1TQHA

Covalent reaction intermediate revealed in crystal structure of the geobacillus stearothermophilus carboxylesterase est30
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
242
structure length
242
Chain Sequence
PPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTGPDDWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIEQEMEKFKQTPMKTLKALQELIADVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESLDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase precursor
publication title Covalent reaction intermediate revealed in crystal structure of the Geobacillus stearothermophilus carboxylesterase Est30.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 95
structure length 242
sequence length 242
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tqhA00
2DQZA 3STTA 2J4CA 5JD5A 2WQZA 3F96A 4B9AA 2HADA 3KOOA 1MJ5A 2DFPA 5KREA 1LPOA 4UHBA 4AQDA 1YA4A 1XQYA 3B12A 1X2EA 4K5QA 4BDTA 5HKBA 4KRYA 4JYPA 2WKWA 4BC1A 1WB4A 4OB7A 3G9TA 1EX9A 2D5LA 2Z3ZA 5CH3A 2H1IA 4NVRA 3C5VA 4C6HA 1ZI9A 4PV7A 3ILSA 2PKYX 3M3DA 1MU0A 4E14A 3WA7A 1M33A 4K2AA 2PM8A 4GW3A 1B6GA 1JT2A 4A5SA 3BL8A 5DJ5A 1QIIA 1FFEA 4L3WA 4IH4A 4H77A 4M0EA 1H2WA 2WU4A 1IUNA 1DT3A 5AOAA 1CUEA 1W1IA 4Y2QA 1AKNA 1GZ7A 1K8QA 3ANSA 3IIIA 3QPDA 5DYWA 1H23A 2WHRA 5DYYA 5DTIA 2OQVA 3EQ8A 4B7ZA 4ZXFA 4Q34A 5E2IA 3AFIA 5AM5A 4WCVA 2XUIA 1DWQA 4B0PA 1CUDA 4MQLA 1VZ3A 4N5IX 4ZV7A 1XRQA 4X6UA 5AP9A 2V97A 3FYTA 2OLEA 4G5XA 1XZLA 4J0HA 4Q82A 2WTMA 4J3JA 1Y7HA 4QDTA 1VE7A 1DX6A 3WKAA 1IZ7A 3Q8WA 2WILA 1XZMA 1XLVA 4U2FA 4XIIA 4YK7A 1JKMA 2JGIA 2I78A 4QDZA 2OQIA 3ANTA 5HFAA 4WY5A 3DL4A 4C4XA 5AKZA 3O4JA 4H7JA 3STXA 3CN9A 1YB6A 2JEYA 4WFJA 2CB9A 2R8BA 3EQ7A 1HPLA 2WHQA 1QIEA 2PU5A 5C8VA 1QOZA 1BCSA 5T4EA 3AINA 5A7FA 2WG1A 1DINA 2WTNA 2FUKA 2BCEA 3ZWQA 3G0GA 1CQWA 3DKKA 2Z8ZA 3VDXA 3G0IA 5CT9A 1CUVA 3EBLA 1WCYA 3BIXA 3A2MA 1E8NA 2WU3A 2WHPA 3KXPA 3R0VA 2RHTA 3WKCA 1UK9A 5CH5A 3RLIA 1ZIYA 4EY6A 4HVTA 4PSUA 2ZYIA 3TJMA 4JH0A 4DSAA 1QONA 2PSHA 2G5TA 4PF1A 3D4LA 2HDWA 2WG0A 4QE3A 2OCGA 3VJLA 4NMWA 4U2DA 1P0MA 1LBSA 1UK8A 2C7BA 5FRDA 2OGZA 2GYUA 4BE9A 2YH2A 3ESAA 3BJMA 4BP9A 5FUMA 5AK3A 2PSFA 4BZWA 1ZD2P 1PJAA 3PFCA 3A70A 4U2BA 4UHDA 1XZFA 1QIJA 2XQJA 2XMRA 1XLWA 4DYHA 1CV2A 2ACEA 4Y2RA 4WFKA 4L0CA 1ZI6A 1G4HA 4F0JA 4Z49A 5JAHA 5ALYA 2J4FA 2WFMA 2XUPA 1MN6A 2PPLA 2GBGA 3GUUA 5AI0A 2PUJA 4BB0A 3I6YA 2H9YA 5DYTA 2PSJA 3H0CA 3FSGD 1YASA 2QRUA 5CW2A 2BJHA 5T4HA 1TKRA 2VSQA 3AZQA 2BKLA 3V48A 1Y7IA 2WUDA 4AO6A 4DSZA 3CCCA 4X93A 1XRRA 3OG9A 4YX9A 5K3BA 4GWLA 1WPRA 4K6KA 3RM3A 3FCYA 1E8DA 3O9VA 2VJDA 4MXDA 2BAGA 4KAJA 4EA6A 4XX1A 3VJKA 5K5EA 4Y7DA 5AKXA 3STWA 4LYDA 2H7XA 4HTAA 2JBWA 3R3WA 5HQ3A 2HA2A 5I9IA 2OGTA 3P2MA 1UOOA 2VTVA 1H2YA 4AMZA 4ZWNA 4J0JA 1HLGA 4ITVA 2Z8XA 4FNGA 4Y2VA 3KSRA 1U2EA 4UBMA 1R50A 1SCKA 3HYSA 5ALVA 1ZIXA 4QLOA 4B0OA 1MAAA 3F98A 5IVHA 5A6VA 3I6MA 3OPMA 5ALRA 2QXTA 3K9BA 4AO8A 1JI3A 2Y6VA 1ZD5A 3BF7A 4WDQA 2Z3WA 4MWTA 4JYMA 4UFNA 1TAHA 3RK4A 1CIJA 4N8SA 1H2XA 1P0IA 4C87A 4PW0A 5IVKA 3MGAA 1F0NA 3QH4A 4PSCA 1CR6A 2ZSHA 4Q3KA 2WSLA 2IX9A 5BWBA 2VAVA 5DNVA 1CLEA 4ZGBA 3OC0A 5AI4A 1KU0A 5ESRA 4UBNA 1ODSA 5A7GA 4OSEA 4IQ4A 2WFZA 3H2JA 3VVLA 5J3JA 4FLMA 4BAGA 1ORVA 3R3VA 3D2CA 1BN6A 1VA4A 3WLAA 3HC7A 2OAEA 4P08A 1BROA 4KEAA 4UBJA 4KE9A 4ZI5A 3R3UA 2Q0XA 1YS1X 1GPKA 3O0DA 3T4UA 1YCDA 1AUOA 4UFPA 2G63A 5LZ7A 2ZYRA 3DD5A 1ZJ5A 1HKHA 5AKLA 2JGMA 4OD0A 2HA7A 1U8EA 2B9VA 3R3XA 3W9BA 2QZPA 3W9UA 3NGMA 4S0XA 1BS9A 3FOBA 4BRZA 3DYIA 3QPAA 1P0PA 1J1IA 1UOQA 2CBGA 1YSCA 5DWDA 4UHFA 2ES4A 3W06A 3QMWA 3IURA 2XDWA 4XVCA 4NS4A 1WM1A 5HK9A 2FJPA 1EA5A 3PF9A 5BV7A 3V1MA 5A7HA 2FX5A 4DMCA 1DQYA 3VJMA 3HSSA 3AZPA 1JJBA 3QVMA 1A7UA 4D9JA 5JD4A 2GZRA 4FLEA 3CN7A 1XRLA 3AUKA 1CQZA 4G4IA 4BYMA 4QLAA 1UXOA 3WYNA 1ZGBA 3C87A 2C58A 4UFOA 2DHCA 3E0XA 1R9NA 5ALJA 2PUHA 1SCIA 2W6CX 2C0QA 5ALKA 1N5MA 1GPNA 5AM0A 3D5EA 2PVSA 1K6EA 2ZJ6A 5AM2A 1W76A 3ICWA 1HQDA 1CVLA 2Z5GA 1WHTA 3DCNA 4KR0A 5AH0A 3OTQA 1G42A 2XUGA 1HBJA 4KYVA 4AN0A 1AZWA 1O6GA 2QR5A 5I7UA 1MT3A 4CCYB 5LIPA 2WUGA 4B9EA 4Q1VA 5BWCA 1XRMA 2WLSA 2DCMA 1JFRA 1DU4A 5E4YA 3FYUA 3WA6A 1EDEA 4B80A 4MYDA 1TK3A 4QDUA 1JU3A 3AZOA 3N2ZB 4FNMA 5ALZA 3K6KA 1VA5A 2HU5A 4K6GA 4P9NA 4W1PA 2BFNA 3M81A 5JAOA 1UZAA 3FCXA 4F60A 2W22A 5EFZA 2PBLA 3DL7A 1QTRA 4HAIA 4KE8A 3ZI7A 2XUDA 3B3QA 4BVKA 2GBFA 3M82A 4G8BA 1ODCA 2JGFA 1UK6A 4OU4A 1N8SA 1CUFA 1A8QA 4B84A 5LKAA 4I3FA 3DOIA 5HK8A 2HA4A 2HA3A 3ED1A 3BIWA 5AM1A 4BVLA 1TQHA 1JMKC 3DNMA 1T2NA 1CUAA 4FOLA 4QEKA 1R3DA 3M83A 3WJ2A 1CUIA 2HRQA 3DKRA 3VVMA 2WIFA 2O2GA 3G9UA 3C45A 5AKIA 2K2QB 1EI9A 1DWPA 3QMMA 3WWPA 3IUMA 4LXGA 1LNSA 1YA8A 4X00A 2B4KA 3QMVA 3BF8A 4B6GA 1C7JA 3PF8A 3HJUA 3Q0TA 2OAGA 2VJAA 3OOSA 4I4CA 1LGYA 3E1GA 5CT5A 3I1IA 2VA9A 2ZJFA 4GEGA 2WFLA 4BAZA 1THGA 1XZKA 1RWQA 5AI6A 2HA0A 4GHWA 5ALWA 3WKEA 3RARA 2EDCA 2WIGA 2XMCA 4BAUA 3GA7A 5AHXA 5K3AA 5HF6A 5AKKA 4HXFB 4QWWA 4X71A 2GYWA 1YR2A 1X2BA 1E89A 2Y2VA 3L1HA 3W05A 4BC0A 5JAUA 1CUBA 1XQXA 4QZVA 5HKAA 4MEAA 4H0CA 3WK9A 5DNWA 5K3FA 3OURA 2WIJA 1S8OA 2VT7A 2PSDA 1EXWA 3LLCA 4EB0A 5AM4A 1P0QA 1LPBB 3WL8A 3GZJA 2AJDA 4CG1A 4H7HA 2VJCA 4C01A 1JMYA 3IBTA 3V9AA 4FKBA 1MO2A 2AJ8A 3ICVA 2BUAA 1DWOA 3I2JA 2Y6UA 2OCKA 2QT9A 3WWOA 4IO0A 3G0DA 2CKMA 2AJBA 3LS2A 5IVIA 4AN1A 2UZ0A 3B5EA 3WQHA 5FDFA 4JNCA 5C81A 3H1BA 1TCBA 1QLWA 2XQGA 1D07A 2CJPA 1RYYA 2ECFA 5A62A 3G8YA 4ETWA 3WL7A 1LPPA 3TEJA 2RHWA 4W63A 3MVEA 3U1TA 1BEEA 3FVRA 3UUFA 5K3CA 4BRSA 5ALFA 4J0GA 3ZPXA 1U65A 1UKBA 2X76A 3OM8A 5EHXA 2CUTA 1USWA 2I3DA 1W75A 5AM3A 4EUSA 5K3EA 2XUFA 5LKRA 5HZGA 3AIOA 1WPXA 2WM2A 4Y2YA 1O6FA 5KBYA 5CMLA 2AJLI 5AOCA 5AJHA 4M0FA 1UWCA 2HM7A 2FJ0A 3E3AA 2XB6A 3UMJA 1WB6A 4BBZA 1YAHA 1XZIA 5SYMA 2BUCA 2WUFA 4B81A 1QIDA 1GQRA 5FPQA 3DOHA 2VATA 2H7YA 5AICA 5FXMA 4PNZA 5IVDA 3MUOA 1RP1A 3FLEA 1UFOA 2XMDA 1ZI8A 3WWCA 1QTIA 4HZGA 5LZ2A 1TCAA 4UBOA 3ZLUA 1SOMA 3GFFA 2GZSA 1N1MA 3STUA 1MTZA 2EDAA 1Q0RA 1T4MA 4KE7A 3I2FA 3C8HA 2QM0A 4G8CA 6YASA 4AZ0A 3FAKA 5JAPA 1GXSA 4HS9A 1QIMA 5CH8A 1W52X 4X6YA 5HCUA 4K6HA 3WI7A 3A6ZA 1UKAA 2BUBA 2EEPA 3IULA 3ESDA 1NU8A 5EHNA 5LZ4A 5A71A 1Z68A 5F4ZA 3DQZA 1ETHA 1QJ4A 1XFDA 3DJYA 1IMJA 1QIGA 1UKCA 2YXPX 4ARAA 3AIMA 2ROQA 3WL6A 1Q83A 1YS2X 4J03A 3L1JA 5KWJA 5ALGA 4Q05A 3C8DA 4F21A 1FFCA 2RONA 3CCBA 3QBJA 1ZGCA 3GROA 1SC9A 3D0KA 4KRXA 2IITA 1QFMA 1R4ZA 3LIPA 4UHEA 2GBIA 5CRIA 2BGNA 1SFRA 4L9AA 5AKYA 1XLUA 5E4JA 3WK8A 1E66A 5ALQA 3FLBA 1WOMA 3G7NA 3H1AA 2HRRA 4DMHA 1YB7A 2HU7A 1CFJA 1R1DA 1XQWA 4E11A 2VJBA 1VLQA 2XUOA 1EK1A 3WKDA 5HF5A 3I2GA 5FLKA 1F6WA 1W6RA 1AGYA 2HFKA 3C43A 4G8DA 3H18A 1W4LA 3WL5A 2IIVA 4BCDA 2HL6A 5AKEA 1QO7A 4GXNA 4EHBA 1A8UA 3D2BA 4YASA 2XUHA 1VOTA 3IUQA 3W2TA 4B83A 5JANA 1FFAA 2JGLA 1HDEA 3WIBA 2ZYSA 3O9MA 5EI5A 1TCCA 1AC5A 3SK0A 4HRYA 5JZSA 4PO3X 1EDDA 2WJ4A 3PE6A 4X92A 1GKKA 2JGKA 1AMNA 4DIUA 2OGSA 2VEOA 5CXXA 5CT6A 4BCBA 2XQFA 5EHZA 3WK6A 2OCIA 1CUZA 3KD2A 2H7CA 5JARA 4RE5A 4DMKA 2YYSA 2PSEA 2DHDA 3BDIA 3I2HA 4G4GA 4J0DA 1EDBA 1CPYA 1K5PA 3F67A 5AKJA 4AXBA 4OU5A 1VXOA 4Y2SA 3G0CA 4UBLA 1QIHA 1CUXA 1ZJ4A 2C4HA 1Q84A 3ZLVA 5AK6A 1G5FA 1BEZA 5AI9A 1ZD4A 2AJCA 2WFLB 4OUKX 1DTEA 3IUNA 4Y9SA 3WK4A 4ZRDA 3I1YA 2ZSIA 3PUHA 4OPMA 5ALDA 4ARBA 1DQZA 4B85A 4J0IA 1OILA 1GQSA 1Y37A 2G5PA 2WJ3A 3O4IA 1C4XA 3RKSA 4C4ZA 4FTWA 4HRXA 5HF9A 5AO9A 5AK4A 4BATA 3ZLTA 1R9MA 2OPHA 4YPVA 4BP8A 2QUBA 2QXUA 1VZ2A 2ZYHA 3C70A 1K4YA 2CMFA 3QYJA 5KWIA 1WHSA 3N0TA 4N5HX 4DTCA 1VXRA 2O2IA 1JJFA 2DQYA 3PDCA 4CIAA 4X7BA 5FKJA 3QZUA 4AB1A 2VF2A 3FBWA 2QVBA 1CUWA 2XMGA 4BDSA 4BVJA 4LIPD 2WIDA 1XZBA 2VQ6A 1XZEA 3U0VA 4X94A 1DT5A 1TRHA 1QO9A 2J3DA 5BOVA 1C7IA 1QIFA 1VKHA 3BDVA 2CZQA 2WG2A 3SWWA 4G4JA 5EHQA 1L7RA 3NUZA 4X6XA 2B20A 1J07A 1MNQA 4UUQA 5T4BA 1AURA 3PUIA 2B61A 4FFVA 1EVEA 1QGED 4TVKA 5IKXA 1HL7A 4UBIA 3L1IA 4DNOA 4DLNA 1CRLA 3HABA 1EINA 5HFNA 2VAXA 3IDAA 2WHPB 2ZJ7A 5I8PA 2HFJA 1UT6A 3H17A 3AJAA 3X3HA 1L7QA 3VISA 1TIBA 1GPLA 5CT4A 1FJ2A 5AIAA 2J3QA 3D7RA 2XMQA 1XRPA 4DNQA 2D0DA 3FLAA 3F8SA 2HIHA 1KU6A 1U4NA 1E5TA 5ALXA 1A8SA 4BCCA 2YASA 5FV4A 2JEZA 4XWGA 1BE0A 2QUAA 5ISMA 1EHYA 1SCQA 1IZ8A 4WY8A 2C5FA 2PX6A 4INZA 2GBCA 1K63A 3DS8A 2Y1KA 1VJ5A 1LZLA 4FBLA 2WUEA 2XT0A 3WIOA 4H7KA 4G1FA 4FHZA 5ALLA 4X91A 1XRNA 4AMYA 1CUCA 1ACLA 3H04A 5AOBA 5ALOA 1PV1A 4OYYA 5H3HA 4WDRA 3T52A 3S2ZA 1BU8A 4JEIA 2HU8A 5AKHA 1F8UA 3DLTA 1JU4A 1BCRA 5JZBA 3WYDA 1CUJA 1J2EA 3S8YA 2XLCA 1L7AA 4MJ3A 2CEKA 2DR0A 4I19A 2QKYA 1ACJA 4MQMA 4H7FA 4OCZA 4AZ3A 4EZIA 3MUNA 2C5GA 2DSNA 3IA2A 1N5RA 3TRDA 4GECA 1XQVA 4GDMA 3IB3A 2QJRA 5JYCA 3R3ZA 3G0BA 2PU7A 2XE4A 4H18A 5HQ3B 2RI6A 5DNUA 3DDUA 1IVYA 1CEXA 2GYVA 4P92A 4LXHA 3EQ9A 5LZ8A 5LZ5A 1G66A 5FOQA 1EB8A 1ORWA 2VT6A 2LIPA 2XQKA 1H22A 1LPAB 3QITA 4LKOA 4KE6A 2RIPA 2OG1A 2V9ZA 5EGNA 1UK7A 1XKTA 2BGRA 5LZ9A 4DM7A 4KAAA 4FMPA 3HI4A 2NW6A 4KJXA 1CUUA 4CCYA 1MPXA 4E15A 3LIIA 1PFQA 2JF0A 3JW8A 4FDMA 4IH1A 4OB6A 1MX1A 4GBGA 5D6OA 2V96A 4H35A 2WJ6A 3BWXA 2JGEA 4MYSA 1XZJA 4UPDA 1H2ZA 5D7BA 2HA6A 1NU6A 4G9EA 1GGVA 4Y2JA 4CG3A 5A2GA 4QA9A 2X8BA 2E3JA 3PICA 3R3YA 4Y2UA 3WZLA 3I6ZA 1IUPA 3LCRA 4EY7A 5IH7A 3YASA 3EF3A 1E8MA 1EVQA 4JUIA 4XJVA 5T4FA 4BTVA 2XMBA 3PFBA 2AXEA 3V1LA 3D59A 3ESBA 4QWMA 3IUJA 5JADA 2O7RA 4M0MA 5EIEA 1FFBA 2ACKA 5C8ZA 1ISPA 1LBTA 3R40A 3F9CA 3I2KA 4H7IA 3QM1A 5EIAA 3WMRA 5CBKA 3C6XA 5CURA 2XUAA 3A2LA 4RNCA 3WJ1A 4MWSA 1YAJA 1AX9A 1ODTC 4EBBA 3UUEA 1JJIA 4J0KA 3WWEA 1QIKA 5JALA 4N8DA 3G02A 1OCEA 4AX4A 2XLBA 4ZV9A 1THTA 5FP0A 5E4TA 3F97A 3HLKA 3H2KA 1EK2A 3HACA 4DMFA 1FFDA 2R11A 3AILA 2Y2UA 4A16A 4U2CA 5D3KA 1Q0ZA 5CT8A 1QE3A 2RAUA 2XMZA 3VXKA 3V1KA 5ALPA 3H19A 3C5WP 5JIBA 3C6ZA 1F0PA 3AIKA 3WK5A 3GELA 2I3ZA 2OXEA 2O7VA 3E4DA 3GBSA 4FFWA 4P93A 4CG2A 1QZ3A 5YASA 4G9GA 2X5XA 5LLSA 5ALUA 3KWFA 3WZMA 2G4LA 4WFIA 1LZKA 4IH9A 4EY4A 2QS9A 1CUYA 4C88A 5DTJA 2JIDA 3BXPA 4U2EA 1XZDA 2PL5A 3H2HA 1GT6A 5ALHA 2XI4A 7YASA 1DX4A 4ROTA 1EH5A 1I6WA 1XROA 1LPSA 3I2IA 3FYUB 3TGLA 4DNFA 4J7AA 1QFSA 1LPNA 1B41A 1XZAA 4Y2PA 5ALIA 2P8SA 4BE4A 4Y2XA 5CXUA 5AIBA 1XZHA 3SX4A 3DYVA 4X85A 4H7EA 1XKLA 2ZVDA 1R88A 3HXKA 4Q3LA 4Q3OA 3CXUA 5ALTA 2QJWA 3JYHA 4X90A 1X70A 3KWJA 2JGJA 3WKBA 3HRHA 4WJLA 2HA5A 1GKLA 4FBMA 1LPMA 4MEBA 4LXIA 5C7YA 3H2IA 3STYA 3D3NA 4C89A 5JZ9A 2ORYA 2OCLA 3HEAA 2QTBA 4GI1A 3ZV7A 3STVA 3H2GA 4FWBA 4FLFA 4U2GA 3NWOA 3LP5A 4X97A 1E3QA 1OXMA 3PI6A 3FYUC 4W1RA 4TPKA 4N8EA 4Y2TA 4RGYA 3O4HA 4HXEB 4PSDA 4V2IA 3DEAA 1XZGA 3SC2A 4AO7A 5LYYA 5JD6A 4F5ZA 2HHAA 2XUJA 2I03A 2V98A 4PQEA 1CUSA 4CI9A 2XUQA 3D2AA 4TGLA 1WB5A 5SYNA 1J06A 4CCWA 4ZREA 1ZOIA 2O2HA 4OB8A 4NZZA 2QOEA 3R41A 3BE8A 1MX9A 1XZCA 5JATA 4W1SA 5HF8A 4CFSA 3FVTA 4W9RA 5JASA 2C0PA 5LP1A 4OYLA 3G9XA 4EY8A 4GLBA 1EB9A 3KDAA 2XQIA 3K2IA 5AK5A 1FSSA 3I28A 4LHEA 5D3ZA 5DLPA 1AQLA 5K3DA 1CUHA 4QDXA 4RE6A 1LLFA 4CIBA 3V1NA 4LYEA 1CUGA 2WIKA 4KACA 3FSGA 3IVMA 5ALMA 3FWHA 5K3FB 4O08A 3WWDA 1ZD3A 1BRTA 2RGUA 4W1QA 1UOPA 1IUOA 5ALSA 1ZICA 2XUKA 4J0CA 3WK7A 4BTLA 4DNPA 4QNNA 5ALEA 1VE6A 4RPCA 2XMSA 4DGQA 4UHHA 4QDOA 3JWEA 4KAFA 4EY5A 5FPPA 4X3CA 4L72A 1NX9A 3A2NA 3C6BA 5EIHA 4UBKA 4UHCA 3O4GA 3HZOA 3G9ZA 3QPCA 3FNBA 3O95A 2ONCA 4E46A 2DHEA 1MNAA 1MAHA 3ESCA 1KEZA 4X95A 3VKFA 4A23A 3C6YA 5C8XA 1A88A 5CTAA 4HXGA 1MX5A 4C4YA 3W04A 5AKGA 2QMQA 4IHAA 1BN7A 3BJRA 3EIOA 5AI5A 4BZZA 5ALNA 3NOXA 4H7DA 4B82A 5AI8A
chains in the Genus database with same CATH superfamily
4LNUA 1D3AA 3SXJA 1AM4D 1E1MA 1M67A 1NPYA 1U7OA 2ZAMA 3PR1A 2M9MA 3TAXA 5JD5A 2DUMA 2QR3A 4Y98A 3W9SA 3L8MA 2W2TA 3Q3IA 4RM3A 2NVUB 4FX2A 1KOJA 1HNXB 2FHPA 3F5MA 4AQDA 5JW6A 2N1MA 1Q1NA 3PHLA 4R8VA 1ST2A 4KXLA 4NH4A 1H66A 3DL2A 4BDTA 4XDHA 3OQPA 3UK2A 1MB0A 4BKMA 2IC5A 5I7AA 4KRYA 5G3YA 4KIUA 1TCVA 4QGBA 1KOFA 5FFNA 1PU2A 1ZCZA 4RA9B 4RIFA 3MM4A 1H9BA 3CJRA 3A05A 3I3OA 1JB1A 3VHRA 2SBTA 1TM4E 3I3SR 1VMKA 1WCIA 2OHGA 1I7QB 1X74A 2I6XA 2OORC 1C30A 4G89A 3UENA 2J30A 4XSHA 3UIEA 3WSWA 1J97A 1U5CA 1KR2A 3BSWA 3MCZA 1X1SA 1VHLA 3RVLA 2WNHA 8ABPA 3KSAC 4B3GA 1UIRA 5FEUA 2X58A 3JQ9C 1FFYA 3BA6A 2D5LA 4K9SA 4BKPA 4KPGA 2ZPAA 1GEEA 4NVRA 1XTBA 1KI8A 2Q9BA 2VSFA 4L4XA 3KKMA 3HY4A 3U4CA 4MV5A 3NVKI 4BGVA 4CT5A 3P9RA 3ILSA 4BWGA 3OJFA 1QDLB 1NPTO 2PKYX 3DB1A 4XH9B 1ONPA 3QBVA 4JZKA 2BGTA 4MVJM 1R0LA 1TVCA 2P9HA 3MOSA 3WA7A 1ULUA 2PM8A 1XEFA 1OASA 3DO6A 3HGTA 1JT2A 1LK7A 1WVGA 2R1VB 4AIIA 5JWOA 3P71T 4K87A 4C05A 5A1TA 4Z4EA 3A6PC 3TQFA 4LG1A 5C53B 1NMSA 3DEFA 2W37A 2HGSA 2Q0HA 4AZ0B 1EIZA 1AQJA 2EQ5A 4Q4DA 1ZFNA 3PS9A 1GXSB 4BPBA 4XD7D 3VPCA 1RACA 2C4NA 2FEWB 2G04A 4LTMA 1XTPA 4JN6B 3RRZA 4CUJA 1R4MB 1W1IA 4I1UA 1JQEA 1E3TA 3L8EA 5EVCA 4FX5A 4Y2QA 4DUPA 1HF3A 2RBGA 2DUJA 1E1CB 4DQKA 2WT4A 2WFAA 3DFUA 4JDUA 4BNXA 5DYGA 3BGDA 5KNDA 3CNOA 3IBYA 3L8CA 1COWA 2WMOB 1PEYA 2RH8A 1DIBA 1R0KA 1X7ZB 2CFIA 1KDPA 3GVPA 1GG9A 4EW2A 4KQKA 4Q34A 5KYWB 1SKUA 4BNIA 1CNEA 1N8NA 4HDRA 4WCVA 4XGNA 1CZUA 1U31A 1LS6A 5JCJA 5THXA 1DG9A 1TJ3A 4B46A 1KC3A 2W6NA 1APBA 3MF4A 4D3FA 4N5IX 4EPTA 2P5UA 2R1TA 2P3LA 3TR5A 3AVTA 3D1JA 3FYTA 2N0SA 1I7LA 3BX1A 4G5XA 3ZDEA 3ZZTA 2IXTA 4J0HA 3EPPA 7REQB 2JAXA 2NO5A 5AVUA 5BMVA 3QSYA 2VXCA 4OGLA 2X42A 1IOWA 4J3JA 4PAOA 2XCUA 4QDTA 4WCFB 3ZE9A 1DX6A 3FMIA 3HS3A 3PXCX 4X7PA 3C6MA 5CA1A 3M4ZA 3OJEA 3Q8WA 1W0KD 2EQBA 1SA0A 5IEJA 3KQMA 2ABWA 4TVBA 4JY7A 4JSYA 4GE0A 4OK5A 1E1QD 2P75A 3KV1A 3P2JA 2R5NA 3R7WA 1HQYE 4O0MA 4ZJPA 1EUYA 2L82A 4YBRA 3TNFA 2X77A 1L8OA 1XLVA 1L4FA 4U2FA 1MRSA 2HMAA 4TL7A 1JNXX 2JGIA 5HPYB 2NXNA 1MOPA 4BV9A 2I78A 1QK4A 5H4HA 3QQPA 3CM0A 1VHJA 3ZS8A 3L02A 4RLFA 1FDVA 2X0KA 5H0IA 3HK2A 3U0BA 5REQA 1D1QA 3PTAA 4P1ZA 4J43A 3B9QA 1FIUA 3T7SA 4YUWA 1XEAA 4HDNB 3ANTA 4OSOA 1PZEA 2O1XA 5K0FA 3DE5X 4OXKA 5AKZA 4D7AA 3AIIA 4H7JA 5TNXA 3M6XA 3OECA 2CLSA 4M9ZA 4HAUA 5BR1A 1YQ9A 1T8RA 1TLTA 1AB6A 2JEYA 1YB5A 1YQWA 2VSNA 3DMRA 3FPKA 2X6RA 4FEYA 2JI4A 1HPLA 5CGZA 3TI7A 4LQCA 5A4FS 5ED4A 2CV0A 1IOLA 4X0EA 1L7OA 2QUIA 3IVAA 3G2HA 2C4TA 5T4EA 4G37A 3UXYA 2B0JA 4DC1A 3SF8A 2FUKA 4IFEA 4JA0A 3ZU5A 3L49A 4FJ0A 1GARA 4CIDA 1BX3A 2VHTA 2XDYA 3SDZA 2A9VA 2VVTA 1D4OA 3VPBA 3DQPA 4RKRA 2G9QA 2XKKA 4GX2A 1U3TA 1VB3A 4TTAA 8MHTA 3L77A 3L6CA 4HPWA 4EWLA 3VDXA 1QQ7A 1P9NA 5DCYA 1FLDA 3DMHA 3OX1A 4R8SA 3TXAA 2R4TA 3QVVA 2QTVA 4JB8A 5DCWA 2QZJA 2JGNA 4FS3A 4CGZA 1WSAA 1MW8X 2X9LA 3BRCA 4N3GA 4RXMA 1KWKA 3O7MA 4FFLA 4F84A 5E1BA 3DEYX 3UY4A 2JGAA 5B53A 2DLCX 2JLWA 3BIXA 3QELB 5T57A 4OI0A 3X1WA 1MAWA 4ROSA 4ZVQA 1HXHA 5ECGC 1FQWA 1X77A 1WKBA 3VSDA 1JVBA 2W9XA 4EVQA 3E2MA 3QP9A 1R18A 3HUFA 1ZD1A 2WU3A 1HDZA 1W9MA 4PXAA 4HG2A 3R0VA 4GKBA 5IG2A 3R7DA 3OZVA 5EWJA 1UK9A 3GMSA 1MENA 3D0OA 1F0YA 1KI6B 1M1YB 5B6JA 3PU6A 4OQEA 1JA0A 1ZIYA 5LBUA 4YJ2F 1Q17A 3WP0A 3VPSA 4OLAA 4GKKB 1DLIA 4A15A 4LZOA 1DKOA 2W4QA 2GZ1A 1P4JA 2YR0A 2VPXA 3P0JA 1CJBA 2ZYIA 2DECA 3QG5A 4LE0A 1QONA 4BQEA 2IEIA 1RAHA 2PSHA 1TPYA 2ZYWX 1TF5A 4JOQA 4TM8A 5BMOA 9ABPA 3GT0A 4RF2A 4CNQA 2FJUA 2XVZA 1T4BA 2A67A 2XWBF 3GRYA 4H60A 3KCNA 4RKWA 4B3CA 2HDWA 4GRIA 4H7PA 2G88A 5IMSA 2REQB 2ZDGA 2H65A 4I1VA 4EPRA 4JT8A 3TL6A 4F3TA 1EIWA 2BFEA 3W4IA 1E3WA 4KK3A 2NPOA 4QBKA 4QYSA 1MIHA 2JC3A 4BWFB 3L01A 4LF9B 1P0MA 1USVA 2AN1A 1LSSA 3K92A 4RHUA 5CHEA 3DW3X 5FRDA 4J29A 1T5IA 2V7QD 1BE6A 4MCJA 4UPVA 4BE9A 4HO1X 1GUAA 2QL7A 1CBUA 1FRNA 2PFKA 4FONA 2IELA 2IZ6A 2YOHA 3CKLA 5IN4A 1IL0A 2J7PA 3OUUA 3P2OA 4JP1A 1AUPA 1QO0A 2QVXX 2R86A 3E53A 4A2QA 4F11A 3ZGNA 2CMGA 1ZD2P 2OBNA 2P68A 1LX6A 1DV1A 1LSUA 3MWLA 3RBVA 3RYHA 3A70A 3LYAA 4MRAA 4TL6A 4U2BA 1J99A 1BKYA 4R9RA 1WDTA 4AFNA 5J40A 4JA2A 1EE1A 1NOKA 3EMVA 3H13A 4GYKA 3GMIA 4DYHA 3O8OB 5K0LA 3UAGA 3W7AA 4UTNA 2GDZA 3RLFA 1CV2A 2QV7A 3KX2A 4IIEA 4BYGA 2XX3A 2IOFA 4Y2RA 3V4SA 4WFKA 4L0CA 4U7GA 4Z5XA 1HE8B 3CYFA 2FR0A 1G4HA 1GTSA 4F0JA 3CEJA 4YDSA 5SZIA 2R8YA 1E64A 4QOJA 1UQRA 3ODGA 3UBTA 5FWYB 4HAWA 3MWDA 1NJ5A 3QXHA 4UQOA 2UUCB 3BGIA 1V16B 5DM0A 3PV0A 2Y1DA 4LHZA 3AEZA 3BMOA 3HKCB 2J4FA 3T0GA 3H65A 4YXWD 2VUSA 3E5RA 4POAA 1SUCA 4DV3B 1MN6A 4UOQA 1RWBA 1T0IA 4MR7B 1XGKA 1LTQA 2CL5A 1GN9A 4HDKA 2PUJA 5L95A 1E1NA 2OEPA 4JCOA 4DC9A 4B75A 5TMEA 1DCTA 5TT0A 5IAGA 3RSZA 2QBYB 2VSYA 3HP7A 2FRVA 4BN0A 4KIWA 1HY3A 2X7HA 1DXQA 3H2SA 3LCCA 2XY4A 2QRUA 4Z1MD 5BPHA 4HNQA 3R5JA 2XYHA 2VYND 4TV8B 3PLAE 4GL2A 3LD9A 2DFTA 3ANNA 2JCGA 4L50A 4R3WA 2Y1LA 2WWFA 1OPRA 1KK0A 2UZIR 2YXBA 1V9CA 3HBFA 4KIGA 4NV0A 1PL6A 1KO5A 4Q3BA 3RVJA 5IAEA 4IUCS 521PA 1GQ2A 4DIBA 3GT3A 1I0IA 1IBRA 4GBMA 3V46A 4U00A 2Z4TA 3JWHA 4X93A 3A06A 3W3AD 5H9WA 4TZ0A 4DABA 4O2RA 1K86A 1JIVA 5CM8B 4P3KA 2W7TA 4B7CA 4CTKA 5MGNA 3PZRA 2N1BA 4QELA 3T3EA 1VHTA 3GAFA 3OG9A 1W87A 4Z8YA 1RM3A 3I39X 3TZEA 5A0TA 3U5ZB 2QYHA 4Q6BA 1L6IA 1W581 2QRHA 1QYVA 1OIVA 1RNLA 2JAUA 3Q2KA 3H5IA 3MB8A 3QXCA 3K8YA 1WPRA 4G8JA 4IV8A 1U3GA 4QXAA 3A9UA 2Q5IA 4RK6A 4CHGA 5J58A 3PGVA 2PCJA 2HMVA 3F4BA 4UUAA 5B37A 4C2BA 5JPDA 3GLIA 4LJKA 3QTTA 2JL1A 4BEVA 3UKOA 4DTIA 1QK3A 1DQRA 1BH2A 4M8SA 4EA6A 2XB8A 4Q1DA 1JN0A 4RFVA 5FTWA 3CLRC 3CV3A 5DN6D 4NBLA 2RHBA 2D1TA 3CUUA 1ZNZA 2FEAA 3DEJA 4GGMX 2H7XA 4ZYUA 5CEEA 4HTAA 1BJRE 4DEVA 1XV5A 2QY6A 4G5QA 1OXKB 2QTAA 5FOWA 4IINA 1SCUA 1X19A 4CN9A 3TFOA 3AERA 2QDKA 3WQQA 1XZPA 3LF1A 1M9NA 1RWVA 4IDDA 2RHCA 4URUR 1S9DA 3CCFA 1GZSA 4FSHA 4W8HA 4DDWA 1RLOA 3SEQA 1ICIA 3EE6A 4NCHA 5L9AA 2OCBA 1GNLA 2RC5A 4R8KA 2NXCA 5CDFE 2QW8A 4LN1A 1Z7WA 2ODWA 3ORRA 3VPAA 1HLGA 3JRNA 4LRUA 2DT5A 3VV3A 4I4TA 1NUAA 1UH5A 1DIGA 1K89A 4RFSB 3HB1A 1SCKA 2IY9A 2BV3A 1F2TB 3HYSA 2WKQA 5DLQC 1JHUA 4HPXB 5AXAA 4DR7B 3CKKA 4QLOA 3A0RB 3W7VA 5HR5A 1E5DA 5IVHA 5FADA 5A6VA 1LQTA 3CZ4A 3I6MA 4IDFA 2FZ5A 1HFKA 2ZEJA 3A14A 3TK1A 3OO0A 1MAVA 3AVQA 3JQBC 4RETA 2YXLA 2HLNA 5CVUA 4JI6B 1NRJB 3R0QA 4I1OA 1ZD5A 2FPOA 4LECA 4TT3A 3JTEA 3RROA 2ZB2A 3BF7A 2EKZA 2BISA 2Z3WA 3TW8A 4AJOA 5KCZA 2X2FA 2DP4E 1BX0A 1SIUA 5BT9A 3G3EA 4DSUA 1RJDA 4C4SA 4EUFA 3BTOA 4EJSB 2PWZA 3QGMA 2B1GA 2VBIA 1AV7A 1P0IA 2R6AA 3O82A 3UAYA 2A2ZA 3KFXA 3WBFA 1M72A 2RC6A 1VSBA 3CO5A 4GZ5A 4MKGA 4XW2A 5IVKA 2HWYA 3DZIA 1KI1A 2ZSDA 3HDJA 1OUMA 1UPUA 3PP8A 2NAPA 3TJZA 2JPDA 4D9IA 3DP9A 4ZODA 1JG1A 2I29A 3KR0A 1V1RB 2HEIA 2IEYA 3ZWXA 3QH4A 3R0XA 4D5GA 3PFHA 4PSCA 3OZXA 1CR6A 1L8LA 2LDBA 1NM5C 1HL3A 3KEQA 4RAQA 1RI1A 3P9YA 3IERA 5DXFA 3KHTA 3TCKA 4NOMA 2GZ3A 3DBIA 4DR1B 4DLTA 2FPIB 5DNVA 3OC0A 5F52A 2ZE8A 1KU0A 2XRFA 4MW7A 3CFYA 4RPIA 2ZS7A 3IEKA 3IV9A 3PGXA 4UBNA 4AY5A 4O4JF 1BA2A 3HE3A 2AFHA 1GTMA 5A7GA 4FGUA 4COOA 3D8BA 4TX1A 5C3MA 3ADCA 1L5WA 4IQ4A 2WFZA 1OXTA 2DFKB 4RKEA 4RIEA 4O4JB 4XE5A 2VUHB 3KS9A 2GPWA 2V55B 2VT2A 4BNDB 2LKCA 4FKZA 5J3JA 4FYMA 4PY2A 1AZSC 3N86A 1Y8QA 3NTUA 4FLMA 4PLPA 1ORVA 2HLPA 2YY7A 2EZ9A 1RC1A 1YZFA 5IKPA 4CTJA 1BN6A 2YYAA 4P34A 1E1YA 4RCYA 2B8WA 1SD1A 1BROA 1BMTA 1VCIA 1Z25A 1XC7A 2I2BA 2ZANA 1E3SA 2ATIA 3M89A 4KE9A 4KEAA 4WWHA 4ZI5A 5TF0A 4GX1A 2Q0XA 3R3UA 1Y3BE 1YS1X 1CNMA 2IFTA 2QRPA 2VWPA 3AR4A 3DZDA 3L6EA 3LFUA 4LNHA 1AUOA 1BW9B 4YEDA 3UW1A 5B2ZA 2ZUUA 2OBYA 3ZI0A 1VCMA 4D0GA 1LS1A 1Z8HA 2R6R1 4A91A 1RI5A 1WCIB 3L6BA 3OLZA 2MOKA 1M83A 4B3RB 1ZJ5A 5D00A 1HKHA 1FUEA 1MT0A 4MULA 2J0EA 5ECDA 2GHTA 1Z2PX 2Q45A 4IIJF 4ZYYA 5B2EA 1V96A 3M4NA 1U8EA 2BFPA 3OSZA 4DSNA 4IIJB 4IMPA 2QZPA 3LVFO 1AE1A 1IN7A 1GQYA 1OE0A 2H6EA 1XD9A 2EZ4A 1J20A 1XR3A 4ND6A 3L06A 4ZOCA 2IH5A 1IG0A 5KNDD 3QPAA 4XRRA 1UOQA 1J1IA 2B35A 4XCVA 5B5SA 5IXJA 1COWD 2QEQA 2I2CA 2UYOA 2PV7A 1EHCA 1EK0A 2FR8A 2QQ5A 1FSZA 2ES4A 4FT4A 1KJNA 3A4IA 3FGNA 4UHFA 3W06A 4A8HA 3IURA 4FDUA 4BVFA 3DLBA 2H54A 1GZDA 2XDWA 1RRGA 1N6OA 4NS4A 5JCJD 2PY6A 5HK9A 3V4VB 1HTWA 4R41A 3E18A 3UH1A 2Q3HA 3QPWA 1KVRA 2P67A 2XNJA 3WRXC 1YFZA 2N46A 5E6SA 2FMHA 3PF9A 3VAZA 3GIDA 2EWVA 2MT9A 5F3RA 1PFKA 2ZUDA 3QPVA 5EG5A 4DMCA 1C3OB 1BYIA 2GRUA 3GGCA 1JALA 3VJMA 4DPMA 3EN0A 2FE1A 4UMDA 4OXRA 1XEWX 1HYQA 3P0EA 1JLLB 2IP2A 2ZG6A 5BN4B 2J9GA 2QLMA 3FKQA 3UEOA 4AZ3B 3PGMA 2YWCA 3TAUA 2XT6A 3EUFA 3QVMA 1FZTA 1VGRA 2QROA 4OHWA 5DBHX 1A5AB 3G8BA 5DASA 1TQ6A 2Z6UA 2R6FA 3AM5A 3C8UA 3F5QA 4FLEA 4DG5A 3KFVA 3WQSB 1PW7A 1XRLA 2NAFA 3HP1A 3WGGA 4HDRB 4L8WB 3MXTA 2UUPA 4G4IA 4BV2A 1SUIA 1SOAA 4BYMA 2PS1A 1T13A 5FYDA 4B8ZA 4ENUA 2OM6A 3T95A 4C4AA 4EGQA 3RW9A 1CS4C 4BGIA 1CJTC 1LDNA 1XMVA 2YIJA 1RLUA 1ZGZA 4UFOA 2WTBA 1XMQB 4ENQA 2PRZA 3D4NA 4KX5A 3O3CA 1Q2XA 1SNYA 1WR8A 4ZAFA 1USKA 1A50B 4PQYA 1N7HA 1NC3A 3MQ2A 1T1RA 2VZEA 4FN4A 1Y3HA 5F9MA 5I5EA 1ML4A 4BX0A 3SMQA 2XB4A 2Z30A 4UVHA 4B43A 4CMIB 1ZM3A 4PAQA 5AM0A 4AF7A 1P7YA 2PVSA 3RJ5A 3MCWA 3GJQA 4MQEA 3WGUA 3M4JA 4L0MA 2GCOA 2JD1A 3KD3A 4LBWA 4WI1A 5FA5A 2CXXA 4C29A 3BVPA 4C7JA 3VYTB 4EUHA 2GAIA 4ZJYA 1DPFA 4PLYA 3TZ6A 1NM5A 2ID4A 2JD0A 3S2SA 3EVZA 3PQ2A 3MERA 4GXTA 4TYWA 2FGKA 1TVEA 3HB0A 1WW2A 4LZAA 4UNQA 1MQ9A 2Z5GA 2E48A 5ESXA 3VHQA 4DHWA 2I76A 1U2QA 4MIOA 5C7LO 3ROMA 3FUUA 5JJIA 5LFAA 1V8OA 4KQ9A 1VI2A 2IUTA 1HBJA 4UASA 1CY8A 2BBTA 3ZTYA 2CV1A 2ATEA 2FRDC 3F7TA 1PS9A 1O6GA 2X8JB 4LBZA 4Y9DA 4KFUA 1E9BA 4ZC8A 3MOGA 2OYCA 3WJAA 5C8DA 5I7UA 1ZKDA 2CE7A 2I99A 3CGWA 3E3LA 2P3QA 1PJ8A 4MV8A 1JA9A 1KFKB 2WLSA 5DXJA 2HMUA 4HXYA 5AQEA 2ZJ1A 2G67A 2CEAA 4MS3A 1B15A 5CG1A 2BDTA 3GG2A 3EDOA 1IEXA 3OZWA 4C04A 3L84A 2P9CA 5EJGA 3N2NA 5SV2A 4GD3Q 1QYDA 1SEVA 1Z7YA 1PK9A 4ZCQA 1XCJA 1RYMA 3IDSA 4QDUA 3KZCA 2CCJA 2FPGA 3BBLA 5L8VA 3N2ZB 4G0MA 4HD8A 4CFYA 2Q3CA 3L5KA 4DC0A 2YVKA 1PT7A 1UPCA 2CJFA 2BY4A 4FYKA 1OLSB 1ZJJA 2G80A 3OPQA 4L8LA 4PQFA 4YCDA 3ZKWB 4H3HB 2GSWA 2ZQZA 1VA5A 4YO8A 4NICA 4W9NC 1GIAA 5DXAA 3EQ2A 3WC4A 3FTDA 1FP1D 1I10A 4A4DA 4P9NA 4B8WA 1FNDA 2JBHA 4BMDA 1WULS 2JAHA 2XZOA 4OQQA 5KVQA 5IFKA 3R5FA 1IIBA 2C9ZA 1QP0A 1EUCB 2VDVE 2VUTA 1YR6A 4P8RA 2IWHA 1GRQA 5JAOA 1M34A 3LKVA 3DHYA 4WH0A 1I94B 1T4GA 2O8DB 3JD3A 4J4BA 4KUGA 3GLKA 1C8VB 1VSUA 1QTRA 3EGIA 2ILVA 4QYWA 1A9XA 5B3KA 4YQYA 3ZI7A 3GRPA 4J4TA 4EQZA 1UJ4A 1X7YB 3BKWA 3DE6X 2EFHB 3BD9A 1WXDA 3Q5GA 1HEIA 2TMGA 3EXIA 4ES6A 4BVKA 2J7PD 5LQDA 1Z33A 5T7BA 1NATA 1QO0D 4QM7A 1JZQA 2WJIA 3IUEA 1LJLA 4OREX 1N8SA 3T5BA 4YV7A 3BWMA 2FWRA 5KOHB 2BZSA 2OBLA 4GM4A 5MFPA 3T15A 2UKDA 4D3SA 2IHKA 2W2NA 5KSWB 3AM1A 3UK7A 3NHRA 5LQCA 5G0VA 4H3KB 3WRXA 2OCAA 4DADA 2OENG 3KQPA 4KO4S 4BN4A 3ED1A 3ABOB 3TOZA 1Y7PA 3F5SA 3SXPA 4OBWA 2V9PA 3THYB 1IXKA 2VTBB 4XTCS 3WFJA 3Q87B 2CVQA 3LLMA 3OIWA 2NIPA 3DMNA 4HNGA 1WETA 1OWLA 3I09A 2BMAA 4LCBA 1T8WA 2EC5A 4QFMA 1S3GA 1CUAA 2GUGA 3IPCA 3OCCA 3TCNA 3AHCA 4CEJA 2WF9A 4YRQA 4KN5A 4R8RA 4LBYA 5AVVA 1DWUA 1D03A 3GY0A 1QP7A 3ONVA 1NBMA 3AV3A 3GVCA 4Y18A 3Q15C 2UUAB 3JQGA 9GPBA 2JHPA 4ND8A 5TRTA 3G9UA 1BRMA 1OFVA 3C45A 5AKIA 4BVAA 3GJSA 3WLRA 5FAKA 2ZU6A 4ALIA 5L7WA 2JKZA 4B6FA 1HWYA 1NHWA 3MFYA 2JLSA 1RE0A 4BU1A 3SF0A 1DWPA 3Q40A 3QMMA 1B0UA 1U9IA 1YUNA 3ITEA 1SIWA 2BFCA 1KZ6A 3UT5B 5A4JA 6REQB 2D74A 2PLFA 1LV7A 4A2WA 2XGJA 2J5BA 3L0SA 1XNRB 3KVYA 4CKCA 2JFGA 1YA8A 2F90A 3PE3A 4ML3A 4R98A 3HVIA 3A1EA 3UUWA 5HJ2A 4AY3A 3HADA 3AJEA 3EOZA 2H4XA 1XHFA 2NYVA 4JC0A 2EKLA 2DX7A 3BF8A 4IQGA 2ZAGA 1NE2A 2FUEA 5D1HA 2PO7A 1C7JA 3HB5X 3OLCX 2I80A 2A8YA 2ZR0A 1LLQA 2Q3DA 1TYBE 4NE9A 1RPTA 1ZM9A 3ZWPA 1RRCA 2C82A 3F6CA 3HJUA 3BWDD 4DMLA 2VJAA 1VJGA 3AF6A 3NRJA 4BLRA 1YR3A 4I4CA 3ZHOA 3EIHA 5LCXA 4NZOA 5BOSA 4V1CB 5LYJF 3I1IA 3M3PA 2RJ3A 3CVUA 1ORDA 4LDQA 4NENB 3RBXA 4I1PA 2ANBA 4JX9A 3K5WA 3NYWA 4MW6A 5LYJB 1W94A 3ZV6A 1PFVA 3OCVA 1G1AA 1UBRS 3AUAA 5CX1B 1XXHB 1NTRA 4CDNA 3DAGA 4DQLA 2VDQB 1BVHA 2HUNA 2J87A 2I4IA 3NOOA 2ZWAA 3F6BX 4LYYA 1VG0B 5AI6A 2EDCA 3ND7A 4Z9XA 3G2KA 2P5SA 1JXQA 2E85A 3GRCA 3KZVA 1RKVA 5AHXA 1HETA 1M2FA 3IT2A 1VYHA 3GZNB 1H5UA 5CR9A 1P3DA 2XE6A 4V0QA 2FRDA 5KMGB 5KAPA 1DC5A 4LVNA 5EIBD 1MJFA 4PLCA 4YP5A 5IVDA 3VVCA 1S02A 4YMUA 5KOJA 1YRYE 4N1AA 5B4TA 4JI8B 4DCGA 1H3EA 3JU3A 1XRJA 5KHAA 1YIOA 5K0JA 1XMOB 1X2BA 1TAUA 1HRKA 3V7WA 5HOEA 1SGWA 3NTVA 3W05A 1SXPA 1UDAA 3C41J 4BC0A 4CETA 2PZBA 3PDJA 4WLNA 4OQXA 4OH1A 3BH6A 1D6MA 3SXUA 4EEXA 4YV1A 4ZCMA 1H05A 4O59O 2ZFUA 5JU6A 5KSZA 3G1TA 5BNIA 4K8RB 2NO7A 5DSXA 5ITZA 4H0CA 3ZGVA 4E5SA 3MJFA 1H65A 1PUJA 1U8ZA 2CMDA 3AGQA 2IYVA 1HORA 1BWRA 1Z5OA 2YRXA 3KQQA 4UMVA 5DNWA 4DV5B 3NJRA 3OZRA 4PVCA 1B73A 2QN6A 4IPTA 3X43A 1GV1A 3OURA 3UFXB 5DW0A 2Q29A 3ZD8A 5BSKA 4X20B 1OYVA 5L53A 2WWXA 3A1UA 2WIJA 2YJGA 2PX0A 3I5MA 4W9NA 2VT7A 2I1LA 4Q4LA 5CDFA 3I04A 1N7IA 2R2GA 3DKIA 2EGHA 4MDHA 4YGYA 4ATNA 1Y7LA 3K0FB 1ZHOA 4DA9A 3S68A 2X3UA 1F12A 1TU0A 3AERB 4FKMA 1ENZA 1ID1A 4TT3D 2WTEA 3BMCA 3P27A 1CZHA 1K6XA 1QZXA 2PQ2A 5EMKA 3HXOA 2ZI3A 1LPBB 1AZLA 4I4TF 1EGVB 5JI3E 4US1R 1UJBA 3KLOA 5JT1A 3COSA 2G9NA 5JSFA 3R2JA 1AQNA 2VRNA 4HVAA 1JHXA 3ZLJA 3BS4A 1W9HA 2YVQA 3OCJA 2MTBA 4WECA 5AT1A 5EP3A 1JMYA 2N42A 3I34X 3IBTA 1OV4A 3Q7QA 1HE4A 5DB4A 3ROPA 1QQBA 5K45A 2F17A 3NM4A 4QNRA 1C4KA 4CM4A 1FEZA 1MC4A 1ECBA 5AK0A 4CU2A 1LI5A 1PR5A 2AJ8A 2E2WA 3ZNPA 4QUAA 3ICVA 4HX9A 1AA6A 2W6QA 2H2AA 4Z9FA 1DWOA 3I2JA 3TW8B 2FPPB 2QT9A 3WWOA 5TE9A 3ZU3A 2LV8A 3PNSA 4JLKA 4JQYA 4WE3A 2XB2A 3O8RA 4X64B 2I91A 2FVXA 1Q1ZA 5TGTA 1CR0A 4PHCA 4RSMA 3GGGA 3JQAD 4JUFA 1SPXA 1P6UA 5E7IA 1DJOA 1U0RA 4KXYA 3A9VA 1UEIA 5IVIA 2HYDA 3DPSA 3EQZA 1ZBQA 2Q41A 1MVOA 4LZNA 1ACMA 3G7SA 1N57A 3DFMA 1O6BA 2FEKA 2I3GA 5C81A 2GCGA 1L4UA 1TCBA 3C7DB 3FMGA 3QVKA 4MDFA 3VKVA 1WWKA 4C0JA 3D7LA 2XQGA 4MWGA 1JHZA 4HB0A 2CJPA 4Q1BA 2WVGA 3INTA 1QR2A 5IJ0B 1FC0A 2RAFA 4I4IA 2VG8A 1QU3A 4HWTA 4AAYA 1B76A 3K1JA 3ABQB 2C42A 3U56A 1J8VA 1BEEA 1P33A 4R2XA 3UUFA 5DLEA 4Z3KA 5K3CA 4J2TA 1OH8A 1UBMS 2Q1YA 3I12A 2V6JA 2C99A 3I9MA 4P3NA 2QLBA 5FTNA 2XDAA 1P39A 2OMEA 4DPLA 1ZITA 3RUAA 1VBNA 5EHXA 1LF0A 1USWA 2X0FA 4DBLE 5E8JA 2UDPA 2J31A 1W75A 4M1WA 1VECA 3USCS 1IUKA 1QSGA 2OLKA 1BWPA 1DS6A 4EUSA 5BSEA 3KETA 4MCHA 1E9EA 1CY7A 4LJ4A 1RZRA 2PGDA 2N3ZA 1KBQA 1WPXA 1YRAA 3W6UA 2X4DA 3B85A 4JL6A 3HR8A 5I01A 2OR3A 3L4SO 3KPWA 4PAMA 4BFTA 1FP7A 3ZDZB 1MX3A 5LL6P 1P2TA 3HUTA 5ELLA 2OZVA 3HDQA 4R3UC 4D4GA 3SICE 4EO9A 5B7PA 4KR3A 4R2MA 1QV6A 1C7QA 2FCRA 1TQ4A 1E1KA 2RFLA 4E12A 3VFDA 1VBKA 1WLSA 4RVDA 4AJ2A 2X0RA 2BFOA 2QV0A 4FE3A 1JHQA 1ZMRA 2EU8A 3CNHA 3T7DA 5ABPA 1E2MA 1JYEA 4XDZA 1GPAA 3T41A 1Z4NA 2ZBVA 3CLRD 3LM8A 4UXJA 2BUCA 3KSMA 4MW9A 3SC2B 1QB7A 2B2XA 2BF7A 1DBPA 2PKWA 4JJ6A 3WADA 4G5FA 4IKEA 2HPHA 3NFRA 4BO4A 2BM1A 4KTVE 4AJEA 2P62A 2PZKA 5DM2A 1NE7A 4ENSA 1B43A 2TS1A 2C94A 2VATA 1RVV1 2OAQ1 4INJA 2EARA 3RS2A 2XADA 4NCNA 5BUQA 2HXGA 4ESHA 1E20A 1AIPA 2CB0A 2G36A 2CGEA 1A69A 1PD0A 1V48A 2PDAA 1UKVY 2YWBA 3FLEA 2WSYB 1UFOA 3Q3VA 4QSMA 4JEHA 1MJNA 1M6YA 3TZBA 1ZI8A 1E7QA 3VGPA 2HQBA 5EE9A 1QTIA 3K70B 1F1JA 4PANA 3H4IA 1WA5A 4HZGA 4ZEWA 1SUSA 5DT2A 3SZGA 4DIFA 1TCAA 1NW5A 2WVJA 4UBOA 1G18A 3BWVA 2ONKA 3H1PA 2VP6A 3GFFA 1BHSA 3WVNA 2BGJA 4YWJA 1MTZA 1EP2B 2EDAA 3CH6A 1Z82A 3MEQA 3SR0A 2YOGA 4G0ZA 2NP7A 1T4MA 3A1SA 1ZO8A 3AR3A 5JJBA 2BR5A 2BLLA 2FZ4A 2PT7A 4B4VA 4ISCA 2XGSA 2QM0A 4G8CA 1AGXA 3B6JA 4XUDA 1HX7A 1BDBA 4QARA 4ZK6A 2QLJA 2X7JA 3VNAA 4HS9A 3K20A 2BM9A 4ZHSA 1QG6A 2ORWA 1BSVA 1C50A 1FF9A 4R2WA 1GLVA 1O77A 4YUAA 3ADPA 1YR1A 3N8GA 4QJIA 2WDZA 4E2YA 3N3BC 3RNOA 3G23A 2IE0A 3ESDA 1H6AA 3NX4A 4TS1A 3FCCA 3HCDA 1LX7A 1JE1A 2QN9A 5DGCA 2NP6A 1PL7A 1AD2A 3RUDA 3P0IA 1T10A 2O3UA 4LPSA 1JEQB 1A9YA 4AKIA 2CVOA 3QKWA 4ZVTA 2C3OA 4LQLA 1IEQA 4KQCA 1JKFA 1D2GA 1MIOB 4MJLA 2BEUB 2VDOB 3S81A 4W6ZA 1QIGA 1UKCA 2JLAA 2IU3A 1L5FA 4AYTA 2H06A 1AGRA 5EKTA 3RBAA 4DWVA 3RCBA 1P1CA 4JX8A 3PPXA 1DBQA 2QAGB 1TJ4A 2ZRKA 4G0XA 4LJSA 3W79A 3TKYA 1PJ2A 2NO9A 2Y3IA 2AS0A 2W90A 2PBZA 3QBJA 1AVTA 3OUTA 3TSOA 1TUBB 4IIBA 3ZWDA 4A10A 4M9RA 4FM9A 3JQQA 5T8KA 2G5GX 2ENUA 4KRXA 1G63A 2PUVA 3JZAA 1QFMA 2GCOB 3LIPA 1BOOA 3KYBA 2JKYA 4NBUA 3RYFB 5EJIA 5CD9A 2Q8NA 2BGNA 2IHJA 4AG3A 1QGDA 3T1OA 4ALMA 2W98A 4CGYA 3HFGA 1JLKA 2RHOA 1J22A 3D7NA 4D42A 1CZLA 3GEPA 5E4JA 4ESOA 5KZMB 3ZXYA 4KZPA 3BILA 1E66A 4C0SA 2FOLA 1RM0A 3ZOZA 1WAMA 3AHGA 1EFRA 3GEDA 2CK3D 3NHWA 3Q88A 3A6HA 2W58A 5CVJA 3SCZA 2DQKA 1YR7A 2QE7A 4KLAA 4AMBA 4EABA 5K6RA 1P6QA 2GD6A 5J5AA 3JD0A 1QHGA 3L0OA 2HRRA 3L9XA 3NDJA 3NZEA 4DMHA 3Q7TA 4LYGA 4D9NA 1FDTA 1V5EA 3NJ4A 2EATA 1YB7A 2HU7A 1AKUA 1CFJA 1U8AA 1XQWA 2VJBA 5TEWA 1PR0A 1G9SA 1DRUA 1S2NA 5HF5A 3SQWA 1CW2B 2VUUA 1E58A 3JYPA 3M1YA 4KXXA 2AVDA 4AD8A 3NXSA 4JIGA 4ZVOA 1Z4LA 5CU7A 2DTDA 2CLEB 2ZZKA 3RO7A 3OEWA 5C34B 3VR1A 1O08A 4GOLD 4WGGA 2ZAIA 4HSGA 2HFKA 4BU0A 1OY1A 3C43A 4G8DA 4LBVA 4MUMA 1IIRA 2CDCA 3WL5A 5GIPE 3KAPA 1AN0A 5JRZA 2X2EA 1T4CA 3S44A 4HQFA 3F46A 1MG0A 3AI1A 2V59A 2VQFB 3C8ZA 3ABZA 3CRQA 3JYLA 4L51A 3GHHA 2Y1FA 4YASA 3RAEC 4TKMA 1NZJA 2HYIC 2H1OA 2DB3A 3TMYA 1E2PA 1CB0A 1MOQA 3IUQA 4IJVA 4WD3A 2AYXA 2P2NA 3MMZA 4DRXB 2H3HA 4ZU1X 5LOVF 3PLRA 3GJXC 3HR7A 3MCUA 2V7UA 3RNLA 4FWTA 2IBTA 2X1HA 3OFKA 5LOVB 4ZARA 3GUCA 1X7DA 4E22A 2QUKA 1U28A 4UJ5A 5MDHA 3QU5A 1CX9B 1JHMA 1LUAA 5HQTA 4MOWA 1GTL1 1G4AE 2GGSA 2PFGA 3KKZA 3LRXA 5CNMA 4D92A 3ZYCA 1ZVKA 3JQCA 2KW5A 4F4FA 3W5VA 4G1VA 5F5LA 3H75A 4PLZA 3PQDA 3H86A 4DANA 2P7IA 3ADBA 1YCFA 4ZYTA 3JASA 4RJJA 2AYYA 3L4BC 1ZJWA 3MJSA 1NBMD 5KYKA 1SURA 1XVLA 1Q11A 1YJ5A 3IB6A 2ZR9A 4QDKA 1XL1A 4PNEA 4XWYA 3UPUA 1UKEA 1DB3A 2WWTA 3B5IA 3I61A 2GXUA 4PIVA 3DBLA 1CF9A 4P31A 1F9EA 4PLWA 3U09A 3UWPA 1AUXA 3ZX5A 3B8HA 1L8QA 4HHEA 4LY0A 1M1UA 3U40A 3G2JA 4YBZA 5EUCA 2V7VA 2VEOA 2C9BA 5CXXA 4YUVA 2VNKA 3ZDRA 4M1ZA 1D0VA 2XQFA 3PD7A 4XUEA 1CIVA 3RSSA 1SHTX 1XEXB 1KI9A 4Q00A 1UBTS 5SZJA 3GRUA 4XYMA 3TQOA 1DXYA 3LUJA 5M04A 1IWOA 3PUYA 4YFYA 1KDOA 1TA4A 5KJEA 2AOUB 1KARA 4KO8A 4QSHA 1EYZA 1M74A 1DCKA 4JT4A 1ESMA 5E0OA 5BWMA 3DM9B 2XZTA 5DV9A 1RXVA 2OCIA 5TPWB 4M6WB 4EKYA 4DXAA 1OC2A 1JQJC 1UXHA 1YF3A 1Z0SA 1NULA 2UZ3A 2YWRA 4NSNA 4MQ6A 3VI3B 3PXXA 1OAOA 1GCOA 3AKZA 2RGGA 3OBBA 4DMKA 4Q4JA 4RF5A 3ZBUA 1QH1B 1SZJG 5JZ9A 1HNZB 4QVIA 4L22A 2DHDA 2WICA 3I5UA 4AP5A 4O0LA 2ARKA 5FBZA 2IUUA 1DDIA 2XIQA 1ZAKA 2JIMA 4MCAA 2R44A 1CYDA 4NHOA 2M6KA 3VX4A 4E2ZA 4RZUA 2BI4A 2AFVA 1O6CA 3TUJC 3WIEA 2I6UA 3T7TA 4CUKA 2VQ3A 1LBIA 4Z9AA 3TIFA 4KR9A 4DLBA 1C0IA 3A32A 5HXAA 1VXOA 2G72A 2AMLA 3H2BA 2XYRA 4Y2SA 3WMXA 2NZ2A 3H4VA 4QKQA 1QPGA 2H1VA 5LA6A 5FUQA 1ZJ4A 4QPJC 1Q84A 1C29B 2OYRA 3ZLVA 2H52A 2YY6A 1BEZA 3R0ZA 4TTRA 2JGDA 1QBKC 1FFHA 3ZDBA 4YI5A 3IUNA 1Z0JA 2CNLA 1P1IA 3AF4A 4ZRDA 2QPOA 1CEYA 1NXOA 3CA8A 2ZSIA 5KTYA 3WYBA 4E4RA 4ARBA 1RPNA 1WEKA 4LF5B 3M34A 1P1KA 3AJ9A 4L27A 1Z28A 3FJ1A 4G01B 4Y6OA 1MC5A 2UYGA 2NV0A 1TK9A 2WJ3A 1C4XA 3O83A 3QKTA 2C03A 4PCAA 2WZCA 3BEDA 2RBKA 3HU1A 4JJZA 2YXNA 2GS9A 5FPYA 5JO9A 3ZV3A 4YAIA 1AS2A 1ZMOA 3PJFA 1AHIA 3KTAB 4EA8A 5H68A 4ZANA 2B7CA 4CMAA 4U7FA 2ZIUB 3JR3A 4G6ZA 4MKZA 2ZIAA 4RWEA 2CZGA 1GRNA 1AGPA 1TC2A 5KNCH 3QNUA 4TYPA 5AR1A 5CFRA 3WFIA 5JTUA 1E92A 4OI1A 1RKUA 2BEJA 5AUNB 2OD2A 2UVPA 2WVAA 3E3NA 3M6VA 4GMGA 3VNBA 1CY0A 2XDQA 2ZJ3A 3IVCA 2D7DA 3TIXB 1VZ2A 3ISJA 2QNIA 4PFSA 2HQ1A 1G98A 3OPNA 2CMFA 3D6FA 5KWIA 1WHSA 5IDYA 3A37A 1F51E 2VOEA 2O2IA 5HM8A 1JJFA 3HKBB 1F3LA 3RVOA 2C4MA 2Q2NA 2H5LA 1U3VA 4NPCA 1P17A 4X7BA 2HXSA 3AY3A 3LWBA 4OFXA 2FWAA 1XMSA 2VJQA 4N7MA 1X7WA 5F9FA 1ZCBA 1H94A 1R6AA 1ZJZA 3FBWA 3LL4A 5I6DA 2Y71A 5H16A 1Y9DA 1XJ5A 2GCPA 3RK0A 1AB5A 1KJJA 4LIPD 2WIDA 1G5PA 3VR4A 2FV8A 2VUIB 4RVGA 4TLMB 1GADO 3U0VA 3Q9SA 4ZI3A 4NEGA 1K3UB 2PLAA 1VGQA 5COBA 3V4PB 1YS6A 2F1JA 4D9MA 3TBKA 5C5IA 1QIFA 1ODFA 1FOEB 3CHYA 4NYJQ 3WGZA 2R6GA 4NBNA 1NXQA 1PI3A 2FFBA 3H9CA 3U80A 2DU8A 1N0VC 4GMFA 2FGJA 3K31A 2AK3A 4H31A 3V9PA 1BCSB 4J49A 4DLVA 5HOQA 3SWWA 5ESWA 2RI0A 2ZETA 1PWEA 2IY7A 4IDBA 5FNVA 4G5OA 1MO5A 2A1IA 2BFAA 3IAAA 3JVVA 4JC5A 3C3AA 4TUYF 4S24A 2WW8A 4X1KB 2H2GA 5EHQA 1YJCA 3ZV5A 1KYQA 3L4BA 4CT0A 4YIHA 5JAZA 8AT1A 2V6BA 4L4ZA 1E63A 1J07A 1Q6YA 4TUYB 4XPIB 4U0KA 3ZBQA 4DM3A 3QFHA 3UGQA 1MNQA 1MUUA 3HNPA 3AVVA 3JD4A 4UUQA 3ILVA 3I42A 1D4AA 1G2PA 3JAWB 1WUKS 4QUHA 1T24A 4P4SA 1PFUA 1CHDA 1RI2A 1X14A 4QGGA 5FO0A 3HJRA 5IT9A 2A1TR 5B64A 4RVFA 2PGLA 4IV0A 3MBIA 5HZHA 3UJPA 3ZJVA 5AWFC 3R3JA 5L7TA 1JRLA 2B1RA 1RJ9B 1R0SA 1W46A 3SSOA 1H1DA 4W5RA 4C5CA 721PA 4QGSA 1CRLA 3W8EA 1RLMA 3QNMA 4PN7A 2JFUA 1RZRD 3MN1A 3MT0A 1PGPA 4G09A 5LZ4A 1AKTA 3GFOA 2JARA 1IJEA 4R1QA 1KP3A 4QBFA 4Y6GB 1RAAA 5TR9A 2WHPB 4ANFA 2IGTA 5HIAA 3PQCA 1NUQA 4E3ZA 3Q12A 1N2IA 4O2AA 2D2EA 4ZT7A 1ZS9A 2ZT7A 3QF4B 4K6OA 4ZPJA 1CU1A 1BVYF 1VJ1A 2NU6B 3DDZX 3R7AA 2H63A 3S70A 4EAAA 5JJCA 4PFJA 1Y80A 2J9XB 4RMJA 4CDRA 1JPUA 1WZUA 1YJQA 3G8CA 4RV5A 5HIJA 4B2IA 3HMQA 3CQ9A 4YP1A 1GPLA 1AKWA 2GJSA 1EFTA 4LWQA 1YFLA 3K53A 1Q0QA 2E37A 1S01A 4IOJA 3WGVA 1HSOA 1U8XX 1J2UA 1E0DA 3L7YA 1BWSA 1XD2A 2Q3LA 1UZLA 3ZD6A 2D0DA 4WBNA 3AFMA 2F64A 5GM1A 2ZYVX 4Z53A 3INYA 1W93A 1CJUC 1V9LA 2E82A 1U63A 4TYQA 5ALXA 2B3TA 3NXKA 3UM9A 4RTKA 2F6RA 5TJHA 3MWKA 3T5CA 1RXSA 1U0LA 4I99A 1A8SA 3C4VA 1X9GA 4LGCA 2XD4A 4CDMA 3MYYA 3UAVA 4I1IA 3W6PA 4BCCA 2ONJA 4QD3A 4FUTA 3UYKA 1RLTA 1ZNYA 1C1DA 2H4HA 3EY4A 2YASA 1KAOA 4NPAA 4EYOA 1ZEMA 3T1YB 3N6RA 4B34A 1P3JA 1K4KA 1SVIA 2BFWA 3KDPA 4J91A 4KQ6A 2QUAA 4MVJA 4TKZA 3TD2A 3NONA 4MP3A 1XTJA 1UPTA 1GU1A 1QVVA 2BHRA 4QNMA 2PX6A 4INZA 4JJGA 3RPEA 1LLCA 2WSBA 1HZZC 1BHQ1 4QPPA 2R7AA 3I01A 1GYPA 3AHIA 5B36A 2WYUA 2X0IA 3QIVA 1P2SA 1Y1TA 4FBLA 4LDJA 2QTWB 3NC1C 3AYXB 1WKCA 3KJEA 3AUUA 1OGJA 2AI3A 4J94A 4G1FA 3FVVA 4P7BA 4FHZA 4HMPA 1C3XA 4DCNA 3R44A 4ZIRA 5CD1A 3G49A 4KPEC 1D2HA 1PKXA 4X91A 3LBYA 1XRNA 3D43A 3HGMA 1UWKA 1YE3A 2NADA 2VKTA 4GVLA 3ZVKA 4WFQA 4IX1A 2YJ4A 5BSVA 2GF9A 1STOA 2LR0A 2P78A 3OPYI 1HDYA 2WHXA 2QRZA 2Q9AA 5IUKC 4D79A 2AIRA 4HFNA 3IKVA 4CKEB 1VIYA 3ZZMA 2YQ4A 4F3KA 2XE8A 4PZCA 1ULTA 2NN3C 4X41A 2Q6TA 1X8XA 3ZVNA 4FHGA 2Q49A 1WNFA 4P7KA 4MA0A 5TEVA 4F93B 1LY1A 3UJAA 5HIKA 3LBIA 3JARB 4HYYA 3FOFC 5A0FA 5DM4A 5CCDA 5KDLA 3W9YA 4RMIA 4D2IA 4LHVA 4CR6A 1AU9A 2GQ0A 4LY3A 2WWWA 1JU4A 3T9EA 2B82A 2ZWIA 5KYYA 3NC0C 4H6PA 4DZTA 5JR3A 4DQUA 3S8YA 1L7AA 3C5CA 3DBRA 6ABPA 4Z3OA 4A92A 1U9ZA 1DLJA 1W5AA 3G1WA 2DR0A 4S2EA 1VCHA 3VH3A 1P9WA 1NF2A 2QKYA 5G2OA 4PZ0A 1ACJA 2OKGA 1A72A 4YUXA 1VE1A 4REQB 2LCIA 5BN3A 4F12A 2CXQA 4M4SA 4EQ6B 2A5LA 2IA5A 1G2OA 1SXJE 2F48A 5FEMA 2YS7A 3AKDA 1KDYA 3CT6A 4IMIB 3E7FA 4DCUA 1V3QE 1Z22A 3QWBA 1QP8A 1XNGA 2D5AA 2DSNA 2VPZA 1PS8A 2R7KA 2RAVA 1UT8A 1N5RA 3COVA 3HLYA 3IP7A 4MUAA 2Q4OA 3TNDA 1CVIA 1W36C 2R84A 1PR1A 2K6GA 3R9XB 2EKDA 2RK3A 3F5DA 3RYIA 1SHZA 3LNTA 2VP0A 5H9VA 4J4HA 4LSZA 1JHVA 3MWYW 2Z4RA 3R3ZA 4PZUA 1M1NB 4RTLA 2GR9A 1EFRD 4N9WA 1A2QA 2I3BA 1XAJA 2H59A 1IY1A 1XUOA 4MKIA 4MB6A 2QE7D 2FP4A 2B83A 1MZVA 4IRMA 1AV6A 1R5JA 1UXJA 3SIXA 1XA3A 2G6BA 1QHIA 2B4QA 4G26A 4A8JC 1KJQA 2QI9C 5DNUA 3DDUA 1NVFA 2JK0A 3OX2A 4C7XA 2GYVA 3KJIA 2C7VA 2O3SA 4AECA 1C1HA 2LCQA 5I7WA 1VJDA 2QE6A 3K72B 5LZ8A 1E7SA 5LZ5A 1MQAA 5CDGA 4M21A 1IEVA 5JAQA 2IHBA 2FWPA 1FP6A 4IR7A 5EQDA 1TM1E 2O5EA 2VDLB 1VDMA 1XE3A 1J90A 1S3SA 2QX7A 3OCZA 4E13A 4H16A 2ZK7A 1FU4A 4NCJA 2XQKA 3VZQA 3OQVA 4IEIA 4QGHA 4L08A 5LBTA 3TSYA 4DJJA 3SHWA 3AI7A 5EQJB 3B6KA 4CKWB 1T9ZA 1BKDR 5BSFA 2V9ZA 5JYBA 1PZMA 2DPLA 2E4YA 4N3AA 2V4UA 1JU9A 4TZKA 5G1OA 5BW6B 2OV2A 3QHAA 5AUPB 4LV8B 3UJCA 2VWQA 4LSGA 4KAAA 3A9TA 3L92A 1Y5MA 2B99A 4F8EA 1A98A 1WPQA 3M9WA 1HE3A 2SCUB 1QHHA 2WJYA 4CCYA 3QWFA 5F7ZA 4Z7QB 2OUIA 3TZLA 4DMRA 4HDQB 5CCEA 3N2KA 3SU8A 2WQ6A 4UVDA 2CSXA 4RBNA 3DV2A 1ZHHA 3T9DA 4E15A 1YBAA 3VU0A 1ZN7A 2J32A 2XBUA 3PEFA 3L0PA 4YAFA 3JW8A 4FDMA 1MJHA 3JQFA 4BXOA 1L4LA 1K66A 4GF5A 4RY0A 4K9KA 5EP1A 4NYJR 4F8YA 5I3ZA 3ADDA 5D6OA 1UJCA 2IYTA 2V96A 3ABSB 5CYFA 3IAHA 4Q9IA 2EFGA 3IEIA 3MK31 1HZZA 2O1EA 4OQNA 1Z88A 1T9BA 1NW4A 3K9HA 4CIVA 4CCWA 4O33A 1LVGA 3EUAA 2QTLA 4N49A 3L9WA 1OYWA 3C7CB 3E5NA 4Q21A 4UPDA 1OIXA 1JKJA 4P36A 2PZAA 4V24A 1REQB 3LPCA 3PSAA 2HA6A 2QVYX 4L16A 5EMJA 1G8YA 5M3BA 2DPMA 2VBFA 4G9EA 3H5OA 3NAMA 3QOFA 5DHUA 4BNGA 1A9SA 1NNI1 3L46A 4KQHA 3TZCA 1Y63A 3WNZA 3ZGLA 4CG3A 2BKEA 3I9KA 1W0CA 3QPUA 1H0KA 2QDXA 6CHYA 5HKOA 2E3JA 3PICA 1JIJA 3PD1A 2O8NA 3LXUX 1I2MA 2B3DA 1YFKA 2I4LA 1WG8A 1BKSB 4M9XA 5E4FA 2AVNA 3F9IA 2G9ZA 4FQ5A 1YL5A 2J59A 4MW5A 2PZMA 4CTMA 3SR3A 3WV5A 3QEOA 4TWJA 4UAJA 4C5AA 4EY7A 3WSVA 3YASA 3AEKB 1P61B 3H8WA 3VBEA 3AHHA 4LMPA 4OKNA 2H17A 3PFBA 4MKRA 3V1LA 2QD2A 3ZQUA 1TX4B 3B38A 5KWSA 4M9CA 2R7NA 4DFDA 3H6HA 1EK6A 2ZBGA 1ADCA 4BUJA 2R9VA 3QKIA 2C7RA 1YONA 3KYDB 5A4AA 2F8SA 4KN9S 3FHCB 5EIEA 4RHYA 4BQOA 5C8ZA 1LBTA 3OZAA 3FSEA 3E9CA 4IJKA 3DLCA 4TWAA 4M3NA 2IODA 4B2YA 3BPSA 5ARBA 4KPUA 5JYDA 3HCWA 4H7IA 5JFGA 3QM1A 5EIAA 3UHAA 1ECPA 4AJIA 4KHZA 1MV5A 3PC2A 3C5EA 1YVEI 3FW1A 4RJIA 1KAHA 1DADA 2AN3A 2ODBA 2QAJA 4LHYA 2FF5A 5KQMA 4DLYA 4B40A 1E2UA 3I92A 3SHFA 3GN2A 3KC2A 4R40A 1QORA 1KS9A 2H4FA 2RKBA 4QL3A 5FA8A 4DDUA 3M6MD 2Z56A 3CR3C 3N58A 4MAFA 4CDGA 1L4BA 3K9NA 5D86A 3SZLA 5BYBA 3DAOA 1AX9A 2WWGA 4ARZB 3JALA 4QPZA 3P19A 1QGAA 1ODTC 4XLLA 3UUEA 4DV7B 2R0QC 3JQEA 3BSFA 3KTOA 3TQCA 3WMFA 4RTSA 1WUHS 4BE7B 1GZHB 4BO2A 4M53A 1P1FA 4J9UE 5AMXA 4MR9B 3N39C 4N8DA 4QODA 3DT6A 3SG0A 1GWNA 3ULKA 4A8JA 4BGEA 2CF5A 3C6QA 3OM1A 1Q7RA 4NY1A 4TTTS 4AW9A 2PGNA 4R05A 1JEEA 1JILA 3FF4A 2QVCA 3QKSB 5HEKA 4WKGA 3A6DA 4XYBA 3NAGA 3DHVA 2Q3MA 5E4TA 2P2GA 1O96A 4A1FA 1YTLA 4HF7A 4Q5IA 4WN9B 2PS3A 1GNQA 2YDYA 2R751 1EK2A 4MVJG 5FB3A 3F2VA 1UJ5A 1M5TA 2H2FA 2Q6LA 4OQPA 2G71A 3KXIA 1QG2A 1OLXA 5DI3B 4XYEA 3T54A 4ILKA 2GESA 1NFRA 1ZCFA 1NMQA 4DMFA 2D0OB 3RJZA 1Z2NX 3H5TA 4L5JA 1WXHA 3AILA 4JLJA 2Y2UA 2B5VA 3BAFA 5LP6C 1XZ8A 4U2CA 3V2HA 4K6CA 4KDEA 1DJQA 3CUYA 3FI9A 1W2WB 3M9LA 3DHWC 3OHSX 4K9DA 2V6MA 4U8GA 1OW3B 4YJKA 3V7YA 3ZW7A 2GKSA 3BN3A 5HSGA 5IPFA 3B9RA 2GO1A 4ZZ1A 2E89A 4QASA 3V1KA 2XCQA 3OIGA 3T9AA 1WJGA 5AJXA 4DB4A 3VR4D 1IBMB 1L5SA 2HHLA 4NBKA 4RCVA 3CTMA 3W2IA 8GPBA 5JIBA 3T7JA 2P2DA 4O1IA 4URXR 2I34A 1BXKA 2HTEA 3GELA 3WK5A 4B9AA 1NXPA 1ZA2A 1ZC3A 1L7EA 1Y4AE 2O7VA 3CF2A 4GXRA 2FR1A 3GFQA 3T4EA 4P2BA 2PJRA 5HP4A 1JTEA 3GBSA 2YHBA 5D7NA 1J23A 1SD5A 3T8YA 2ZSBA 1A8IA 4B4WA 4KV7A 3UJDA 4PONA 1UM9A 2CD9A 1WABA 3FZEA 3HGQA 3PUXA 1IN5A 4HDAA 1ND6A 4PAGA 3UMVA 3VJRA 5BSWA 5HYVA 3EGXA 5IT4A 2DBRA 2IIQA 1UFRA 1L5YA 2I71A 5F9HA 1EJBA 5JAMA 4LOHA 1U6KA 1LZKA 3E58A 3K7EA 4TTIA 1OVMA 2R8EA 3UJ3X 4MDEA 2MMCA 1GZ6A 3BXHA 2HRBA 3JY6A 4C88A 1EXVA 3SQNA 4JC4A 3B7GA 2JIDA 2FETA 4U2EA 4XRGA 2FUCA 3N2YA 2F1KA 3ONWA 1IWBB 1MRNA 3H2HA 5EWLA 3GRFA 3NKFA 3QFTA 1XPOA 5E7JA 1N78A 2ZSUA 2REXB 3EVGA 5ALHA 2XI4A 3GK3A 2LTAA 2VH2A 1PEAA 4FMCF 5G4KA 3LLSA 1VRCA 3VPGA 3HP4A 4JR2A 4OJMX 1U81A 2AZMA 4KVGA 2C2OA 1JJ7A 4FMCB 4GI7A 3S5UA 3ZUPA 4B17A 3JXEA 5KQSA 1M1ZA 4JSTA 1C3LA 1QAQA 3A36A 3IAXA 4ZO8A 2HF9A 4X66B 2V7WA 1GR1A 2HKIA 3W90A 2EYQA 3PKJA 1J5PA 1LI4A 2XODA 2JHFA 5FWNA 1Z83A 1Y8CA 1K9SA 3PRYA 4URWR 4NOKA 4MUEA 2W83A 4P4SB 1CFZA 3CLUC 1H85A 5KSOA 2A6PA 4KJZA 2QVLA 3G82C 4RYDA 3V8MA 1T1IA 5KINB 1V2HE 1ESDA 2CYCA 3MTQA 1C7FA 3O74A 1SG9A 1HG0A 4IHJA 1NQ5A 3L43A 4K9NA 4U7JA 3G1UA 2FLWA 2C7PA 4X65B 1TLFA 5AIBA 4CIYA 1I1HA 1DIHA 2ZRCA 2ZUTA 2WWHA 3Q9UA 1J1UA 3ZC3A 2YJ3A 3L7OA 3NJ8A 1YO6A 2Q62A 2X2PA 3R6TA 2O14A 5BXYA 1O0SA 2R7MA 5C31A 3CXUA 4N7JA 5HILA 4RW0A 3SGLA 2QJWA 1B6SA 1XPJA 1O94A 3HB4X 1S8AA 1T5LA 2ZZNA 2YICA 1B1AA 1DC8A 4G1BA 3T0IA 3OZEA 4F9EA 4D5EA 1VL1A 2WF8A 4MVJD 1C0KA 2JFPA 1FDUA 3MTIA 1SWVA 2VT3A 3EUWA 4O2LA 3WKBA 2CY0A 4WJLA 5I7EA 3QEAZ 1SU8A 4WBNF 1GKLA 4GKAA 4MEBA 4AKHA 1GVHA 3BGOS 1U80A 4HLUC 3RFCA 1S1CA 4IIDA 3ZHZA 3ZKWA 4H1WA 1XD2B 1Z63A 3R23A 3VO8A 1GO2A 5J2TA 1U7TA 4GX0A 4I8DA 4UAGA 4NU0A 4C89A 3Q3HA 1NTOA 1A2KC 3ASVA 5CYPA 5CP8A 3HEAA 4BL5A 3F6SA 1KJWA 2Q4BA 2C2MA 2W4IA 4X1IB 2PE5A 2JAQA 4JLNA 1T9KA 1GR0A 1GL9B 4M0PA 4RGQA 1IC6A 3AKEA 2O06A 4MS1A 4OKIA 3STVA 1ZU4A 3F73A 2ZAYA 2PJDA 1VE3A 1PJLA 3GJ7A 3NWOA 4FDVA 1TAGA 2H1CA 3LP5A 3OM0A 4B09A 4C78A 3QE9Y 2AKEA 1E3QA 1OXMA 3A04A 3D0QA 5G0SA 3PI6A 4MWOA 4QQKA 2A7XA 5GMOA 2F4VB 3KQLA 2ETVA 1J21A 4R0VA 3FOWA 3GJ0A 3GNLA 5K6AC 3O4HA 3C16C 3K6JA 4BZXA 2G0TA 2W2QA 4UUNA 1S2DA 2GJ9A 3U3MA 4ETIA 3VAYA 2BELA 4IO1A 3U3JA 2IYNA 1CC1S 1ZONA 3TG2A 2IVZA 1NQAO 2HHAA 2XUJA 1J0BA 4QYIB 3JPWA 4LK2A 1Q1BA 2A88A 2C8LA 1CUSA 3EXAA 3S8MA 5JJ5A 3WLFA 4H3VA 4ZRNA 5GY7A 1ONSA 1PLJA 1U7HA 2HEGA 3FFBA 4FSXA 1A4XA 3FOAA 1ULAA 4TGLA 2NYUA 5DGTA 3ROQA 5J2UA 3DV0B 5SYNA 3SM9A 1EX7A 3D2LA 1W4RA 4MV6A 3OFJA 1MHTA 5EE0A 1UEXC 3DXXA 2J9FA 4BJ1A 4DIKA 4GOJA 1ZD9A 2AXPA 4D6XA 4KREA 3IEPA 5CVEA 4C22A 5DHPA 1G2IA 3IT1A 3IUBA 4HNHA 4O2BB 4C5BA 4YRCA 4CQLA 2J3MA 3R41A 4UU8A 2X0EA 4E5KA 3NR2A 4L8FA 1M8FA 2ZSEA 1LW7A 1L7MA 3URKA 1RI3A 3S2UA 5K8CA 2XKAA 2C57A 2A5DA 2I4TA 2IEBA 2OOKA 3KWLA 2Y0BA 4TTPA 4YECA 3TQTA 5E2BA 3IT0A 1XTKA 2CUNA 3CRMA 1MLDA 5CEJA 3EPRA 3LUBA 4O4LB 1KPGA 3OF2A 5C46F 3L04A 1K3FA 3N76A 2D00A 4I81A 3G89A 1N9GB 5HIMA 3BL5A 1KNQA 1LLDA 2BFFB 3O92A 2ZXUA 5BN3B 1M2OB 5JZMA 1FSSA 2GHQA 4LHEA 1IBKB 1ATZA 4NULA 2RARA 3HKDB 1S5PA 3KWMA 3EIWA 3LUDA 1GFIA 4ID3A 2HLDA 1IATA 1S4QA 1YULA 4RSRA 5DLPA 3VRHA 4MHSA 3LWZA 3GDOA 3N70A 3ZVLA 1GFSA 1K7XB 4ISBA 1XNHA 4RE6A 6GPBA 1RQGA 3CZ5A 5TMBA 2ZJ8A 4XYLA 1C9DB 3BXGA 5K9ZA 3PEYA 2IQIA 4P82A 1OROA 3USES 4EFNA 3X0DA 1V2GA 1ESCA 5JHGB 1J42A 3F1LA 2FQXA 2J3KA 4MS4B 2RGDA 1N6NA 3FSGA 3R6WA 4UNRA 3KLBA 4JHXA 3FY4A 1PZNA 5FWAA 3T3GA 5AHKA 5K3FB 2P2SA 1N3LA 3H11A 3R8XA 3LO5A 5F2EA 2IWRA 5FD8A 4TOIA 1NF3A 4GQAA 1L4NA 4ZZ2A 3ITKA 2PL1A 3QEMA 4LZZA 3C98A 4W1QA 1UOPA 2JLQA 2Y9PB 3QOXA 1KERA 5E1MA 5BSUA 2O0KA