 4LVUA 4B71A 2VFAA 1RWBA 4RDXA 3L1VA 2QY9A 3PGJA 3Q7SA 1YZTA 4XIJA 4HYEA 4J0EA 3SKVA 2R4TA 2ZZKA 5IMBA 2RKBA 1H2FA 2DOKA 2QK4A 3VMFA 4X1YA 4TTJA 4YRMA 3B1FA 2O8BB 3EVEA 2J4CA 1JIUA 4MGHA 2O5RA 1XDSA 2GMWA 4UNNA 4XYGA 3RC7A 2QQGA 3T7TA 3TE6A 1OF1A 4EI9A 5H0IA 3O2JA 2WYOA 4MXDA 2VSXA 3CW2A 1J2RA 2CXRA 2O0LA 3QVMA 3A4IA 3A28A 1GARA 2PTGA 3NBXX 4YRKA 4B48A 3SFVA 5DMXA 2PYDA 2H4WA 2VWPA 4KQWA 5EJ2A 2ZZMA 1I0ZA 3BHJA 2XQKA 1QTQA 3HL0A 2VF7A 3L5KA 4KFRA 1MAUA 4NZMA 2H5IA 3PC2A 5K0JA 1D0VA 2BMAA 1NW5A 3UENA 1C2TA 4S1TA 4F5DA 1H2WA 3TD6A 5E3HA 4IW3B 5JRZA 3QI2A 3R9XA 4JWTA 1N0VC 3IXQA 3W8EA 5FF9A 2G82A 1OFTA 3RYFB 3CF4G 1DJQA 2IHUA 2OAP1 2OV6A 2ATIA 4NHEA 1ZK2A 2DTXA 1ZXXA 4IIJB 5JAZA 2N42A 2J41A 3C70A 4CV3A 2M6KA 2BHSA 4F45A 3RGGA 4CLRA 5KQRA 1T6BY 1MA3A 2G4CA 3BMNA 4KXUA 3GYBA 4RJTA 5LKAA 4GP7A 2Y0DA 3F6RA 4AY6A 1WCIA 3KOYA 5CK5A 1R8YA 1U8UA 5IJZA 1KP3A 1OGJA 2ZM6B 1JPNA 1RXUA 2GCIA 4IGFA 3KQYA 5KHOC 1P31A 2O7SA 1J56A 1U65A 3GDHA 2JF0A 1V8FA 3BF7A 3LOQA 3TPFA 5K0EA 5DM60 1PNVA 3RS3A 2Z0MA 5C81A 4H4EA 1M74A 4S0XA 4NYMR 3FDXA 4PAQA 1IY0A 1N6NA 4BGDA 1BYIA 2E18A 3LBFA 4PRLA 5TGDA 1LLQA 1PRYA 2ZYHA 3CINA 1YI8A 1EQ2A 3ET5A 3O0DA 4ALKA 1G5QA 1SCKA 4YBZA 4EABA 1NP7A 4CM1A 1YF3A 3R4VA 4OP2A 4BOYA 1ZM4A 1UKEA 2R84A 3TXYA 2H7CA 4WZAA 1RS0A 2F1JA 1YIAA 3NFRA 2GJ8A 3TOVA 1E4VA 3A3NA 4DEVA 2R8BA 3OPXA 2HWKA 5FADA 3K9HA 5BMVF 4GKVA 2FU5C 4XCXA 2ZUVA 1E3QA 4CEHB 3VJKA 3X1ZA 4AF8A 4BMXA 4K9DA 4QQRA 2WPNA 1ESZA 4HVCA 5BSHA 5BUCA 1PU2A 3ABIA 3VDXA 2ZWOA 3FFXA 1DKRA 4NG5A 3T5TA 4C76A 3AVXA 2W2OA 3PXAA 3FF1A 4BJ1A 1T8SA 2XKBA 3OY2A 3S2FA 1RJDA 4JZYA 3T4PA 2PA3A 1T1RA 2DHEA 2WOOA 1IBMB 1A4XA 3P2EA 4EB6B 2YWDA 1UDRA 3PEWA 2CW5A 4XUEA 2BBOA 1M1YE 4DMUB 3I04M 1SUPA 4RVCA 3E1GA 1FC0A 4Y2XA 1X7GA 4FYKA 2OFOA 2P9FA 2CZGA 2KBEA 2A3RA 1Z75A 3RNOA 4LBZA 2IZZA 1IEXA 2GM9A 3IP5A 1IUOA 4B80A 2GAIA 3E7XA 4C06A 3CJTA 4BKOA 5K4GA 1QS0A 4N48A 5ENVA 2Q62A 1AB6A 2GD1O 2GK3A 3PQ8A 1YONA 4L02A 5JJIA 2ZBFA 3DV2A 4C4YA 1N7HA 1WD7A 2VQ3A 1IHUA 4Z9AA 1IOWA 3OKPA 1I51A 1JI3A 1OBVA 2Q1TA 4DPKA 2AC7A 3B85A 5DASA 4Z99A 1FBNA 1E6WA 1RPZA 5KU7A 1ENZA 1NXVA 5K01A 3W3AA 4YRRA 3RWOA 2B94A 1JE0A 4WXRA 1JKXA 3HC7A 2HK8A 3PQ2A 4FW9A 5A4FS 1OILA 1X6VA 2R65A 4UTOA 5LA6A 1QVAA 1KOGA 5KX5A 4KPEC 2JGKA 4JS0A 4WADA 1SXJE 2HLHA 3QH4A 5DGCA 5DH9A 3HNOA 4ZAYA 1L4EA 1VBFA 3CZPA 1O97D 3OIVA 4N3BA 5LPNA 3HU1A 2NNLD 4GKBA 4ME6A 3WLOA 1XZMA 1YJXA 2YDYA 4G5HA 4HDKA 4AZ3B 5KNCD 5LZ9A 5F1PA 3ZOZA 1P6XA 3FAZA 2CDAA 1H0RA 3MELA 4I1PA 1L4UA 5JWHA 2O8EB 3MJSA 2J3QA 2YCBA 4PINA 4GXNA 1P5ZB 4FM9A 4G1VA 1XZQA 1DC6A 3K8OE 2B6HA 5I48A 3QVXA 2VSNA 5AW7A 5JNUA 1U90A 1UMDB 2NYUA 5HCUA 1TUEA 1NRWA 2R00C 1C7RA 3E03A 4RGVA 4YCBA 4ETMA 2X7HA 4OKSA 3OHPA 2V4UA 4KG7A 4XSHA 3F6CA 1ZGGA 1C9YA 4FZ5A 4LOJA 3M3PA 3PXXA 4Y0NA 3HL4A 3W8FA 3BWMA 4B7CA 1J20A 3GT0A 4TQ9A 4N5NA 1EEXB 4ZOCA 4KVFA 1PT7A 3F6SA 2C98A 4WW0A 1DAKA 1TQ6A 4FCWA 4PYMA 4YRAA 2JFBA 3FCYA 4Y1FA 2A1UB 1ESCA 1I4DD 3QFCA 3ZZNA 2PJRA 3QKWA 3ZDRA 2QN8A 4I14A 4J49A 3UWSA 3FZEA 4PW0A 4W9NA 2EFYA 1UK6A 2E6KA 2IYOA 2PSDA 3L0ZA 3ZLBA 2RGNA 2WE8A 1RI2A 2GUWA 2G17A 3MIIA 5LM3A 3E9DA 1K75A 1XKQA 1XCOA 2PFSA 2XYRA 4HRVA 4RZ3A 3RANA 3TJMA 2JGRA 5KTNA 3Q88A 2J7PD 2XADA 1U9ZA 1W88B 2J9RA 2FV8A 2ZSKA 4JI5B 1YOVA 1XDUA 3TBHA 1QF6A 1Z34A 1ZICA 4X1OA 3WL7A 4AD8A 4Q1DA 3OFND 4YR9A 5JSUA 2VJOA 3CZRA 2UYGA 1NQUA 1U3CA 3BGIA 2FPPB 4FBGA 5HUJA 2R1VB 4PM4A 3V4LA 4EKNB 3W3ZB 3RT7A 4PICA 4GC5A 4E09A 4EYOA 3OAAA 4AP6A 3PR3A 1G21A 1GY8A 1OYWA 3A9TA 4NI5A 1OQAA 2C03A 2GARA 1YDGA 5DWDA 2IWHA 2Z1MA 2CDBA 2FEXA 1YJBA 3DQQA 4OB6A 3STTA 4KIGA 1RRMA 4M0FA 1MENA 3AZQA 1PCXA 3PYMA 1FK8A 4HEA6 3GRPA 5DT9A 3RS5A 4DFDA 4G8JA 3FI0A 2VEDA 5EXDA 4BQIA 3BRWD 5AMXA 2POQX 4DSTA 3NUZA 1HT2E 2AN1A 4B8YA 4E33A 5M34A 3GW8A 1E6LA 4CTNA 3EZXA 3GY0A 4TGLA 8AT1A 2RBKA 3ZH9B 4YA6A 1J00A 3OESA 4XIGS 3ZHUA 1DKUA 3FHOA 3IVCA 2OZVA 4HNAB 4GD3Q 5D3ZA 3FGNA 3PEYA 5GY7A 3HB9A 4JUFA 1E63A 1JIQA 1OOEA 1VIAA 3UJ7A 1E79D 5D5QA 2J48A 5D5HA 4HDMB 1FP6A 1BCSB 1V1JA 1KKLA 3HNRA 1HK7A 2F9FA 2JKVA 5IH7A 1JH8A 3VZRA 1CUWA 3AF3A 1JKJB 4RPLA 1ADCA 1N1DA 1GNLA 4I9NA 1NFRA 5TB5A 2RBGA 2R6JA 3RJMA 3R3JA 4BVGA 4EF4A 4BPBA 4QM6A 3TOXA 1AXGA 2BFCA 2W4MA 2V9PA 2ZJAA 1EM8B 3ZNPA 4AUKA 1EFTA 3WNVA 2IPLA 4FB5A 1DT5A 3GVPA 4L57A 5AFSA 4M8LA 3ER8A 5CX1B 2G07A 3GC6A 1DXHA 4TXNA 1E66A 5A7HA 2EP5A 1I1HA 1HFJA 1QKIA 3H3FA 4UHHA 3RS7A 1PZMA 4QWWA 4Z0NA 4IWYA 4MLCA 3DOJA 4IPTA 3IP9A 4KVAA 2JGDB 1DS6A 3EYAA 4RIGA 1SBHA 4TQGA 4X9XA 5F5XA 4ZYLA 2YJTD 5JD5A 5EC8A 4DF3A 1QO0A 4M7WA 5E6SB 2ZDGA 3F7TA 5LSAA 4GYYA 3FXAA 1HPLA 2J5QA 4AWXA 1BX1A 5CCBA 3MGKA 2ISQA 4O4HB 1EFLA 1I14A 2C9YA 2F3SA 3ZQ4A 3K30A 4AUEA 2F48A 1P1FA 3EVNA 1ZO8A 2RGCA 3LPCA 1KAGA 1E1YA 4GR5A 5EP3A 1H2XA 4ZOQI 4FMCF 5FL3A 3ZHXA 4Y3UA 3TPZA 3DC2A 2LGJA 5DXJA 1GPMA 1QFXA 3A4YA 2Y9MB 1G6HA 4JBGA 2VHYA 2AEJA 2IITA 1P2FA 1W0KD 2HUPA 3VUFA 2E2WA 3NPMA 3PPIA 5CXQA 3H0EA 3QPWA 5TVKA 2ZIZA 4MDEA 2WHEA 1OLSB 3KJHA 1UZNA 2HO4A 3IQEA 1IY9A 1U1GA 4FGLA 4GKAA 1GRCA 3DVAB 3SIXA 5G3YA 3TXAA 1M6VB 4D02A 1DKOA 4G63A 2PRZA 2XCQA 3F6YA 4BGEA 4MRRA 1Z63A 1IN6A 3A32A 1SVSA 4PBTA 2ODWA 4ZEWA 1JIKA 3ND9A 4YRTA 5C18A 1G19A 1N8SA 5IMSA 1C0PA 1HEUA 1ORDA 2UV8A 1W93A 1RQPA 2EJWA 3PNYA 2C94A 5IJAA 2WKQA 3UCEA 5EINA 4FOOA 1EP3B 2ZJZA 2ENWA 4I9HA 2VL7A 2UUAB 1KJJA 2FVXA 3K1AB 4PS0A 4FR0A 2HPVA 4DM3A 3ZPXA 1WULS 2INGX 1WKBA 1GU7A 5CIYA 1L7QA 4HYYA 1NP6A 2FSPA 3SYRA 3JQEA 4H7HA 2FW8A 3B48A 2AE1A 3HFJA 4HK4A 5ENZA 5IUNC 1AKTA 3NNNA 3R09A 2TRSB 3M0EA 3T1NA 2ONYA 3FSGA 3CW9A 3DA8A 1HLPA 5DBGA 5CJJA 1MABB 3W9SA 3HBFA 4X6LA 3I6YA 1CUVA 1KO8A 2OSBA 3KV1A 3RVBA 4DIEA 3RFUA 2JHFA 1H6BA 4DRXB 1JQKA 4C7KA 5GM1A 1USVA 4ZAXA 2DPHA 3P19A 4C4OA 1RXWA 1MTOA 4GNRA 4TTPA 2O1EA 2OKCA 2ZLBA 4IDNA 2HN9A 5F3DA 3RIEA 3ZY4A 5H9WA 3UK0A 3B53X 3VNVA 1QSGA 4UOQA 3JATB 1PTKA 3AG6A 4J0FA 4DR4B 5C7IO 3Q7PA 3FCXA 3ITEA 4CQMD 4TM8A 3RWBA 1U2ZA 3OJFA 2J3KA 4A1FA 1NHGA 5L7WA 1RVV1 2V7WA 3MFQA 4ER3A 4AQYB 2CXUA 2PSHA 1ZNXA 4DILA 4A8JC 4D0LB 3HXQA 2ZJ6A 2I80A 4MQLA 2RD2A 2IIQA 3PUZA 4B2YA 4TL8A 1JDPA 4ZT2A 2AS0A 3NOQA 4HGOA 3LDUA 5AM4A 3X1XA 5GZ3A 2C84A 1FFHA 4B47A 1Z6QA 3THOA 3KCQA 1VJRA 3TS1A 1T2NA 3AONB 4NE9A 2UAGA 3NV9A 1CE8A 4JZKA 2QTMA 3KPVA 5DCUA 5ALPA 1O6BA 4TZ6A 2X3YA 3DE4X 4G4GA 3INYA 4MWDA 4QEDA 5IC4A 1NWCA 1LBQA 3ZU3A 3MERA 6REQB 1EB9A 4MWGA 4KBGA 1GQYA 3B1ZA 5HRAA 1RAEA 4WUVA 2G9ZA 1E0JA 1O5OA 1QHFA 5A9SA 1O94C 1TYAE 4B76A 2DF8A 4QT4A 1WF6A 3SQOA 4MA0A 4HCJA 4MINA 5B30A 4DDMA 2HPAA 3IUBA 3SHVA 5BMOA 3TFOA 4G2NA 4JGBA 1DADA 1G4UR 1KI9A 2B98A 3K7EA 3H05A 4YRZA 2WT4A 1TUBB 2CK3D 3ACDA 4MQMA 5E1DA 4YP6A 3UWPA 4D9FA 1XO1A 3N6XA 3HACA 4D7AA 4E4YA 1DQSA 2IUYA 3TNFA 4WK6A 5ILOA 4FIDA 4EJ0A 5MN4A 1RZVA 1SQSA 5B6IA 2GEUA 4MVJI 3UJHA 2B4TO 3T4EA 1PD1A 1PX2A 3AT1A 4CMEC 5EWLB 1UPBA 1XE3A 3HHEA 1RHRA 1HMPA 2G28A 3PNMA 4H7DA 2ODQA 4Z1MD 3K5IA 4WLNA 4DQLA 4EHAA 2R751 2I71A 2WICA 2QD4A 1AQYA 4JI7B 4FEGA 4MPRA 3WIEA 4EGCB 5BT8A 3ZNOA 2AXNA 5HQJA 3HJFA 4PGMA 3OI7A 1TQ8A 4NHOA 4RORA 3WNZA 4HMQA 4CMBA 3DQPA 5K8LA 3UMCA 3T61A 1CZRA 4Y6GB 3KB2A 3PNSA 5FQOA 5B58T 2WF6A 1QVWA 1NPTO 4HT3B 2GEBA 2O8FA 4QYIA 3JQ7A 3LQRA 4A7PA 4E46A 1JBEA 2NT4A 4YEDA 3RH0A 4BO0A 3AQIA 3A6DA 3AVPA 4X0EA 3L40A 4YQYA 3EEOA 4R71A 1RYZA 1XU9A 1AV6A 2Q0QA 3LU1A 3LQKA 2HMSA 4GPEA 3UHAA 2YC2C 3JR7A 3LP8A 1Q7GA 3FDJA 5L7YA 2PQ0A 2BM9A 3MCTA 1B3RA 4KAFA 4NBSA 3OE4A 3N3BC 4W1SA 1GTSA 3O7WA 4Q7EA 1VXRA 2ZAYA 5K8UA 2P62A 2D6FA 3QE9Y 3QWBA 1R2QA 1HT0A 1W4AA 1LU9A 2OM2A 1ZUIA 3CO5A 3RJ5A 4WE3A 5DXFA 5BSWA 3W5AA 1CYEA 2DRIA 2YBEA 5AW2A 1YO6A 2QR2A 1HMYA 3H6HA 4FX5A 4XJTA 3U9SA 4P31A 1BKDR 3CFYA 3EIEA 2ZT7A 4WEQA 1RC8A 4FPXA 2VZ8A 4DSZA 2YHAA 3VR5A 1QKKA 3E2MA 2R4UA 2LCIA 3D4PA 4P83A 3H0KA 2Q4EA 3B1VA 4EB8A 4I4CA 1ILEA 3WL8A 1GUZA 2MWMA 2P91A 1KPGA 4EKYA 2D4AA 4QGSA 4IINA 2OYCA 4MUJA 1XP5A 5A4KA 1I94B 5IJ9B 2JLCA 3L01A 2NUAB 4W5NA 3ZR4B 4EVQA 2UUBB 3PRJA 5JDCC 5GGXA 3H1EA 2GM4A 1NBOA 5AJXA 1WW2A 1JLLA 1TEVA 2AMYA 4IHKA 4IDPA 4Q4LA 1MUUA 2FZLA 2HRDA 2CNWD 2GXQA 4W5WA 4B46A 4DABA 4UUQA 1SCBA 1IUPA 4B7XA 4RULA 4L8LA 3JVEA 1GEGA 2GPYA 2HQRA 1H85A 1VE3A 1XXLA 3TZCA 2FZWA 1M1NB 4FOTA 1PEDA 4S1OA 4WASA 4B43A 3DJYA 4PO9A 1PFKA 3CR7A 3FRHA 2CGEA 4XWGA 2Y1CA 3WFIA 1W96A 2C1XA 3HXPA 2PWZA 2RJ3A 1RYBA 2NVWA 2ZULA 2GEKA 3O0TA 3U62A 3O8OA 3ND5A 3PNLA 3L7YA 3ICCA 1RI3A 1Z73A 2V5AA 4RADA 4ZVLA 1NR5A 5ALXA 4JQSA 1PJRA 2V97A 5H83A 3KUXA 5CVVA 1DDGA 4EDFA 1JDNA 4OHFA 3SXUB 5BSUA 3IEXA 1NNLA 4RVUA 3NTQA 3FVTA 3D6TB 5EJFA 4QHTA 3R8XA 4OG2A 4CKCB 1ODSA 1YB4A 4G85A 4LAFA 2R8XA 4DCMA 2P2YA 4X24A 1AS0A 1BJKA 2V7QA 5A5VA 4UASA 3G2NA 2I76A 3PFWO 4LNAA 2Q5CA 2IWRA 5TJHA 1HRDA 5FA8A 1RTKA 1NNUA 1JJFA 3KDSE 3QVOA 5ESXA 3L8DA 1N5MA 3S6JA 3TI7A 1H2ZA 5DTIA 4GLLA 4DLWA 5JYEA 1YQUA 1SXJC 4RESA 4JHLA 2VXCA 3BHMA 3FW1A 2E4XA 4KKXB 1M6HA 1SUDA 1QWOA 2G5GX 5FBHA 5EL0A 2HB6A 5BOSB 1JIVA 2FRVA 1TLTA 2E0IA 3MS7A 2MSKA 2VNHA 4LXGA 2ZYVX 1BJRE 1T8TA 4AMZA 5AUPB 4EENA 2IOYA 3M49A 1D2CA 2F9MA 3M6FA 1A95A 4LX0A 3ZH2A 4R1QA 3AR6A 4UMEA 4W6ZA 3WKAA 4TL6A 1PTJA 5JYCA 3LUFA 1JLSA 3KS9A 4WN3A 2OGUA 3CSUA 3O4GA 4Q4HA 4YCJA 5LD2C 3A4MA 2YJ5A 2P69A 6AT1A 4OX9Y 4JQZA 1RKBA 5A02A 5LVAA 4EG7A 1I36A 4H0FA 5BWBA 2QXTA 3K9FC 3R7FA 4ODIA 4B8WA 2BLNA 2I4MA 5IWCA 3ZJVA 3AKYA 4Z0HO 3BILA 3A25A 1N8KA 3U4QB 1WVIA 2E1RA 3A11A 3BH6A 3GWZA 4PLVA 4RY2A 5DHPA 3CE9A 4ZI2A 4BHTA 1VPWA 1NBME 3GJXC 4LC1A 4PC1A 4LV6A 2DTEA 2B83A 2JGNA 4FE4A 5TRTA 2JDIA 5FULA 1Q0TA 1MXHA 2WM8A 4G9EA 3UC9A 4Q66C 3OE7D 4M46A 2CLEB 1M8FA 2NAPA 3GL9A 3IA7A 4PRZA 3HJAA 3NKVA 2ZXFA 3FYUC 2BE7A 5FBZA 4CKYA 1P77A 2QP4A 3UMMA 2W6JD 5IVKA 1F4LA 3SNKA 1LPMA 2V65A 2XTJA 3PSHA 3MWKA 2BGTA 4O2BA 3TAXA 3RFTA 1M5TA 1U0RA 1NZDA 2C0QA 4ZEXA 2FI1A 3G85A 1OUMA 4ZWNA 3PDIA 1A97A 1RNLA 5EN4A 3LPMA 1G3QA 3WWZA 1BRTA 1AU9A 2GBCA 1TB4A 2FF5A 4BCBA 2JA2A 3M6VA 1E8NA 5HZMA 1J97A 3K3PA 3K16A 3K70B 1LBHA 5F78A 3NHUA 1PK7A 4DCUA 2RE8A 1L6IA 1S4MA 3LF2A 4LPSA 3LFTA 3CXUA 4B34A 5DGHA 2YJNA 2IEDA 1DGQA 1Y3HA 4OL0A 3F46A 5JI3E 5IZCA 3K15A 4LHYA 3RYHA 3EJWA 3WQQA 3IO3A 4QQKA 1L5VA 1IEWA 3E7PA 1EH5A 5B1SA 4EQ6A 4H31A 3SICE 1FIUA 2W93A 1O4WA 3PVZA 4HDCA 3H2KA 1KRXA 1HNNA 3GG2A 5FBQB 5FA6A 4S3MA 1EUDA 4AJLA 4GQBA 2GM3A 2R48A 1WMFA 2JHAA 2PPLA 4DN6A 2Z2JA 3RODA 1JQAA 2PKWA 3ILVA 2XMDA 1KE1A 4NAHA 2VP5A 4D8WA 5ER6A 4O4IB 2PJZA 3C43A 4DMGA 3L92A 5EG5A 2EKPA 4GO1A 2ODEA 3T7DA 5KUTA 2OYRA 2PGOA 4ENWA 1GZ4A 4CFZA 5A62A 5T7BA 4XWWA 3GT3A 2YZNA 3E48A 5BR7A 3NHKA 4CEHA 1KI4A 5BSVA 4BKMA 4BLPA 2BDEA 3PJRA 4Q03A 3ANXA 4PE5B 3PIRA 2EW1A 3QOWA 1E7SA 1MT3A 3QWHA 4O4LB 2IHYA 3GHYA 4D9EA 1E3MA 3R6TA 1VCNA 3AFOA 1MHTA 3BN3A 2EHJA 2XF2A 2OGSA 5B7NA 3A3PA 4UMFA 1LS1A 1GUAA 1JBQA 3NWBA 1DG3A 2P0AA 3C5HA 4UAVA 5IC5A 1M10A 1CCWA 1KEZA 3GT7A 6GPBA 3RBZA 3VSEA 4F2WA 4D3FA 4UOZA 1M6WA 4RFVA 5HNKA 1DP4A 2Y27A 3OZXA 4OFXA 4NVRA 4I50A 1TADA 2O3TA 1P7CA 1MJFA 3PXUA 2POCA 4TMXA 3UMGA 5F52A 3QXSA 2ONZA 2EFDB 2VDJA 3FTFA 3CJRA 1G8GA 3CPSA 4UUOA 5DTEA 4FZRA 4IZOA 1BMQA 3L7BA 4FZJA 3E61A 4CEJA 3H8SA 2NO0A 3BDIA 4P5PA 1PNTA 1YS6A 3VC7A 4J4TA 2AUTA 1C1DA 3V4SA 4IFBA 2IUTA 2BY4A 3SDSA 3NIDB 1QB7A 2QN2A 3FNEA 2GQ0A 2UUCB 2XNKA 4MGEA 4RK7A 2CN1A 3WA6A 3ZGXA 2IDZA 4CTOA 4L4UA 2ZUTA 1XEWY 1Q57A 1X2EA 4FFSA 4KFTA 4LWQA 5D01A 2ZYIA 4KW7A 4I19A 4KRFA 1LUAA 4DEYA 3DAOA 3DBOB 1R8QA 1P7YA 2VK8A 5BORA 5KWJA 2H7VA 2BT4A 2D8MA 4UHFA 5IT5A 3R0ZA 4LXYA 2WNHA 3ZIUA 2YN4A 1XMPA 2ORIA 5FWYB 3VZCA 2GWRA 4K46A 3C6YA 3HNPA 4ZYYA 1FYXA 2WPDA 1OV6A 2BDUA 4ZCPA 5KZMB 1N0IA 1BIFA 4BU1A 3NV7A 1E1DA 5J23A 4GZ3A 1QH0A 4KNVA 4QO8A 4RV9A 4V03A 3WL5A 2AF4C 4M88A 2QW0X 1L5MA 3FVQA 1PLJA 4XD7A 1O8CA 3K0CA 3LX6A 1EX1A 4YONB 4J1NA 3E7FA 1P5FA 4JC4A 3R6LA 4DMHA 3VX3A 3WDSA 3WGYA 3LW8A 4ZZ3A 5ALNA 4B6QA 3IP8A 4YAFA 1KJ9A 5A3JA 4W7IA 2W00A 2XSZD 4YI5A 5DW3A 1LS6A 2BJVA 2IUEA 2QE6A 3EF0A 4HLUC 3QLJA 4JQCA 4WJLA 1USUA 1CLUA 1ADGA 4XTCS 1XPUA 4LTNA 2F67A 2ZR7A 1VE9A 3KT8A 2Q7DA 1P4JA 3VO2A 3RT1A 4EATA 1CF9A 1JDBB 1SBIA 2CUNA 3EA4A 4TV8B 4IMPA 3BCRA 1FJ2A 4ZYVA 2GO1A 3HGTA 5BV2P 3EEIA 3GP5A 2OZLB 2AMLA 5KQGA 2GBPA 3DBRB 1DSSG 3G7UA 4PZUA 4CKXA 4ECEA 4NCAA 4DS3A 3JALB 5CEJA 1P2GA 3D5EA 3FMGA 3H9JA 3VU9B 5C8ZA 2HMTA 2UZ4A 3WGIA 2R1TA 4O2LA 3PX7A 5DHUA 3K6JA 4FYYA 2PT7A 1ZUNA 2RH9B 1IXKA 1H93A 3IODA 3OM8A 2CMHA 4MS4B 2FWMX 4Y0VA 5GONB 3WY9A 4D97A 4J2OA 5T8KA 3E27A 3P0EA 2PXXA 3QFHA 3QIAA 4DC1A 3HM9A 2PYZA 4FFMA 5EE9A 2BJWA 4RJJA 2D5AA 4PQGA 4YS6A 3ZI4A 3JQ8A 1ZLXA 3PD1A 4LF6B 1KQ3A 1KE2A 5HS4A 3MT7A 2WNIA 4DC9A 1NVXQ 2FW6A 3NOVA 1EDBA 1K4MA 4KDCA 4EBBA 4FE7A 5DB4A 1GPNA 2GHTA 2KE5A 3QUBA 1RLOA 2HXSA 4N3NA 1VPVA 2V7EA 1IEVA 3D0OA 4YXWD 2CXSA 1IY1A 4FMBB 1MP0A 4HB2A 4K9RA 4LKOA 4OXRA 4BVEA 4DA9A 1X1SA 3C74A 3H9BA 3OLZA 1BRMA 1YKSA 3PFFA 4G0OA 2BMVA 4QKQA 3AIKA 3AU9A 1KS9A 3WL4A 3HR8A 4RD2A 2P30A 1PG5A 4K2HA 4GMHA 1XD8A 3BJMA 1RZRD 4JJZA 2QRGA 3IVGA 2DERA 4JBLA 5LP6B 1Z16A 5ISMA 3AILA 1OH5A 5CG1A 1L5WA 1M34A 1T4CB 2OD7A 2Q7XA 3GJ0A 1EK6A 3PIDA 4CRWB 3VU0A 2EC5A 2ECPA 3HBJA 3HADA 4POOA 5CXUA 5IUJC 4Q15A 5T5QA 2XCSB 3CV3A 5DHFA 1N6IA 2VDPB 5TF4A 2PUWA 1RCFA 2FR0A 2X15A 1P29A 1WZCA 3VPXA 1WMBA 2A33A 3P9SA 2HJGA 3ETEA 4U9UA 5FTJA 3X1JA 3G2KA 1JJVA 2HRZA 4URYR 1PQ4A 3FBGA 1OWPA 3FM9A 2HV8A 3R3UA 1FDSA 1W19A 3RTBA 3S29A 1FX0B 3WG9A 1NV8A 3O47A 3TCKA 3T1OA 4OQNA 2HKIA 2FPKA 5CYPA 4RV5A 1AKQA 3LRXA 3THSA 1NXXA 1G6OA 4YT4A 3JD4A 3RVDA 1VBMA 2BDTA 3CUSA 5BSGA 4L16A 3QVJA 1DC3A 1V5FA 4AG6A 1OYYA 5J3JA 3AVWA 3GFTA 1YZVA 3TTXA 1YI1A 4RVGA 2X2PA 4CGYA 3HH8A 3PQ5A 4XH9B 4YCDA 4RY0A 4CODB 4U2GA 5JFOA 1FS5A 2QRJA 5JSKA 4B6FA 1KR5A 1WDMA 4KI7A 1JG3A 2XKJE 2CFCA 2I67A 4BVBA 1FVHA 1C0IA 3C7AA 4CCYB 4KPYA 2O05A 2PCJA 4DLZA 4IG9A 3GGSA 2IUFA 1X92A 1YZNA 1N2CA 2I55A 3UT6A 3SSOA 5A0TA 2QYHA 1EP9A 3KQOA 2ECFA 1FBTA 1GCAA 2SCUB 3GZNA 4GRDA 4L73A 3UCXA 1ZUWA 2CL5A 3FLEA 2OO7A 3RLFA 1MXFA 1E5TA 2MIIA 3KM0A 3S40A 2ZUBA 1ISJA 1AG9A 1SM4A 1XWFA 4MWSA 4XIIA 4EJFA 3L49A 1LVHA 1HE2A 1M2FA 2C4HA 1QPBA 4PYQA 3TF5A 5C53B 3ZZTA 1P5RA 3OSUA 2YHBA 3PF9A 5FIUA 1QBKC 5JLAA 3U4CA 1XYGA 2XITA 3ESYA 4FLMA 1C5KA 1IYZA 2X1HA 3TOZA 4M8NE 2XTZA 3NWEA 1XFDA 4NS4A 3TFWA 5KVCA 2AJTA 3L5OA 3CNQS 4FFNA 4A2PA 2C1ZA 4EFKA 2JIQA 4G8BA 4A6PA 3CLUC 3TTUA 3ZWYA 4XVQA 4YY3B 2Y3IA 2ZI4A 1LA2A 2REQB 3BMQB 4NONA 3PC3A 5EIBD 3VR0A 2EJBA 2ZVQX 1X8KA 3BTSA 4QQ8A 4C1BA 4IM7A 1AKUA 4H18A 4Y0AA 5FNVB 4GMDA 1OB5A 4BJHB 1J99A 1U3TA 2RAPA 4MRPA 4CF7A 1MO4A 4ARUA 5JH7F 4H6VA 1S6YA 4XW2A 3FTNA 4PYKA 4MROA 4X97A 2HIMA 1A9YA 2VRCD 3DTTA 3A4TA 4E70A 1NJ8A 3Q6NA 5TPZA 3ZHYA 2LIVA 2ECOA 1NTRA 2ZUCA 4M1QA 4ZI7B 3COZA 4LC9A 3LVQE 1NXWA 2BRUC 1U8ZA 1I5OA 5DVZA 2OXRA 3MEQA 2UZ1A 4RKEA 4DR5B 1Y1LA 1GILA 2E9SA 3TFQA 5LOVB 3NHFA 3W1VA 4Q1BA 2JIPA 2Y1FA 1PQWA 3MRTA 1PX0A 1E1QD 2WNSA 4RPHA 1L4NA 3NVAA 1W25A 1KP9A 4PYOA 4DCNA 5FTWA 5CTAA 3ZWWA 3VNUA 1GPKA 2P9YA 2J3JA 1N5DA 3VR6A 2CBZA 3P0FA 3WWCA 4R2LA 3CSDA 3QELA 2CVZA 3WGNA 4JI1B 2P4HX 1A9TA 1J0CA 1L9KA 4CNQA 3K0AA 4RUKA 5EIAA 5KNDH 4BJ3A 4EGFA 4OM8A 4I55B 5KHLB 1G8YA 3N0WA 1F2TA 1NYLA 3RF7A 4OFBA 2H2GA 3OP4A 4V0OA 4M0PA 3FD8A 1JHUA 1YVUA 1WU8A 2PVPA 2VNAA 2ZIWB 4JJKA 3HSSA 4HNVA 1M6EX 3JZAA 4M0UA 3DHVA 3GJZA 3WFJA 2H2AA 1UWCA 2OQRA 3FTPA 4Z7JA 2QYOA 4JSRA 5L3RA 2C7BA 4Z3OA 3AHIA 3IAAA 3O91A 4XYLA 1O9HA 4KNWA 1CVIA 2PWYA 3ZD6A 2DTDA 1SBCA 4LDRA 2P1DA 1XZKA 3LSTA 1LPSA 4PC3A 4ZHQB 4KQEA 3QNUA 3BRSA 3KVOA 3AIOA 3PKIA 3TTTA 1KAQA 4RFLA 1WE2A 4DLBA 3PDUA 2XECA 1ZYUA 2IHBA 5E2BA 1KQGA 4DV7B 3PGKA 4IYRA 3MGAA 3FGPA 3SHTA 4MP8A 2AOUB 1DTWA 2VT6A 3N2YA 3QXHA 1E4EA 1PFUA 2ZIXA 4MKZA 1T3TA 4OJYA 4PZYA 3VH3A 1D0SA 4PPNA 5H16A 4EJSA 2DUWA 4ETIA 2X7XA 1R6TA 2ADOA 4XVUA 4YJ2F 3VR2D 4BFUA 3RVRA 3Q3IA 5J2UA 1CUCA 1SO8A 3LHDA 3DD1A 2VP3A 1UKZA 4N49A 5K05A 4FXOA 3CTPA 5BOVA 3KHSA 4OBXA 3W8DA 4RK5A 4BFCA 1YE3A 2JLVA 1COWD 4MH0R 3GNQA 3JWGA 1UFKA 2IA5A 2G76A 3DHEA 4C03A 4PXSA 3KELA 1RQXA 1Q7CA 1SULA 2B37A 3R0XA 1LFAA 3O2SB 5IPFA 4J7CA 3WNDA 3BM5A 2MSNA 3JYOA 2ZIUB 4BNMA 1Y5IA 1QYIA 3ECCA 4KSCA 4YRSA 1IULA 5SYMA 3UG7A 1E2BA 4TSKA 2WWIA 3HKDA 3ZHCA 1N25A 2IPAB 2CLLB 4YO7A 3STWA 1I3OA 3CZQA 3WZMA 2HDNB 2Z2KA 4MQEA 4MQFA 5IBPA 4JLOA 3Q12A 3DDCA 3LX8A 3U13A 2YQZA 3W1EA 2BEKA 1YK0A 3IVAA 3WIBA 2DJ5A 2YYAA 4A6DA 3U4DA 5DLQC 5C51B 3TKLA 4Q9HA 1XYVA 3SPXA 4Q7JB 3KTAA 3UGTA 2I6FA 2NO4A 5THQA 2TMDA 2UVDA 2WUGA 2O4UX 4DQXA 1Z17A 4TOIA 3W7BA 3M33A 1VIYA 1EP1B 4DM7A 1ZMBA 4MRVA 2ZI3A 1REQA 4UTPA 4FEEA 3E81A 4G1EB 4JP2A 1SB9A 4MI1A 4Q82A 2WSLA 3E4DA 4FB4A 2P2CA 3T7IA 1OHHA 4TUYF 3S1LA 3ETHA 5F7ZA 3UTCA 3C45A 3NJ4A 1OD6A 2W6MA 3R6DA 3WB1A 1HDXA 2WWWA 2LTAA 4OQQA 1L1EA 2ZAMA 3SC6A 3CZ9A 4YMIA 4F1KA 5E6RA 4MVJP 1ZM9A 4IVPA 4OAPA 3RCBA 3V7YA 1EPUA 5CW1A 1LDGA 1UEJA 2L0XA 3NHWA 1Z0KA 5ALOA 5AVQA 3OKAA 4J07A 3Q3VA 3B7PA 2I29A 3HB7A 5D3QA 2LBPA 4FC6A 4Z4FA 1OGYA 4H7JA 2GZ1A 1T4GA 2FN9A 1JG2A 2I7TA 3RF6A 1L7AA 4U6QA 2DFDA 1EG2A 5H3CA 4KWTA 5KIAA 4PLGA 4DYHA 3FCEA 3L0DA 4AWAA 4LOAA 1VL6A 2XYPA 3LT1A 4GOJA 4OB7A 3U7EB 2ECQA 2PKYX 2HF7A 3EIOA 4G8CA 4B3HA 1MC8A 2YJ4A 3ZE0B 4QJIA 1GJRA 3WAJA 5FI0B 5AI9A 4DYDA 3GJSA 3ER9A 2Z5LA 3CLKA 4B2IA 3EPJA 2FP4A 3QHPA 4YCNA 2C04A 2HJHA 3N87A 4BZXA 1PHRA 2VA8A 5SZHB 2KHZA 3KCNA 2WVGA 2C77A 1LWNA 1KO7A 2HHCA 3OMLA 4YPFA 1MQSA 3ZXSA 1C9NA 4NMXB 2NU8A 5CBKA 5CBPA 4YDQA 1FNSA 1Q1ZA 2FMXA 2GN2A 3HP1A 5DI9A 4QUEA 1E59A 4RK1A 1DTSA 4P82A 1S3GA 3Q8LA 2NU6A 1A7JA 1WMSA 3BBPA 3OJ0A 1MC5A 5C4IA 2XXAB 3AVYA 1JL3A 3LA8A 1O57A 5HIIA 2PJDA 4TMFA 3TR0A 3UZUA 3ZW8A 4FBMA 2W42A 1JAYA 4M37A 5I3ZA 1FFAA 1LDBA 2PVSA 2RIPA 1ODFA 5IDWA 1YGPA 1XVAA 2H0AA 2HHAA 1CDEA 4MQBA 3KDPA 3UJ3X 3VO1A 4QOFA 5EMHA 5KKCA 2IE0A 3C15C 2O8DB 3PEFA 3H4MA 1OKKD 4NBKA 1JX6A 2OXTA 3WIOA 2Z83A 3AYXB 1AA9A 2JJQA 5B37A 2J0EA 2Z6AA 1F5SA 1YQEA 1MW9X 3H0CA 1PP4A 3HBNA 4AS1A 3MMSA 3D7KA 4MKXA 3WOVA 4QPPA 1RHQA 1ZGJA 1ORWA 3PVCA 4V1CB 3EYWA 3IB6A 1X86B 3GPCA 3OF2A 3T5DA 5AD1A 4G6ZA 3TAHA 3W6ZA 2HT6A 3GCGA 1WXHA 2NO1A 2VF4X 2YNMD 2WZBA 1RM4A 1E1RD 4LFAB 3KJXA 5J4KA 2CHUA 2D2XA 3ILXA 4G5SA 4GW3A 1KYTA 4KXQA 4MICA 1SC1A 1HL7A 2OXCA 3DZIA 5EUMA 3W06A 2HSWA 4U8HA 3G2MA 1X13A 3COWA 3GT4A 4LE1A 5M29A 1AKYA 2W58A 3HBMA 2DFVA 2FW1A 3CW8X 3LHKA 3OOEA 1JA1A 4PEVA 4QECA 4BNYA 3EDYA 4KH1A 1E99A 2YYZA 3JAKA 3VVLA 1EVKA 2H8GA 3FCSB 3V3KA 1EVEA 3T7JA 3HP7A 5DRYA 2DPLA 1RW4A 2IZ7A 4M9CA 1QCYA 2BFFB 1YRLA 1INLA 4BTEA 5K2OA 4QFDA 2VJDA 5DNCA 1DEOA 3ASVA 4PXAA 4R2XA 2GBLA 1JDTA 5FAXA 1VG9B 1TVKB 1W5TA 3Q6MA 4WBNF 2FK8A 3Q9LA 1GXSA 4DA4A 2A86A 1RYMA 3ZCRA 1EXDA 5I9BA 4PVCA 2O8BA 4XSGA 1LBEA 4E3ZA 3OD5A 3QU9A 1H69A 1YZLA 3DO8A 4EUKA 2CV1A 2VXOA 3B9BA 5LCXA 5H59A 1J4AA 3H4TA 5B3JC 2QG6A 2BFAA 2DHCA 3QA9A 1Y3AA 4ZYZA 4B6EA 4BTVA 4X91A 4B82A 2OK7A 4AU1A 3QSGA 5JIBA 1EG7A 3UA4A 3COJA 2HBZA 2ZQ5A 3H86A 3MBIA 4NBNA 2XZLA 4XQEA 1T5IA 2ZPAA 4BAGA 1CJUC 1DXOA 4KLNA 1W2WB 4XDHA 2FMTA 1B8VA 1L8LA 1CULC 1MKYA 3N8HA 3NM4A 3R77A 4TT3A 3P9QA 5F2KA 3RK0A 2P9QA 1X7XB 2Q41A 2HWWA 5BVHB 4DNQA 5A5FA 1FQOA 3WJAA 2HT1A 3W9BA 1NQOA 1P3Y1 3K2BA 5TJ9A 4C1NA 2VP2A 4Q47A 5AI8A 5MGNA 4BDSA 2NTNA 1LSSA 2AQHA 2LVBA 3MWLA 3Q3JB 1RBYA 3LL7A 1Y6JA 3IC5A 1HZZA 2OOKA 4DBVO 1UT8A 4YUVA 1T0HB 2QSYA 3W4JA 4FEYA 4GT1A 2MHCA 3E3NA 1LV7A 4CW7A 4D25A 1MB2A 1L5LA 4OXIA 1JEQA 2NV0A 2VAXA 1AKVA 2AEFA 2QA5A 4U9IS 4ZOBA 5FT9A 2M6LA 3NDPA 3CLSD 3R7SA 7ABPA 3SLGA 3MBKA 2XUIA 1Z0JA 1A8PA 1T0PA 4MUGA 3JQ9A 2AI2A 2C3YA 1XRNA 2Y1KA 4OJMX 2AJLI 2EV9A 4D99A 3ED1A 3D6FA 1JVSA 4U2DA 5E3JA 4D43A 1YTUA 3GFPA 2XZTA 2Y1XA 1TJ5A 2HH9A 4JU8A 3GEEA 1PBTA 3EIHA 4LJ6A 5FOUA 5K6AA 1L4KA 1OTXA 3A10A 1V8OA 2VKQA 4ROTA 4XWOA 2HCTA 3ETLA 3G5TA 1KKUA 2VYVD 3L04A 4F1WA 1B15A 1MB9A 1G8FA 1V1MB 3OT4A 3UHFA 2HXGA 1FU7A 3WRYA 3WWEA 2WJVA 3UTDA 5E8JA 2AZ4A 3ESDA 5K8VA 3OX3A 2QSJA 4G5QA 2C2YA 2I3BA 3VUEA 4CMCA 4CQMB 2EIXA 4PAOA 1C7QA 3DV0B 3OIFA 5CTJA 3TTSA 2OZPA 1G8SA 1YR1A 5DF1A 3J80A 3I2IA 4IEIA 1DEHA 4Q3EA 1MFPA 1NONA 1LJ8A 1MC1A 1MH9A 1Z6GA 1NATA 2N46A 3GZTB 4JWKA 4RQBA 3GU3A 3LECA 5JC1A 3LQQA 4XPZA 4YAJA 4G9GA 4N1AA 4B87A 4G0ZA 5IHPA 5HUHA 4BFLA 1IQ0A 1X7YB 2ACWA 4XWKA 1WWKA 2FQWA 4JBHA 2YVAA 3TPCA 2X77A 4CT5A 2QRPA 4IIHA 4NCJA 1BE0A 4QFCA 5C80A 5FOQA 3FJYA 2ZCJA 4EB6A 3G13A 5ARCA 4RXTA 3VH1A 1XX6A 2IYPA 3CLVA 4TSFA 3RIHA 4BLTA 5EJ9A 4LISA 1YCFA 1Y3FE 4IQGA 1B93A 3E9CA 3I39X 4M86A 5F5LA 1Z2NX 2EBHX 4UVEA 1I0LA 1J06A 1I3NA 1UZUA 3WK4A 3EIQA 1L4FA 4OY3A 1X9IA 4FKZA 1ESEA 4FFPA 3CF2A 3VU1A 4QQFA 2OGTA 1UBMS 4AO7A 1P7VA 3DS8A 1MPTA 2RC6A 1UZLA 1DRVA 1ML3A 2XNHA 3PRKE 1Z25A 4JLPA 3JPYA 4OHOA 5GM2A 5HG0A 3TNLA 1W8DA 3AEKB 1ACJA 1ZJJA 1T24A 1ESDA 3IOBA 3WGTA 1C1YA 4BMYA 1J8DA 1U81A 3IT1A 5KCZA 2PN1A 1BNCA 4PLWA 4FFVA 1BTOA 4O4JF 5H9VA 3P52A 1ZL2A 4K7JA 2V6BA 1J2JA 1GG9A 3QQ5A 4FU0A 3A1TA 4JA0A 3TW4A 1WY5A 1FPQA 1Y6ZA 5H3HA 5IDVA 4NP6A 1DT3A 3IMEA 1J39A 1Q1BA 3EUFA 1ZH4A 2QUBA 4LZWA 1MU0A 4X7PA 3B6KA 3HK2A 3QOFA 1G9XA 1L5SA 4W5JA 1H8EA 4FYMA 3RR2A 4KR9A 3SJCA 2H1OA 1M0WA 4L85A 2PUHA 4YJ2B 1JZTA 4PNZA 4BKPA 4CTMA 4JBYA 2IELA 1L3CA 2Q6OA 2QVCA 3JASB 3U0BA 4J7UA 4AZ3A 4WOCA 3Q9NA 2VHEA 3ZWXA 5FPPA 1Q7TA 1SC4A 2WAMA 2X3FA 2J0SA 1D6NA 2ZT8A 4JB8A 3CZ4A 2OKGA 1KI1A 4TTVA 3V55A 1J25A 1X80A 3CX7A 3PQFA 4DC0A 4HDNA 5DWQA 5JYDA 1R7RA 4UVIA 3COVA 1LRKA 3JWEA 3DAGA 1UMDA 4BCDA 2V0CA 1CQXA 1PGNA 4QSMA 1E5LA 4PN7A 4ZICA 4TLLB 4QUBA 3OLCX 2PR2A 3ABRB 1R6BX 1NMZA 3WYAA 1L6RA 2XUFA 3ZOKA 4DARA 1YB1A