4ZC8A

Structure of acetobacter aceti pure-s57t
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
APVVGIIMGSQSDWETMRHADALLTELEIPHETLIVTAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Mutation of the conserved serine in two PurE classes
rcsb
source organism Acetobacter aceti 1023
molecule tags Isomerase
total genus 55
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 4zc8A00
2FW7A 5CLIA 1U11A 3KUUA 3LP6A 3TRHA 2NSJA 2ATEA 4YCDA 2H31A 4YCCA 4ZMBA 5CVTA 4YCJA 3RG8A 4GRDA 3RGGA 2FW1A 5BORA 3ORSA 3OOWA 2FWBA 2FW8A 4YCBA 4ZJYA 2FWIA 4JA0A 2NSHA 5CLGA 5BOSA 1O4VA 5C5DA 2NSLA 2FW9A 2FWJA 5CTJA 2YWXA 2FW6A 4AY4A 4Z7JA 2FWAA 4ZC8A 4AY3A 1QCZA 4B4KA 4ZK2A 5CLJA 1XMPA 3OPQA 5BOSB 1D7AA 5CLFA 5CLHA 2FWPA
chains in the Genus database with same CATH superfamily
1O54A 4A6XA 4C2BA 5A5EA 4I8XA 4LYDA 1H2AS 1RS0A 2IYYA 4QXMA 4PX5A 3K6SB 2QR3A 3C2QA 1MH9A 3QV2A 4LQLA 3QE2A 5KS2A 4XD7A 4CU2A 1X1CA 5HQJA 3WGTA 2VYQA 3KXDA 3J7TA 4NHEA 4OBXA 3W5SA 5ITSA 1ZC4A 2H59A 3BJEA 4J3FA 3QUBA 4O4LA 4DDVA 4KL8S 4MUFA 4G2TA 1R6UA 3AY7A 3RRNA 1V26A 4OP1A 3LF2A 5FR2A 1F0YA 4QVKA 3ZDAA 3HJRA 2AG1A 3ZWBA 2JBAB 1BFKA 4XGQA 4MS3B 4C7XA 4YPOA 1LB1B 1KO8A 5L51A 5BP7A 2QTNA 4BHTA 2JAHA 3I8OA 4TS3A 1MB0A 4LSWA 4EQ6B 4AI6A 4BAGA 2R8RA 3PNQA 3IXQA 1L1EA 5HBRA 4F2GA 2A7QA 5LBTA 4IFEA 4LWOA 4XGRA 4YJ3A 3MWGA 3U4DA 4GAEA 1COWD 3C5WP 5DZSA 3WL7A 4D6YA 2H65A 1YC2A 3NCTA 4FN5A 2R65A 3LGAA 3GMIA 2D54A 1O4VA 2VPYA 3FZGA 1JXMA 5IKOA 1GO2A 2ZRBA 3THRA 3VSDA 4X1IB 1OBVA 2G9RA 1RXVA 5MN6A 4HKTA 2D00A 3VH2A 2YN4A 2ID4A 3W8NA 1I7QB 3ZX4A 2B94A 1BWPA 2CD7A 4NEGA 1WMDA 4ZCPA 2J3KA 3CUEF 4GLOA 3GXBA 1X7ZB 1YK1A 1M7GA 4MRPA 2ZSUA 5J63A 4W7SA 1XQYA 5ALPA 2C97A 3E27A 2VJOA 1QTRA 2VZ8A 3NFYA 3NTVA 3Q7RA 4Q1EA 3UWDA 5BUZA 4YNBA 4DABA 1G4UR 3O4HA 3ZDCA 1JJBA 3TL2A 1SVSA 4ZT4A 1TVKA 4RWEA 1C80A 4CLHA 1E9SA 4E2WA 3CRW1 5KNCA 4ID9A 1G63A 4RZ2A 1O95A 1Y1PA 5ER6A 3QPCA 1PJRA 2C9YA 3FNGA 3GJ6A 2AWNA 2RC5A 4MMZB 1L4KA 2C2BA 2D5CA 3C5VA 3I73A 4V02A 1W30A 3BKXA 4WLNA 1EM8B 3SLRA 1E99A 4JMLA 1TE2A 5BSUA 4D9GA 2X9QA 1BGWA 2AE1A 3IO3A 2WU1A 1TU3A 2WSSD 3EQ2A 4E2FA 5KTRA 4X66B 1ZESA 2HXYA 2O0MA 4FDTA 4E08A 5JS8A 2WMDA 5JEDA 2H2FA 1WZUA 721PA 1K27A 2W6OA 3AIOA 3AKYA 4D82A 1QTQA 3S2YA 5JSHA 3W7BA 1D2CA 1XK6A 2EGHA 5J59A 3OE1A 1RI5A 2XRFA 4ZU1X 1KPGA 3L8DA 2PX0A 4EUEA 5KEIA 2IHTA 2NYRA 3F6CA 4FOOA 4K5QA 2C99A 4N0DA 3T0IA 5AVWA 2OBNA 4JJ7A 1SC9A 5IM4A 1Q14A 3LCJA 2ORWA 3EWAA 1V11B 4FINA 1N3IA 2ZRLA 3FLAA 3HVHA 3P26A 4RLHA 4TUYB 4WJKB 1NJSA 3CR8A 3BMNB 3VDQA 4CDRA 5BSHA 2DQKA 2FUEA 2PRSA 3FDJA 4A92A 4R54A 3R5TA 1B1AA 1U99A 2X14A 3E7WA 3FZNA 4IWYA 3OZTA 1UODA 3EGCA 4DBZA 3DONA 4J3JA 2ADFA 1V39A 3MJDA 1DI0A 4M9ZA 2CHQA 4A73A 3JQGB 4QD3A 1N0UA 3ZBPA 4D57A 4ROSA 4KEAA 4HYEA 1YH3A 4GZ3A 4PZCA 3PWSA 4MEJA 1JWLA 1QP0A 3K16A 1B73A 1EHYA 4UTRA 4B6QA 3IHWA 1W5BA 1GR0A 3MCAA 1VE5A 2EARA 2OBBA 3L7JA 5AUNB 1KK2A 2FWMX 4MKFA 4V0OA 2BE7A 2WD7B 3KTAB 5DX0A 4BQSA 1A1VA 1EX9A 4FIZA 5F21A 4QSHA 3HA7A 3ZK7A 5K0TA 2JCSA 3PTLA 1RWBA 5LZ9A 5ICSA 1CS0A 4EAAA 5ELMA 1J9EA 1UPBA 2DBVO 1NFQA 2JHCA 3CB4A 4FMPA 4GLFA 1N6PA 2P67A 2GN4A 4RDHA 5L4SA 1UK9A 4X90A 1LBSA 1OHHA 2Q2QA 3CYFA 4O4JF 1C3VA 4JLNA 3ZKWB 1ODJA 2OUKA 1MA0A 2NSJA 3ASZA 2WOJA 4YECA 3TRDA 2K5UA 4WESB 1I2CA 3WBKA 5A4IS 1DCTA 3O3NB 3OEHD 3BAFA 3R0ZA 3VXKA 2VH1A 3B8EA 1U0BB 1H0RA 4R16A 4YBZA 4MQFA 4LGMA 1DDIA 4W5HA 2FWIA 1SUSA 3D2CA 3TOZA 1UPUA 2PX6A 1EWYA 2W11A 2YOGA 5HCNA 3RR2A 1Z4LA 4DVGA 3AB7A 3DXXA 4ECEA 1K9SA 4YCAA 2B1QA 2SECE 2GZMA 2I7VA 1VHQA 5J47A 2KLBA 2ZRNA 2DZDA 1U7DA 4E4YA 4OQNA 2GN2A 3IHLA 1XRSB 2P79A 1YJCA 4U2DA 2BZSA 3IPAA 4PG7A 4BKUA 1Y1KE 2O0KA 2IA5A 2RJOA 1F3OA 2CFIA 4DMKA 3NW9A 9LDBA 1F1JA 1TRHA 1KBOA 5AWFC 4CRWB 1EX1A 4GXTA 3B6MA 5IDYA 4EATA 2N75A 2WNIA 2QR2A 4AKHA 4G9BA 1QNLA 2TRSB 1NRWA 5TMEA 3CEJA 5K6AA 3OKPA 4J76A 1OWLA 1U7TA 1NUTA 1EUYA 1DKOA 2AG0A 4GQBA 4MGEA 3JATB 4O2BA 3RC3A 3ND9A 1PT7A 4CM6A 1KYQA 3UAGA 1IM5A 4S05A 3OQMA 2V7VA 4PSDA 1JV2B 2CZGA 1IY0A 5T6MA 4JKOA 2BFBA 3ZQ4A 2GO7A 5A6SB 5JYCA 4J2TA 4A1OA 3T5GA 3T5AA 3HB4X 4MUKA 5FORA 4AFNA 4B6EA 3BWCA 1S7GA 4EJMA 2ZUSA 4Q1FA 2DUWA 4O4LB 2H3HA 4HAYA 4OBWA 3PXCX 4F0JA 4ABYA 3D3JA 3L1UA 4R3NA 1N1EA 5I5EA 1PDOA 5IT0A 3TLGB 1WEHA 2POQX 4LDQA 1NY5A 1P9WA 2QUKA 3JZIA 5KHAA 4BLRA 2H1IA 3RAPR 1QWSA 5FI3A 3UMYA 4RVOA 5ESDA 3M6AA 1MPTA 1PQUA 2GK4A 4BJ5A 1FL9A 1TGYA 4JB8A 2YDXA 4ZK6A 5AT1A 4NENA 3WGGA 3K0SA 1Z8DA 1WV0A 1A2QA 2JHGA 3UO8B 4DR2B 1HOTA 2HK6A 3EK2A 3CVVA 1U8FO 3FWZA 3B7GA 3DZGA 2JI7A 2UYCA 3Q8KA 2PYIA 1RJ9B 5AVVA 1RTKA 3CLVA 3ZG6A 3WQHA 1YOBA 2A0YA 2ZBDA 4I19A 4X1OA 2H9IA 1F9AA 1UKVY 2ZVDA 2ZCUA 3PKIA 4KG7A 3K9BA 4JITA 1T2EA 4U0KA 5D3MB 1X8XA 1AO3A 1RAEA 4QDUA 1O8BA 4QSMA 4BLOA 1R0XA 2Q21A 5BQXA 1K5HA 1XD8A 1B3BA 2VP9A 1TYCA 1CB0A 2X8AA 1C9KA 3D9QX 2B20A 2Z1MA 3K0AA 5LA6F 1JILA 4GWLA 5I3ZA 5TPZA 4YRKA 4QPDA 4JLOA 1ZA1A 2HIGA 3KYIB 3EZ6A 1TVKB 1Z7EA 4PLTA 5FIUA 1J9ZA 2VSYA 3NWOA 1TYEB 1U2TA 2FXVA 4RJLA 2PUGA 4ONEA 2DPMA 3CF4A 2VJKA 5LJIA 2J46A 2VPQA 5M7EA 5A4JA 3KETA 3V8BA 1F8FA 3IEKA 5JG7A 4ZGWA 2A57A 3LP6A 3VPHA 4ND3A 2ZBEA 1F0PA 3AUSA 4I1YA 4FONA 4FWIB 1HF3A 1A98A 1GGJA 1SCBA 1Q7GA 3SSOA 5CDFE 3OX2A 1E64A 1H05A 1T9CA 2XDQA 5GP1A 3KJZA 4P2BA 1SUEA 3RVOA 4J94A 3ZWVA 3WYEA 3OZFA 3V6MA 1VLZA 2FU5C 4ASUA 4ZEMA 1S3GA 3N2NA 2G4CA 4D46A 5HQ3B 1GT6A 3MGKA 5FQNA 1QPZA 2PS9A 1TUBA 1RR6A 2XBLA 4CL0A 3T3NA 4TWZA 1X1EA 5H5JA 1D03A 1JFSA 4KNVA 1X1DA 3Q15C 1P7ZA 4W5RA 5AK5A 4DARA 3VA7A 4F4CA 4PFKA 4XJXA 5IVIA 1YKSA 2OBFA 1PZGA 3AWIA 3B78A 4FJ2A 4H3KB 4NK4A 2GSDA 4DYVA 1N3BA 1ZMTA 5EHZA 2P8JA 1N78A 4RKQA 3HB7A 5EQFA 4Q82A 3HJHA 2X23A 3I04M 4FGLA 421PA 5M3BA 2ACVA 1JG2A 3UJ8A 4AJLA 1RXSA 5AQEA 1GADO 2QLNA 2NLOA 2VA8A 1S02A 2Y1GA 3PC8C 3ZJ4A 4CCSA 2ILVA 2IVZA 4XB6B 1SXJD 2OECA 4MAFA 2WJZB 1YA4A 2D5IA 4JT8A 3I2IA 1E7SA 2ZXFA 1RYDA 4DGQA 3EY4A 5DI3A 3EZGA 2ICAA 3WAKA 1K63A 4M99A 3TL6A 4XARA 3OCZA 5L4NA 1Y6RA 1UUFA 4LFBB 1Z7WA 4KWEA 1KOLA 1HDEA 3GAMA 3E3OA 1Y1SA 5G41A 3ZDBA 2PLAA 4MGHA 2RJ3A 3C5HA 5FTWA 3UXEA 2VT3A 3ZY3A 4F3KA 3P9KA 2BFCA 4FNOA 6ABPA 3SSMA 3R9KA 4QPCA 1GQYA 2GCGA 5E6UA 1P72A 1P8JA 2Y27A 2DWOA 3DUFB 1XZLA 4OFWA 4UNSA 1KAOA 3RFUA 4N5IX 4LVUA 1HMYA 2CLDX 2ZUEA 1RLMA 1XQ9A 2P4EA 5L40A 1RPZA 1GUFA 4UC0A 4G8BA 3DV0B 2RARA 4RVUA 5BN5A 2GPNA 5F12A 2HEIA 2GN8A 1NYTA 1QX4A 2OOKA 1NWCA 3F3YA 4MQFB 4CKCA 2V6FA 1MTZA 2G63A 2WV9A 1LPNA 1AHNA 3E3LA 3H1TA 3L7CA 4WGFA 5EQJB 3F6PA 4YAIA 4CQLA 1WW2A 5FOWA 5FUQA 4RZ3A 2NU7B 3V4PB 2TMGA 1UDXA 1PFGA 3PPXA 2OXEA 4R2WA 4AO7A 1NSYA 5FAXA 1JYEA 1E1CA 1JBQA 3GO4A 1YVPA 2XUGA 3H1BA 2XDAA 1CIPA 4RY8A 1Z4PX 3TLEA 3TPFA 1L7RA 4F6RA 1Q0LA 1NAIA 1Q77A 4TLCA 2JCXA 2NN3C 3FXAA 4OXYA 1Z2CA 2XNDA 1Z5WA 3X1JA 1BFUA 2CXSA 2HLHA 5B57C 1ABBA 4KPEC 3VVLA 3MJFA 1BFDA 4BFLA 2KLHA 4IX1A 4OJYA 4DKXA 3R3VA 2YH2A 1QZUA 1ISJA 1ILWA 3EVZA 3K2IA 3V34A 4ZIRB 2XRMA 1H6DA 1FNMA 1M1NB 3F78A 2PFGA 2B0JA 2NIPA 5DMHA 3VR6A 4FE4A 2Y77A 1U80A 4KUEA 3RVRA 1DIRA 3ZOKA 2XTJA 1JKIA 2IE0A 3DZHA 1RRMA 3OEEA 4FDVA 1KZ6A 1T3LA 1PZEA 1P2BA 3ITKA 1P3Y1 2VHQA 2WG2A 3MMNA 4G4SP 1LW7A 4LE2A 2C2ZA 2YN0A 3T12A 4A8TA 2WJIA 4PM4A 4TXJA 3IYLW 1E6WA 3GNLA 4L8GA 3MLAA 5JY6A 4NS1A 1WMSA 4G0XA 2OENG 4HEA6 5A3JA 3BWEA 3QKTA 4X3OA 1EK2A 5FUBA 1XZIA 4EO4A 1LBEA 5C53B 1D4FA 2R8XA 3QKRB 1ISFA 2ZIXA 3D3KA 1THMA 4RV5A 3NXKA 5LC1A 1JPJA 4EEZA 3RYCA 1ECJA 3GH1A 1E89A 1KFKB 1TZBA 1LLDA 2I4OA 2FR8C 3ZE7A 2RGWA 1FDVA 1P1RA 2OXCA 1GPAA 2X2PA 3EIFA 3PHGA 2JD1A 2UZIR 4D26A 4AKGA 1PJLA 5TJ9A 2XQGA 5JXGA 1J97A 1PR0A 1XLWA 2WBLC 1RYHA 3KYDA 4I8IA 2PQMA 4J7XA 5EUMA 1US8A 2G72A 2AL7A 3KDSE 3TO5A 4BBAA 3U19A 3B9QA 3STTA 4HNUA 3G7NA 5JQWA 3C48A 1TAHA 3CZQA 4WOBA 5BQFA 1ZRHA 4BFWA 1BDMA 1A5AB 1KETA 2AEFA 2OV6A 5T8KA 2RHBA 5C2JB 4W63A 2CW5A 4GXNA 1OX5A 2GZSA 3HLTA 4GSKA 3F46A 4PNPA 4QO7A 1B8VA 3ZE6A 3PEYA 1PLKA 3OM9A 4UBNA 1FLDA 3RJ9A 2W2QA 4XWTA 2X7XA 1QRSA 2VH5R 1HETA 3L7LA 3ZK8A 4ARVA 2RG7A 3DWGA 2A5FA 4Q7JB 4G8CA 1O0CA 1L7BA 2GRAA 4RCYA 3F8WA 4F3CA 4X94A 2ECKA 3I72A 4H1UA 2BWJA 2XUAA 3STYA 5CYGA 3K6RA 2PL5A 4OI4A 4WXHA 2Z5GA 5EUCA 5KOIA 3PNKA 1YB4A 2BGJA 4X92A 3O4RA 2X5XA 4OMFG 4C4XA 4TMTA 4PYMA 4DJTA 3HDTA 3NDBB 2KI5A 2KWIA 2ZRMA 4LSMA 5DWQA 2Q4RA 1FTSA 3VGJA 2GVDC 1D0SA 3AETA 5K8IA 4LF4B 8ATCA 3LV8A 1YDHA 2OPHA 1FRQA 4BE7B 2VHWA 1CXZA 5I9BA 1YDWA 3TW6A 1UFRA 1UXKA 4RD0A 5KJFA 1GRCA 4AMUA 4OI1A 1ZCAA 3HR8A 4PPGA 1QH0A 2WFZA 4FHZA 2WJ6A 3THXA 1C7IA 1CLEA 2V97A 4IGFA 3HM2A 5JNSA 7MHTA 3FCOA 3TLMA 1KDRA 5LB4A 3C70A 3L8FA 3N5KA 4ZTZB 5CLGA 3V7FA 1SBHA 2IE8A 2YHIB 4IGKA 4S1NA 5FTLA 1Z2DA 4M0CA 1DC3A 1B00A 2OXIA 3W1WA 3PC4A 1V4NA 3S0JA 1CZUA 1YBMA 1BDJA 4UUBA 1Y81A 4R1TA 2EYQA 4N41A 5E4YA 2YBDA 4FS8A 1B43A 3NHLA 1Z6QA 2WAMA 3ZIDA 3C7DB 1TMGE 4NV1A 5LOVA 1J49A 1WXIA 4M1TA 4P35A 2ZUTA 1L7NA 2JRCA 4OFXA 1JF8A 2P9BA 5DI3B 5K8CA 3IULA 4HGPA 3H5VA 2O2IA 3IBGA 4G36A 3WTBA 3E81A 4LXUA 4QFDA 1XZFA 1QFXA 1TO2E 2CLFB 1NVDA 2FW0A 1K2WA 4QLOA 3PSAA 3QF4B 3REQB 1H4SA 2A86A 1E2PA 7GPBA 2RK4A 1CY6A 3CZ9A 1ZXLA 2A84A 2BFCB 4H9GA 3ROZA 1JQAA 3B6ZA 1L5MA 1YRBA 1Z6GA 3G9UA 2Q2OA 5JR3A 1H9CA 5E6UB 1FRFS 4D3FA 1ZIDA 5AH0A 4E5PA 2A5JA 1O0SA 2WOOA 4JP1A 2AUNA 5AHRA 1DQRA 5B2EA 4LFAB 4KZPA 3DLIA 2O8NA 1M1YA 4KH0A 3F9CA 3UJ7A 3VC1A 3CLRC 5KSYA 1TZKA 2PYDA 1Q3KA 2H6EA 4BLSA 2PM8A 4EF4A 3A4TA 5TXGA 1GPMA 2HRDA 1RWQA 1TQ8A 2WHEA 2GZ2A 1KS2A 4I4TF 4MOWA 3QTTA 2QZSA 3DP9A 2C00A 4IXMA 2IHYA 4ZJYA 3LFUA 1VJGA 1A2KC 3HUFA 2ES4A 2H2DA 3ND5A 4BMSA 1QIIA 1AURA 2CFCA 1AQJA 1A4XA 4GKKB 2XCQA 4JAVC 1JH9A 1MA3A 3GUVA 3VNSA 4XOUA 3AFGA 3WLNA 1KXZA 1G3UA 4BNIA 1K7XB 4O25A 3O9VA 3WNZA 4G0NA 2P7HA 4F6RB 2GZAA 3OHSX 3Q7EA 4PLYA 3L8CA 1KBZA 4HAZA 2YWCA 1RAIA 3I12A 4IXDA 2YFHA 2JZNA 4MLDA 4OQLA 3TRHA 4M9XA 3GP8A 1PO7A 1Z29A 4ZODA 1OXTA 2ZPAA 3HGQA 3ZHZA 2PUJA 5H7XA 3MGGA 1UZAA 2LRHA 3MUEA 1L7DA 5F1KA 3RS9A 3SLKA 4OJNA 5KMGA 4CIYA 1I1OA 2HK7A 3ZV5A 3S3TA 2A30A 2FUCA 2Q1WA 2IP4A 3CH6A 3I52A 3R09A 1W7AA 3KKLA 5HIJA 4N7RA 5T4HA 1DXYA 1ZNQO 3Q3JB 2RAVA 4L73A 3HKDA 1MLDA 1MU0A 2C5GA 4F4FA 3TFWA 1CE8A 5L45A 2RCYA 1TA9A 3DXFA 3NYWA 2ZB2A 4MV0A 1XZ8A 4UUOA 3EF0A 2BEKA 2V5VA 4DSNA 2CYBA 4FFLA 4PLCA 4RTQA 2M6KA 3RYCB 4D8UA 1W25A 2OY0A 1XI2A 4F9GA 3MWYW 3ON5A 1O94A 5L4LA 1QHEA 2YWJA 3DBRB 3G9ZA 1JMYA 1XCGB 1ZWKA 3HCWA 4CDNA 2UUAB 1WAMA 5BR1A 1E1LA 3GLHA 3S1AA 4MUYA 4ZDIA 1YS6A 3U4HA 1HGXA 4INZA 3L8YA 5I8WA 3TXXA 3NBMA 1E3IA 2WMYA 4JC0A 4RK1A 3UWSA 4G8DA 3KYDB 1MRZA 1US8B 3IEUA 3KX2A 1XEFA 5JIBA 2QZJA 3ANLA 3AF5A 2C2OA 2NTNA 2XB4A 3ANSA 3HVJA 3TUIC 3IRUA 2IXEA 1OH7A 1VB3A 4DHWA 3OTOB 1NVUQ 3CXRA 4FKZA 3K0EA 2CXPA 3K8QA 2FNAA 4Q39A 5IULC 2YMQA 4FC6A 2FEXA 4OH1A 3AUKA 3PPWA 3AWDA 4FDUA 5AICA 3UHFA 5EMKA 2ZG6A 3LKVA 1ZCBA 4WASA 1OXUA 1IJBA 3UK0A 4E2XA 1WQ3A 3EWNA 1AB6A 4UAGA 3HP1A 3FTDA 3SE7A 2VHJA 1ZBDA 2QHXA 1Y4DE 1FP4B 4TMZA 3B6EA 4XLLA 2N42A 3VBEA 1KAHA 4TROA 1V2HE 1DOHA 1T2VA 2C96A 3BMQB 4QBGB 5CGZA 2HRCA 3ROQA 3OEYA 1KJ8A 5D51S 4E09A 2XWSA 3ENNA 4LX0A 1QQ6A 1Z4QA 1DTWA 3RANA 2EIXA 4GOMD 1GPYA 3WRVA 4ESOA 3VVMA 5ADVA 4GC5A 3IKTA 1P0MA 5LUAA 1YJ5A 2GT1A 2XCUA 2XE8A 4TSFD 4PV7A 1ZS9A 3LUHA 5TR9A 3ZBTA 4D8VA 2ZAIA 4AP9A 1NBMA 4FX5A 2DTEA 1P5JA 4OXQA 2QB5A 1R0RE 1N2OA 3QYAA 1ZN2A 1YZYA 2PS3A 3AETB 4EHNA 2ZBQA 5B3KA 5C9ZA 1KYZA 1KPHA 2ZQYA 3D02A 4K0RA 2WR8A 2OFXA 2Z56A 4OB7A 1E66A 1YC5A 3LBNA 4N5MA 3IQWA 1HEIA 4PG8A 4WK0B 3ECAA 4ZCRA 3HM9A 4DKJA 1D5CA 3IQHX 3ITNA 4R1LA 4WQMA 1XTZA 3EDRA 1YS1X 4H1WA 2DC1A 1NN0A 5ALFA 1G4HA 2WU0A 1VCHA 1XRPA 2C9DA 2PR2A 1P73A 2WNHA 3DAYA 4KLZA 4WXRA 2IEAA 1USUA 1B6RA 1QRRA 2CLEB 3PSHA 4IIUA 4RA9A 1KMMA 1NBHA 4JQCA 3L0CA 1KDPA 1T8TA 4RS3A 3O3OB 2JK0A 4AQYB 1S3IA 4JYBA 2C1XA 2OM2A 2W93A 3IOMA 3MA0A 4O2AA 4CMBA 2XKKA 2VTKA 4MR8A 3WNDA 3ICVA 4HAVA 5I47A 1DBQA 1QIDA 5FFMA 2P9ZA 4PAWA 3SZRA 3IAS1 4CXMA 4OGFA 2IYFA 1TKBA 2OV2A 2QLBA 3M4XA 3K6JA 2ZUUA 3R6GA 1WCV1 4WVLA 4JV5B 3DTTA 4I55F 3ILHA 1CWUA 1TA4A 4LHYA 4OV6B 3CW9A 2CMDA 1H3FA 4GVPA 1Y1RA 3DOFA 1G3MA 3OLXA 4YT5A 1NX9A 1YB1A 2RAUA 3MLEA 1UBLS 1OKKD 1FLNA 4C4RA 1EUDA 3I1JA 4GMXA 4BQOA 1YB5A 3EQ7A 2J09A 3G8YA 4IGEA 1IZ8A 2O52A 3IRVA 2YC2C 4J8PA 5YASA 1PTKA 1DV2A 3MMZA 3OBIA 4BN5A 4KOEC 2BGUA 2H7XA 3GG9A 4GMDA 3ZW8A 1PFQA 4DMGA 5C7LO 4L8LA 5JBNA 3FHTA 4RIHA 2D0OB 3WJ2A 1RYFA 3EEYA 1NMYA 4QICA 5JZ9A 1QC5A 4ZYZA 2DQYA 1Z2NX 1XDGA 2H0AA 1CFJA 4ZOEA 5K0EA 2DBQA 4NESA 2WIKA 4MYDA 4B7UA 4ZZ1A 1GNPA 2GCIA 3VPXA 3R20A 4QOEA 1AIPA 2C7RA 1YFKA 2GILA 1OFTA 4DCGA 1N77A 1LZLA 1RP7A 4LK3A 1YBAA 4ZC8A 5EMJA 4N9QA 5BSTA 3S44A 3VOBA 2DFVA 5HMLA 2AHOA 1YR9A 2O50A 2B37A 4US0R 4XVRA 3SC4A 4ZOCA 4PEVA 1ZNWA 5AKYA 4DLRA 4BKQA 5B7NA 4Q6WA 4CQMD 3DPIA 4G1FA 4R4JA 1YI8A 3BYZA 1QO0A 3CUTA 1VPVA 3WIBA 5KQPA 4EG3A 4CN9A 4NEQA 4TKVA 2HPVA 3U7QA 1JVBA 1Z08A 2JGMA 1T9AA 2ZYDA 2XJ9A 3V1UA 5L7TA 3CLRD 3QLTA 2B35A 7AT1A 4IKOA 3L9XA 3HV2A 4LXGA 2HM7A 3QHPA 3GFSA 3CCBA 8MHTA 2YWRA 2FFJA 1O5TA 1UZMA 3S7ZA 1EVQA 2G0TA 3D2LA 3HHPA 2YL2A 1FPMA 1M6HA 2W6ZA 4ZVOA 4TRRA 4FE3A 3AVUA 1FP1D 4E0BA 5WRFA 4IJ6A 3PUIA 1JDUA 4JI3B 1R5BA 1W48A 2QYHA 3FPHA 2C4HA 4IEIA 3SOZA 3ZZTA 4YT8A 1K6EA 3HZRA 5KMGB 1GTSA 1L5HB 3NBQA 4IRMA 1UJ5A 1ZJYA 2V8OA 4W9RA 3UNXA 3UV7A 3PPVA 3N8IA 1G42A 1VJ5A 4YUZA 3JZFA 2IYQA 4B3JA 1JDVA 1KJIA 1T8WA 3HKDB 1OGYA 1Z0KA 4Z99A 4KQ1A 4ZAVA 1Z2PX 4QOFA 3OIWA 4ER7A 1CE8B 4R0MA 4FNAA 2PSFA 2QT1A 2BMJA 4HYTA 4IJUA 1G8MA 4EA7A 1U3FA 4EY7A 1U0FA 1QP4A 1KEWA 5LQJA 2ZDGA 2A33A 3E3MA 3FUWA 2FMHA 1PR3A 2CV2A 2F59A 2Q2WA 3JD0A 3GDOA 4M8NE 1U7PA 1VIYA 4DCUA 3UEOA 1N2SA 3JRWA 3NZEA 2G5TA 3DE7X 3DJFA 3H4MA 4HX2A 1SCUA 3EA4A 4I1RA 3RQIA 3ZE8A 2UXBB 3N05A 2ZQ5A 3OLWA 4FIDA 1M6VB 4YB8A 3ESZA 3GLHB 3S1AB 3AVQA 2RH8A 3PUYA 2JRLA 1KRWA 3QUSA 1T3GA 3ABOB 4MV6A 2GXQA 4UHKA 1P77A 2E1PA 2BBWA 3LYUA 4EUHA 4ER0A 3S2ZA 1F8XA 2F6RA 4UAVA 4XB1A 4X54A 2WIJA 2PIAA 4R7ZA 1DRKA 4X41A 3ULKA 4YUWA 5E6SA 5J23A 4PSUA 2J3EA 3EZNA 3HL4A 3O1JC 2WSIA 5DM70 1NJ6A 2Y2UA 1HL7A 1A5TA 3BAZA 1KP3A 4CG2A 3VFDA 4GOLD 3CRVA 3OIFA 1DGQA 2IYVA 1FPQA 1NUHA 4X8LA 1DC5A 4NARA 1D2EA 3CT6A 4AJ1A 4QDZA 2DPXA 2ZJ3A 5F98A 2BHTA 1U8ZA 2BGKA 4EOGA 2HV8A 1E20A 2F8SA 4OQFA 2K7FA 1GPJA 3JX9A 5KSPA 2XMBA 3J7AC 3EVGA 2G71A 4IPTA 2FRVA 2GWHA 3P0EA 3P0FA 1R1DA 1EXDA 5CD9A 3QXHA 5IKXA 1FW6A 4HS9A 4I4LA 4UJ5A 3MWFA 3BJZA 4R2LA 1XTIA 1YE8A 5ALOA 1JLLA 1Q0QA 1M5UA 2I4MA 1GL9B 3DMTA 3HCNA 3VR2D 4RE5A 3VMFA 3GRVA 1GGHA 3KVOA 4L22A 5AJYA 4C0LA 1Q5PA 2DR2A 3LIPA 1UMKA 2P6UA 4H77A 1ODLA 4EQZA 2MHCA 4GHWA 3LT5A 4HQOA 3HJAA 3FMFA 1XZNA 4HMOA 4KWCA 1U0SY 3H1EA 3K2QA 4Y6PA 1KI1A 4UATA 1T25A 3E9QA 1C7FA 1IE3A 1Z6TA 3G8BA 3IAFA 1DEOA 2V8BA 2HJRA 2IVFA 2OHJA 3TVTA 2WTBA 3NR2A 2JDID 2WDZA 1QZ3A 2J9GA 4Q9DA 4ZVUA 4EPWA 2E37A 6CHYA 1E3MA 3UKJA 3DLBA 4MR8B 1WUTA 4HN9A 3DAOA 5F9HA 4IO1A 4B3TB 3LD9A 2A1TR 1FFYA 2DOKA 3N70A 4NZPA 3FSGA 4ZMRA 1CEYA 2NAPA 1J8FA 2ORVA 2OV8A 1L7PA 4EJ6A 2NTJA 2BEUA 2Z9DA 5JCJD 4IEEA 6NULA 1XNRB 3N2GA 3PB3A 3RVBA 3QXGA 1RTTA 3UK6A 2ISQA 5SZKB 4C4SA 4LVNA 4HS4A 1F60A 4BZQA 3IB3A 2NVWA 4JJGA 1VTKA 3NKLA 1X7GA 3NHUA 2W71A 2OO5C 4UNIA 4WCVA 4FSDA 2YIVX 1E1MA 2IHZA 3B9BA 4HYYA 2YASA 3A1FA 4A8JA 2O20A 4EBBA 1F20A 1QC5B 4UDOA 5KKCA 2H16A 1XMQB 3UJNA 3DAHA 2RK3A 3ZNQA 5JS6A 1GY8A 2X5OA 4UFNA 3WNQA 4DY4A 5FBVB 4I4CA 2BRUA 4OTZA 3T7AA 2OP0A 4R71A 4L78A 5CNKA 1WV1A 1EKXA 4E88A 2JZCA 4JBIA 1CETA 4RL4A 1G5RA 4BGUA 1ZINA 2GK6A 3DPUA 1XZQA 3K30A 1N92A 3WGKA 3IVMA 4A0SA 1UEIA 2AX3A 4YJKA 1ABEA 2NO5A 1SBQA 3SKYA 4NBNA 4M9SA 1FYEA 4RGYA 4Y1RB 2AF3C 1EZ4A 4E03A 5FDFA 1MB9A 1P2FA 2D7JA 3VI3B 3IQXA 1DAEA 2XHEA 4XB2A 2H5EA 3M70A 1OGJA 2Z09A 4FDMA 1M83A 2WAOA 1G5TA 4FHFA 4ND2A 3CEPB 4JJZA 1SHKA 4KQCA 1KIFA 3WLTA 3LYAA 3T5BA 4XASA 4YFVA 4BFUA 3F4LA 3CO5A 3FHJA 4TYPA 4WOJA 5JQGA 1HKUA 1RPTA 5ENDA 1E2JA 2ZI7A 5HRCA 1YTUA 3AM1A 3CMMA 4RQUA 1L5LA 4B82A 4I66A 2MINB 4IIYA 1Q15A 4Z49A 5FWAA 5EMHA 3EIUA 3HJNA 3KPJA 5BQOA 5EPOA 3U5TA 5HUJA 4ZEWA 1L1RA 4QT4A 1WNTA 3RK4A 3UIEA 1LLFA 2XMGA 3QXJA 4JEHA 1YIDA 5ULLA 5HJ2A 1GYQA 2HDWA 3QA3E 4RKYA 2OHIA 4IUDS 3RVQA 1C7ZA 1VHDA 3AEQA 3JRXA 3OIVA 1RBQA 3G8CA 5DOZA 2WLTA 3W0LB 5A5VA 2XJ4A 4N3NA 3OP1A 5DGCA 5B3AA 5JI3E 2DPHA 2UZ1B 2YWEA 3NC4A 2FWPA 4DE5A 5K3EA 1L4GA 3BRCA 5A3SA 1NE2A 5DYNA 3SZ3A 1BVYF 1J0AA 2XUPA 4P3YA 1SXGA 5JYDA 2E4VA 3KQHA 3Q9LA 2BCGY 2QRVA 3MMPA 2IW1A 4ITRC 2O54A 4BZPA 2H4JA 3S2EA 4MA5A 5CVDA 4BO3A 1LV8A 1RJFA 3ZIAA 3EGDA 1OT5A 4PQEA 3SNHA 2IZOA 1WXFA 3E3AA 4N47A 3QFSA 4E1AA 5EXSA 1KJ9A 3BQMB 3TEJA 4D02A 2WG1A 3LP5A 4CKBB 5TX7A 3QPUA 2P3OA 1U28C 4WA8A 2YXLA 5E7QA 4B3XA 1H23A 3R75A 1BEZA 3DLTA 5JRJA 3LOUA 4HLDA 2WWYA 2GF9A 1RC0A 2XMSA 3I61A 4PSAA 4N5HX 3C3MA 1YZVA 2ZR0A 4HQFA 1NLUA 3ZU6A 4J07A 3VTZA 1A8UA 2K4MA 2KE5A 1YE5A 3BQNB 5E6SB 2ZRQA 1P2VA 1N5RA 2QN9A 2YMLA 1T0UA 4HDAA 3ANXA 4CMIA 4DM4A 2JAXA 1PX0A 3T4EA 1MC1A 2EAUA 1DAOA 3RUFA 2HWXA 3QY0A 3K9FC 5KC9A 4MUNA 2QE6A 2XI4A 4OAPA 1ENYA 1GL3A 3RC8A 3VO2A 5DNWA 4DQ0A 4DJJA 1U8CB 1X0VA 1IZ0A 3CV3A 1AF4A 4ITVA 1Z36A 5JS1A 2WYVA 1L5ZA 4G23A 3U16A 3A1DA 5FBQB 3TZBA 3TGWA 1EFPA 1VLVA 2DCMA 2ZIAA 3GJ4A 1U6JA 1EBUA 4OYHA 5CLHA 1XPUA 5EJAA 4IQFA 3EPHA 2QDXA 2RAFA 5A3QA 4GOKA 1VL5A 3JQDA 1RRCA 2JIQA 3N7AA 3N87A 5H8WA 1YKFA 2Y66A 2RIPA 2C20A 4IHKA 1CUDA 5CA1F 1JLLB 4BQPA 2R8EA 3PNLA 1ZIXA 5KB3A 5FPHA 5DGHA 5DM60 2BSQA 1N8NA 4QJ4A 5C37A 2PDAA 4K26A 2WIFA 2VO1A 2F1JA 3PG5A 2Y6VA 4WXMA 5C51B 1PL0A 1QDUA 2ZFUA 3P7MA 1PU2A 2OMKA 3AF4A 2NUPB 4RIIA 3I5UA 2HSEA 1J06A 4BDSA 3T7JA 1GUBA 3AXSA 3TYXA 1WBJB 2PWPA 4R0NA 5LIPA 3B13B 1NZFA 1GTMA 4CIWA 1HE5A 1WPXA 2AZXA 4I46A 1R6DA 2COUA 3ZJ5A 3AR8A 2G1PA 4A6PA 3ADDA 2IYTA 4HT3B 2RCNA 3GLFE 4JDPA 1DLIA 2PGIA 1U5BA 2VYVA 1TAGA 3O91A 1ORTA 3C3DA 1DWPA 4ZVMA 3ZWQA 2ANBA 3RLFA 1EM6A 2J45A 1T34A 2G9UA 5JHHB 3GLIA 3DE0X 1TOAA 2JLVA 4JQYA 4P7GA 3RT1A 1GZSA 2B4QA 4YUVA 3NNNA 3BHIA 3IQGX 2WWVD 1R0YA 2PQ2A 3I9MA 5EE1A 5JC8A 3QEBZ 3LTNC 1K8QA 1OYWA 2WD9A 2BEUB 1NP6A 2X6TA 3LYLA 4L16A 4YREA 2VK2A 5BQPA 4CBVA 5KZMB 2ZIWB 1HBJA 3SVTA 1YQGA 1FC0A 1JH8A 3DA8A 4MAAA 2IV7A 3UG6A 3WZMA 4QJ3A 2NP6A 1U9YA 3JQQA 4AN0A 1CF2O 2Z8YA 2X5NA 4KP7A 4Q3DA 3R0QA 4Z3DA 2ILTA 3VO1A 5ECWA 2FPKA 3RVJA 1SAYA 2PZGA 1E7WA 1SD1A 3AJEA 3AP3A 1Z0ZA 4DANA 1JSRA 3QBDA 3TPZA 4D0RA 4JYPA 4A8JB 1FXSA 1E5TA 1QGAA 4QDJA 3W5DA 2CV0A 1GTZA 3Q41A 2ZS7A 1VXOA 2UXCB 1PTJA 3OCYA 1FLAA 4KFTA 4LDJA 3W6PA 1T5TA 3LX4A 3GDWA 1WCIA 2XEDA 4NMHA 1COZA 4R9VA 3AUAA 4TN5A 1WETA 3Q7SA 1V43A 1U9IA 2CLHB 2TECE 3LKZA 3NWJA 1E9VA 2YYZA 4IHJF 4RMIA 5FI1B 5HOEA 4BEWA 3UJ6A 3RE1A 1W19A 2YNMA 4IINA 4Q5IA 5A9TA 1I94B 1LI5A 1OZAA 4JIGA 3TD2A 4Z7NB 2H18A 1LNZA 2C9BA 1DBRA 1ZO8A 1AHHA 3MJEA 1AQUA 4HH4A 4HQKA 5ALSA 1PWZA 5TF4A 1RMYA 1GTJ1 1WZIA 4RU1A 4DEVA 2HTFA 4M1QA 1DIHA 3EXAA 1GAXA 3O94A 2ZBRA 4H35A 1KY5A 3OQ6A 2IS6A 4PX2A 3O1IC 3OG9A 4REQA 1M2OB 3MS4A 2VHCA 5JQGB 1N36B 1XWWA 1U0JA 2NZWA 2XUKA 4QUGA 1PJCA 2HNBA 3PFCA 1H65A 1QGED 1SBTA 2ODWA 3FLMA 3HV0A 4RVHA 4ZCLA 4D3YA 4LYGA 2W6JA 5DN6A 1HQYE 1K7FB 1NR7A 3EOZA 3G5MA 3RVLA 5DHTA 1M8JA 4G65A 5F78A 1MT3A 2ZRIA 3GPDG 3GNQA 4QDOA 1DJMA 1E2HA 5HEKA 1T4DA 1OGIA 2PLFA 1G16A 5DHQA 1VPWA 2QNRA 1NRIA 2KX7A 3IMFA 4H59A 1PGJA 5L3SA 1JG4A 4BCCA 5ADWA 3KSAC 1WA5A 3NWEA 4M98A 2VS1A 5CX4A 4YYEA 4GVXA 2JJ1A 3GMSA 4GSLA 5D5HA 3RS8A 4G24A 5HE9A 1GSHA 1J9GA 3QPVA 4FMDF 4IXTA 1Q92A 4LZJA 4DXHA 1TU0A 2XSZD 3A32A 1VIDA 2J3DA 3PCRB 4QUKA 4B75A 3VV3A 4GPAA 1N7IA 4XXHA 3RT9A 3UFBA 4GMKA 2H4WA 3WMWA 2QRVB 3LS2A 4MVJE 1BQ4A 3K9WA 1VL0A 1ENZA 1V7CA 3H8SA 2JJ2D 4MGZR 3NM4A 3W5AA 1I7NA 3C4VA 2IEZA 1OVGA 3PS9A 3UCFA 3VR5A 3WLOA 4EY6A 5BVGB 2SNIE 5FHRA 4GPIB 4AW9A 4PW0A 4TLAA 1IBLB 5C3MA 2EEPA 1YFJA 1EB9A 1AH2A 4I2VA 2C1EA 1EDEA 1RNLA 4PHTA 3STUA 4CM8B 4GRAA 4UW9A 3V8RA 3AINA 4MVJM 4F91B 1YQXA 2QLTA 3FRHA 5ED4A 3MBIA 1R16A 2GETA 5KTPA 4RFSA 2VJLA 3GEDA 4OQQA 1CR6A 4S04A 4UULA 4YJ2A 2QZ9A 5AIAA 4ARAA 3OZCA 2X4IA 1Q1GA 3UOWA 2ZR8A 2WSYB 4BMXA 5FWNA 1X80A 1T1IA 4O3MA 5LBUA 5CDYA 1U2DA 2E55A 2JPDA 4MICA 2XQIA 3U4IA 1NN5A 4DSAA 3GI1A 1XZHA 3P71T 3K5PA 3LXRA 3A9UA 5JNRA 3LUAA 2P4SA 1E18A 3VQTA 4FQ7A 5DBFA 1PZFA 3FFAA 2JCVA 3ODGA 5K0JA 4HH0A 5K20A 1NMSA 4GOND 3AG6A 1RRPA 4FMCB 4C3VA 1CB7A 1GM5A 2WWTA 4MWBA 3CNEA 4JUAA 2DT5A 1EFPB 2BN4A 4R40A 1XJWA 3IIEA 4RL6A 4BJHB 2I2WA 1AZSC 3NDJA 1M34E 5KYVA 3RSSA 3WGIA 2DTDA 5TNXA 5JROA 3U7EB 3VH4A 1DG1G 3EISA 1CJBA 2Q3JA 1Z5GA 3DVQX 3ESBA 3I2FA 3EGOA 5FJJA 4DXDA 2Q0QA 1J8YF 1U04A 3ROPA 1H5NA 3PNSA 1A27A 1LY1A 4IIEA 3EGWA 4MKRA 3W3AA 4MVJG 4QHYA 5E3JA 2KSQA 3TR0A 5BNWA 5IFKA 1EDOA 3WKAA 3FGZA 3EF3A 1UXGA 2EKZA 1K9VF 3RHTA 1KJQA 3V33A 5DM1A 4BYGA 3I30X 3E0XA 1P5HA 3PWTA 3HU1A 1QX3A 1AKWA 2X4LA 4HQ6A 4FE7A 1N33B 1GUYA 4PU0A 1PJ8A 3JCZA 3BGDA 4EUFA 621PA 1U0NA 2DFNA 2NYAA 2VVTA 1U5BB 1Y6FA 2JJ8A 1ESNA 3G1WA 3GK3A 4Q1VA 1XZPA 3T3MB 5HFJA 4DSTA 3GLIB 1UKAA 5AHWA 1BHSA 1I36A 3UYKA 4AKIA 4UPVA 2J85A 4Q4JB 3CVOA 1CX9B 2EX0A 2PZLA 4KLRA 4KQKA 2IPAB 3UJBA 2VNJA 3C14C 2OPBA 2XEXA 5JV5A 1GQ2A 1P5FA 3HY6A 2XGJA 3AVXA 1IHUA 2YZNA 3CZ4A 3B38A 5DT9A 1NBWB 2Q0HA 3Q72A 4UBIA 4BX8A 2YVAA 1RE0A 3TPCA 4N3AA 3VU9A 2DH6A 4PRZA 1OW3B 4C89A 5LOVB 1II8A 3PPIA 1QHGA 1G4AE 2A0UA 1Y7HA 3T0GA 3SYLA 1V2GA 2P5SA 3BWBA 4PHGA 2WINI 4RAOA 5AMXA 3ASVA 4MA4A 1ODTC 5HA5A 3TTVA 2ODEA 5D86A 3VJRA 1JN0A 3FYCA 1SY7A 1R50A 3NHKA 3CLKA 1AKTA 3CC8A 4F8YA 1GG2A 2WICA 2EBUA 5IAAA 1KERA 3UV3A 1W59A 4PCLA 3PUZA 1SHZA 4US2R 1WOMA 1A04A 2BKEA 5HIKA 5EXTA 3I9OA 3EHDA 3MPUA 3DLPX 4B34A 1J4AA 1MN6A 1V3QE 3L93A 1ZWLA 4H0FA 1KVUA 1YR6A 4E5NA 1FF9A 1XL0A 2JAOA 2L17A 2RBEA 3GT4A 3QX9A 4ZP1A 4BFXA 1V16A 4HEJA 5LM3A 4PC6A 3CEMA 3NVKI 1K5PA 5EWLA 2H1RA 1JQJC 2C9ZA 3G5TA 1HYEA 2BP7A 4W99A 4D9MA 3KEOA 4DADA 4E33A 5LL6P 1CUEA 2V65A 3JXEA 2QKYA 2AEJA 3ND6A 2PX8A 1CY4A 1Q22A 3PQ2A 3L40A 4S24A 3BCHA 2L0XA 1KR2A 3T9DA 1XTQA 1NHWA 3LP8A 1NBOA 1Q7TA 3NKVA 5F4ZA 4B3HA 1GCGA 1W0KA 1Z7YA 3ILSA 4LDNA 3N2KB 1NY6A 1Q0TA 2ZTHA 3L49A 3AKEA 2OR3A 2ODAA 2IDMA 4MP3A 2ONYA 5ESRA 1ISSA 1THZA 3IJ5A 1I6LA 5KQGA 3ECSA 2WA1A 1COWA 3KTDA 5P21A 6ADHA 3SIWA 3KEMA 3UC9A 4JDUA 2VTBA 1RM0A 2OKGA 4JIMA 2CZCA 3UXHA 3HXOA 1IU9A 3M5CA 1Z0FA 2BJVA 4B6PA 4EUSA 1Z18A 3SF0A 2X8LA 3R76A 4FTWA 1JKJB 3WL6A 5L3SB 1P1JA 4D4LA 1C1DA 5C8YF 1BVUA 1AK2A 1NI5A 5G4LA 4HV4A 1W36B 1LVUA 5K2MA 4I36A 4ILEA 3H11B 2QQEA 3QVWA 3HWX1 5TQ0A 5E38A 2OCGA 2H08A 4J90A 3DZ8A 1NNLA 3BL5A 2CY0A 3N0RA 4HB4A 1CS4C 1RP1A 2FX2A 4V0KA 3PX3A 1B16A 1ZNXA 3GU3A 3JTEA 3MELA 1EVJA 2DU8A 2PKRA 1ANKA 1LI7A 2OLJA 4AS2A 3H5TA 1QWOA 1YHNA 4P2GA 2DB3A 3B12A 3KDPA 2AJTA 1NIJA 2J0QA 5IARA 2QTHA 1JWAB 1ECPA 3BG5A 1I32A 3EJ6A 4Y2UA 2X7HA 2WSSA 3AOGA 1KY3A 2FV8A 4W9NC 4PZZA 1EFDN 3GVXA 3D5TA 4RVDA 1IULA 1FTWA 1G2IA 3N0VA 4GFDA 1YQUA 4LOKA 4OBEA 4RFSB 5LJLA 1BD4A 1PSDA 4YJ2B 1SJ9A 1UM9A 1P61B 1ZXBA 3KFVA 4H1VA 4J4TA 5JJBA 2ET6A 1X7DA 1J07A 4MQBA 4RKRA 1U3VA 1X80B 2H5IA 5HBGA 3Q9NA 4IL5A 3RRMA 3ZLJA 4FKMA 1CIJA 2CLIB 3IOEA 3HBFA 3M9XA 5LWHA 3K1AB 4X97A 4BEVA 4XDHA 4BLWA 1AUVA 4PPFA 3LHFA 1MIOA 4L5BA 5DIFA 1BCSA 1FBTA 1DDGA 2BISA 3C3WA 3OP4A 4FU0A 5K4AA 5SZJA 1TK3A 3AW9A 4NBTA 5I51A 2C5BA 4MRVA 5CT9A 3L4KA 1I0IA 1P1CA 1U2GA 4H1TA 1IUOA 4Y2TA 5AKZA 2PRZA 4BCDA 3DAFA 3Q0TA 5SYMA 2QD1A 5AM3A 3FKQA 5EI5A 2Q5LA 4PS0A 5BXYA 5JXWA 4PZDA 1K7CA 5COBA 3CRZA 4Q9NA 2V1UA 3H3XA 5GAJA 1ICEA 3V48A 5AVSA 2ZU6A 1BMFD 4J91A 4JI2B 4FI3F 4L8VA 3JQBA 1W88A 5LDGA 3S2GA 5B3LA 3KLBA 5BSGA 2GM3A 3I34X 2OBXA 4BVLA 2WIAA 3NRJA 3QMVA 5AUOB 5B7GA 4FGJA 3LVFO 4NZNA 4BWYA 4EY5A 4BV8A 3USZA 2QL5A 5JAQA 4FB4A 1X9HA 1Z3CA 1P6XA 3JASB 4CM3A 2M6SA 2QXUA 3DMNA 3OEWA 5IBCA 1PGOA 1PYGA 5FUWA 5T3UA 2C04A 2LCFA 4KIFA 4TSKA 1B0AA 5DHPA 3RAFC 1EB8A 5JECA 3BTUA 4MPRA 3L8EA 1LPAB 2OK8A 4PE5B 2GBLA 1Z38A 4MV1A 3WNBA 4AUMA 5FYDA 1JHDA 2IH4A 1DKMA 1BAPA 2AJDA 4ERNA 1AE1A 2H8KA 1MPXA 3AKCA 4PTLA 1HFWA 4CF5A 5A05A 2W7TA 2HXGA 1IEVA 5KVVA 2P11A 3DWIA 1OAOA 5K6TA 4BPBA 1TYZA 1T26A 1W49A 2PPLA 3OQIB 4I99A 4OGGA 5J1TB 5IMSA 1DAIA 4G56A 5G40A 1RXEA 2WM8A 4LY6A 3EEIA 1DBWA 3W04A 2A0KA 3BH7A 1HLFA 2OD9A 5J2UF 4YLYA 3WX0A 4C21A 4BZXA 3O4GA 1DQZA 2REBA 1Z63A 3Q98A 4PINA 2Z8XA 3DZIA 3D6MA 2RD2A 3MD9A 5ERGB 4RADA 3EIXA 2OCDA 5CVCA 1Z15A 3MW8A 1IRIA 1PJBA 1DFGA 1T5IA 3P1JA 4IUBS 1U0LA 4E5YA 4B6FA 1D2MA 1H6CA 6PFKA 1K0UA 5EIHA 3L5KA 3KL2A 2IPXA 3JYNA 1JB9A 1XD2A 2R3SA 3PHHA 3BHJA 4H7KA 3RVDA 3CONA 2O8BB 6GPBA 4ZALA 2FJPA 5FEMA 4MYUA 1H85A 4MX8A 3U2QA 2I76A 5A7GA 2XUJA 1N9ZA 7ABPA 3RIXA 1E2DA 3IV7A 4DA9A 4BFTA 1Z4MA 3RF7A 5FPSA 3TTSA 2BGNA 2PAFA 2NVOA 1E2MA 1GPUA 4KHZA 4AYWA 3KRTA 5G1PA 1XU9A 2FQWA 5DTIA 3BXFA 1CR4A 4BVJA 4UQOA 4EDFA 4RF4A 4YAUA 3HBMA 3VR4H 4AY4A 2QVXX 5IXYA 3OOHA 3UY4A 1KQFA 3PFHA 3TBHA 1V16B 5EZYA 3JQ9C 1LRLA 2VJAA 5EWLB 5JT1A 4KXNA 4KIWA 3ILXA 5I7HA 5AVJA 3UJ9A 4JJ6A 1TECE 5A4FS 5MDHA 3UB3A 2NPIA 2RHTA 3QG5A 4YCJA 1A5BB 2O2EA 3RTDA 4RPIA 1OOEA 1ZM7A 1T9HA 2EEZA 2LR0A 2QV7A 4E13A 1HNNA 2BUAA 4CEJA 5AKIA 4KSYA 1E96A 1SURA 1XQ1A 2J1LA 3M3DA 4JHXA 3VR4D 3BXZA 2GJKA 1QIEA 4CM9D 1KI9A 4JR0A 2EZ4A 1XQVA 4A10A 4OLAA 4J4BA 2G1KA 2QOEA 5MFZA 5B55A 2VTBB 4JQSA 4CEHA 5JD6A 1UXHA 3CPEA 3RH0A 4D3ZA 5KCMA 3T38A 2JH3A 2DSTA 5CH3A 2O5EA 1QTIA 4YP9A 4TUYF 3WP0A 3NT5A 2I1LA 3L0PA 1MXFA 4EWLA 1DQPA 2JGKA 2PUWA 4UVEA 2TMYA 5B1IA 2TS1A 3HR4A 5IBQA 4YRPA 3MK31 3O31A 3TMKA 1SIBE 2WTXA 1SVNA 1Z47A 5IJ0A 1WKBA 1TVMA 4PO8A 4FBMA 2ID8A 4U7JA 3BERA 4IIDA 4LNHA 2B83A 4CMHA 4I08A 4EZIA 1MB2A 2CLOB 4CLOA 1DTEA 4EI2A 2WI8A 2QRPA 2XD9A 3PCXA 3ICEA 3LO8A 5CT5A 4WVFA 4HDNA 4LBWA 5FWYB 4BMOB 4UCXA 4CKBA 4B6GA 4UBMA 4V1CA 1AHIA 2Y2VA 3DNMA 3HCCA 3HACA 1FNBA 1Z2AA 3IHKA 3NDRA 1P3DA 3T9AA 5KYKA 5K8VA 1NI3A 1E6UA 1TFUA 4M7OA 2M1XA 3AVWA 4EDHA 3KR1A 1XJQA 4YRQA 1RHUA 2P6MA 3LY7A 4JJAA 5MHTA 4L08A 1QBKC 3CUWA 4BVHA 5JCPA 1EK0A 4P3OA 1RYMA 3ZCVA 4XIJA 3IDQA 3RK0A 1NN3A 3L05A 3W3ZB 3X1KA 5B1EA 1DMRA 1X1AA 4HAOA 3TQFA 5HOQA 3H4IA 3HC7A 3GD5A 4CTMA 3OTGA 1P5ZB 1ISHA 1UM9B 2REXB 2EZUA 3OPYA 1HDCA 3E5RA 3BJIC 3ROMA 1Q84A 2BZ0A 1BXGB 3OO0A 3FTCA 4EM6A 3P0JA 4YDSA 4CL3A 2CBGA 4HNHA 3NORA 5CX1B 4ZN6A 2ZYIA 5A3RA 4OGLA 1MIOB 2YXBA 1N7JA 1LNSA 5BWLA 1BCSB 3F7NA 3GGSA 4LY9A 5A2QA 2XV1A 5THKA 2APJA 3O2NA 5BRAA 1C30A 2J67A 4HEQA 4IMRA 1QQ5A 4FHGA 1T2DA 4OLJA 4M1ZA 4P86A 4XWAA 4C7JA 4PNHA 1FUKA 3QVMA 5B3JA 4M36A 3DOJA 1KU6A 2AYXA 2DLDA 3NI2A 3STWA 3VHRA 3EQ8A 2FUG1 1OXBB 3T61A 7REQB 1YVUA 4C3ZA 5K3OA 2FW1A 4K1XA 1SXJA 5IC5A 4RYDA 1ODIA 3JQFC 5JD4A 5DNEA 3O9MA 3EY9A 1RLUA 2CDAA 4RIFA 1BJRE 1RHJA 1T6BY 1TEZA 1W88B 4BNNA 1GNTA 2R00C 4KR2A 3ANTA 3DMYA 1SG6A 2WWHA 3LT2A 3ZS9A 3GJZA 2GEVA 3R7FA 2FXIA 3OTHA 1M5TA 1MC4A 2AFIB 4Y9TA 3S2FA 4HGYA 5BQ3A 4HNVA 4N0QA 2QX8A 3OPNA 1JA0A 2HF2A 2B36A 4FZJA 1T9GS 1G9SA 5BN4A 3I6QA 1OE0A 1PS0A 5HK8A 1W96A 1SCAA 3PRHA 2BFAA 3KKEA 3OKCA 5CG1A 1NF9A 3IJRA 5DMXA 1YR7A 2EQ5A 3ETLA 1PJ4A 3L46A 3S4YA 4D2IA 3ESDA 1VYHA 4RZIA 4F06A 1FX0A 1FUYB 2OB1A 4Y9SA 1RM5A 3PUHA 4ZMSA 1NJFA 2X8JA 2XA1A 1CJUC 2OESA 2XNSA 1L5WA 4B87A 3LC7O 5B4VA 1Z5PA 2F1IA 3QWBA 4MQEA 2J87A 3G89A 4RY2A 5E0KB 1IG3A 1YULA 4C0WA 5DHUA 4KITB 4COOA 2JG3A 4KWHA 3GDGA 4CDMA 3T5TA 1LTHR 3TTYA 2IU4A 4YJGA 1MOSA 3TVYA 3I9KA 3RUIA 2JAQA 4L0DA 1Y7LA 1E7RA 3FI9A 3WY9A 3SF8A 3DE4X 4L5YA 1E79D 3KUXA 4HBGA 4LQDA 3FE2A 3PJEA 4L9WA 2PMEA 3TD6A 13PKA 2LD4A 1GPWB 2XOXA 3DVAA 3JSXA 2Z2JA 4M22A 1LSOA 2J08A 3P9QA 4EG4A 3HVRA 5IN5A 4Q21A 3HUDA 1CEEA 2B2NA 2IZ7A 2OKCA 5C8VA 2QAIA 1TNDA 3L1IA 1UJ6A 1Y89A 3M2PA 4NE2A 3RREA 2PXAA 3P97A 3GDFA 4D6PA 2NU8A 1TEXA 1XR3A 1XNJA 4IQGA 1Z9BA 2EG5A 3GRAA 4TX1A 1JQEA 2W2VA 4LF6B 4MS1A 4GKVA 3V4VB 2PH3A 5BYJA 1W4RA 3HI6A 3DL0A 2MJLA 5U4QA 5I7WA 2B5OA 2MIIA 2PD6A 2ZWIA 3OPQA 4HUTA 1TJ5A 1WB5A 5JTUA 3RJMA 1SBNE 3U9SA 3MF4A 4LI0A 1VLLA 1WB6A 3K9HA 4DDWA 5BMOA 1N0WA 3B6KA 4DA8A 3K1JA 1JXQA 1BIFA 4LV8B 1DT3A 1NVWQ 4P08A 5EZYB 1YSCA 1RYYA 2XMRA 5DXJA 2JLAA 3RS3A 4NAUA 4D99A 4WW0A 5JU6A 2ENUA 5IKPA 5DIZA 1QK4A 7YASA 6LDHA 2IPMA 4MKZA 4QRHA 1C4XA 3UATA 5IAOA 1CD5A 1KL7A 3FG9A 4GLJA 4LISA 4IOMA 4BIMA 4EPXA 4CEJB 1XXHB 4FVTA 1IB0A 5JFOA 2DY1A 4WY8A 2ZAMA 3PC3A 3HH8A 2ZRJA 4KX5A 1AQYA 4OL0A 1PBTA 2H2GA 2H8GA 3NIDB 3LLCA 5CM9C 2OXFA 3VM6A 3N0XA 5KQRA 3RV4A 1O95C 1WXWA 4I5GA 5FNVF 2J30A 1M7HA 3T1NA 2DQSA 4RUKA 4H3VA 5ES3A 2J4CA 1ZJWA 4IVPA 1U2QA 5C1DA 2WTEA 3AY3A 3D7LA 1P9OA 3FWKA 3L6BA 2C9CA 1GYRA 2F8LA 4LVOA 5D87A 1VB5A 4XTCS 1OWNA 5KNLA 2CN1A 4E14A 1L5YA 1QGUB 5CW2A 1NHGA 3R44A 3PE4A 4FGKA 2R5WA 5DYTA 4HPWA 4QXAA 2AA3A 4L8YA 3NRCA 1VSUA 1KFJB 3UMGA 4YJHB 2B61A 2ZIFA 4Y2SA 4NU6A 4EHKA 1RQGA 3DUWA 1FP2A 4G0QA 4U7HA 2B5WA 5G0VA 4QGSA 1VIMA 4CLOB 1ZHHA 4NBRA 5EE3A 2JW5A 3RC1A 1AGYA 1ARZA 1E1KA 3AEZA 4PG6A 4PZ0A 1S8AA 4YAKA 1X3SA 3P96A 5EVCA 1X7YA 1BWRA 5IHPA 4HDNB 1A8HA 1VGRA 3ABZA 4B7ZA 1WSBA 2QD5A 1T29A 3BWDD 2DYKA 4G01B 4R6XA 4N3CA 2DHCA 3T3IA 4YXFA 3ZGVA 4V1CB 5FWXB 1VG0B 1N4DA 2WB2A 5K0FA 1JR2A 2AW3A 4RDIA 4B17A 2R6R1 2UDPA 1A4IA 2QGZA 5JSYA 3ZVLA 2O5VA 4KFCA 5FPYA 2VP3A 4OHVA 1GFSA 3HNRA 3HKBB 4GF5A 4TXNA 4HWSA 3AR7A 4UBLA 1MC5A 1VYVA 1SIUA 1VPDA 2FWAA 1M2WA 1CJTC 2P2GA 2F9FA 1XVUA 3ZHSA 2R8BA 5JADA 3ILYA 1L7EA 2MDTA 1CUVA 3G85A 4AMGA 5AOVA 3OPYB 3RTBA 1UPCA 3I5AA 3NJ8A 4HDCA 3U09A 3QIVA 2NXEA 2X8BA 1HYHA 5IVHA 2XTAA 5D84A 3V00A 1VMDA 1PQWA 4DLYA 1RYEA 4MA0A 4UU8A 1E3WB 2QAGB 5EL0A 1WEKA 3RSZA 1IZYA 2CL6X 4Y2QA 3WLQA 5KYNA 2BGLA 1T43A 2ZT7A 4J9UE 1CUFA 1CP2A 3T4XA 3HA5A 1CW2B 3QTBA 4XWKA 4FZ3A 1NASA 1JT2A 4JJEA 3OUUA 2R85A 5LA6A 2G3YA 2AOUA 5I4CA 2OCIA 4KUHA 4U9IS 4BJ3A 4DUZB 1W5AA 3FOAA 2PAAA 3QUCA 2WC1A 1SXJB 4US1R 2NZ2A 2HB6A 2WJ4A 1O58A 1VJTA 3P2KA 1SCNE 3D2AA 3HCPA 4KBFA 3FFXA 4II3A 4MJ7A 4EW2A 5KTTA 3BTSA 5IKMA 2DQZA 2A0FA 2A1IA 1J70A 2ZITA 1NI4B 3QM1A 3TBFA 5IC6A 4FOPA 1WF3A 3IKLA 4ZZ0A 1P74A 1ZGJA 5M04A 2AGVA 3CR3C 1AXGA 1FCJA 2QUBA 4L3WA 4MQ5A 3IEIA 5JZMA 4AQ7A 3N8GA 1HPLA 2WHQA 3H2JA 2FVYA 4BNHA 5G1NA 4U0JA 5BN4B 2EJVA 1NOIA 3COVA 2VF7A 1JPUA 1OZGA 3PFGA 2A0WA 1KTVA 2FOLA 4L8WB 4OAOA 2KMLA 4RGVA 2DR0A 3E8SA 3PC8A 1TVEA 3OLVA 3WQQA 5CG2A 1GZUA 3ZVNA 1OV4A 3SEAA 3UAXA 1GN9A 3BDIA 1FX0B 5EJ5A 3GFGA 5DYIA 3FPEA 2X8JB 2P0EA 3CVWA 2UYGA 3WL5A 5K6AC 4I0WB 4KDFA 5CB6A 4O59O 5AVOA 3T94A 2QVGA 3I32A 3AH8A 2GAFA 1OX6A 4WZAE 1TYDE 1H1LB 2UUCB 2YZGA 3SQWA 2N47A 3PIDA 1ESEA 1IOZA 3BCSA 4KXVA 4NY1A 4FK8A 4YJGB 2GERA 2J5BA 4GGMX 1KYYA 1OFVA 1I4OA 5FKJA 3SF8B 3Q1KA 2EFHB 5HWSA 3CIFA 4I6JA 3HCOA 1ZU4A 4K6MA 3S5JA 3PWKA 4QATA 4UM8B 4IBOA 1UMDA 1N25A 3WG9A 1G291 4E32A 1MH1A 4XYEA 5BXQC 3LY9A 1S2NA 1E9AA 1N2GA 2H2WA 1I7SB 5K3AA 4JN6B 2YJ6A 3GUUA 4YHBA 5BMVF 1DMSA 3EVTA 1VL8A 3L0ZA 3B36A 4PZEA 2V4UA 4F92B 3N8DA 4KR7A 4LHVA 1AKVA 2CV1A 2QMQA 3N2ZB 5GWXA 4LYAA 5AKXA 4QEKA 2NU8B 3RGWS 4ODIA 3N0TA 1FUUA 1VPEA 1OB2A 3DFZA 1GV0A 2VF8A 3RFCA 5MF6A 4EGQA 3A7DA 4YRDA 1FMFA 5KDOA 3A1TA 4CMCA 5A6SA 1X2BA 2J3HA 4K9DA 1DT5A 4WLUA 3ASYA 3W2EA 3RSGA 3QVKA 2GA9A 2PZAA 1GZHB 3HN7A 3O8NA 4FWTA 1KAMA 2GD6A 4KK4A 1HT3A 2W2TA 4IYRA 2OE2A 3JYQA 4OIFA 3SZLA 5GVSA 5IHXA 5DJ5A 3GLGB 3AM3A 4C2UA 2HLDD 2HRQA 1PWYE 2CUZA 4JD5A 1SM4A 4S3MA 1KVQA 3U3MA 5J5CA 4B43A 4LXYA 3P9SA 4QBFA 4ZWNA 2BTOA 4PIMA 4D1YA 3DDNA 2NO4A 5EC8A 4U7PB 2R4QA 3GARA 2V0CA 4TN1A 5DTEA 3MHPA 4GR9A 3FVTA 3DPSA 1SU6A 1IHXA 4LZWA 1AOXA 2PWAA 1UFOA 4NHOA 3QWHA 2GNAA 5DULA 1VYUA 2DFDA 4HNQA 3ICQB 2ZXEA 4PYIA 1Q7EA 4RKFA 4CM1A 4F1WA 3AC0A 3PXAA 1S8OA 4LMAA 3H6KA 1AKUA 1CZLA 1XROA 4BZZA 3WFJA 2YTZA 2FPOA 2XWJI 1KDYA 3VZDA 2DUUA 4KQ6A 4DG8A 1G21A 2ACWA 4JL5A 4EG7A 4EP1A 5KNCH 1K7EB 4D9FA 1ZUHA 1Y7IA 1Z22A 2XF2A 4L02A 5KJEA 2OHOA 1OH8A 1LPOA 1R9NA 2R7NA 4CEIB 3A6PC 4BVAA 3I0ZA 5CNIA 5AKKA 1VKRA 5DGTA 4RW0A 5FOXA 4E70A 4U2FA 2G07A 4GYYA 4X45A 5CEJA 2QZZA 1YRQA 2B9VA 1HLGA 1BEUB 2O6HA 2G76A 3IJEB 4TLEA 1K8ZB 4KYUA 1P1FA 4RPGA 3BFPA 3PF8A 4DLKA 4IEFB 4D4GA 1LCIA 5HM8A 5LQKA 2WM3A 2NQ8A 4KXUA 1U3GA 3GLKA 4N8EA 5CB4B 3REFA 1FVHA 1G7TA 2AYZA 2PEYA 1ZY2A 3F8TA 2OZLA 1XRQA 1IOLA 3MUNA 1KSGA 4OA8A 4RH3A 5EIEA 4OXXA 1MVNA 4P7KA 4HLNA 4NU5A 1BTOA 1F2UB 2AVDA 2A6PA 4TSFA 2QQ5A 4AJOA 3EMDA 3FNBA 1CY2A 4D43A 2PU7A 1V4BA 2C82A 2G1JA 1TC1A 1JNXX 1HTBA 1KMHA 3JRNA 4CF4A 1J2JA 4DNPA 5JMTA 2V6MA 4HB2A 2DAPA 1PP4A 4INOA 1UDWA 1JAZA 2BZGA 3IP6A 2NQ2C 2W5UA 3QK7A 3CH5A 4HRYA 1D6MA 3E2IA 2BEVB 2PD3A 3KTOA 4RH0A 3U39A 3PEEA 3PNOA 1JHVA 2F3UA 4Q18A 5LZ7A 5JO0A 1E5VA 3SX4A 1F7UA 1CUUA 4KU4A 2ZBVA 5E6RA 5KTYA 1TZMA 5KWJA 3K2EA 1IZ7A 1U2SA 5LZ2A 1F0KA 1TUEA 3M5DA 1IH8A 3G88A 4F8EA 1DZIA 1JG1A 3H6GA 3CISA 3F2VA 5LA6B 3QNUA 2Q8NA 2AOUB 4YCSA 3PNPA 1NNEA 3A3YA 3MHTA 2QVBA 1RRVA 3V4RA 4A36A 4HWGA 4P4NA 1C7RA 3KSBC 4BNYA 1JYSA 4IMIB 5DASA 2MTBA 3R6WA 4DNXA 1DWUA 1NVEA 2Y8EA 3L1VA 3MWEA 4AJ9A 5JAPA 5I9IA 3S1SA 1OCEA 2QVCA 4P0TA 5EP1A 3IODA 2VNSA 5EGNA 1T1EA 4IFBA 5CEEA 5FADA 4BEJA 3AX6A 3OLQA 1N7GA 1ZW1A 3B2NA 4AT1A 1N2ZA 1OKKA 3U1TA 3AEXA 3E9CA 1JIXA 1KSHA 3KHSA 3OZ7A 3B1KA 1C1YA 2UUPA 4NE7A 3T3OA 1T4CA 3RD5A 2R8ZA 2ZVJA 1NQXA 2O6LA 3DOCA 1WVMA 3IE2A 3NBAA 4JC5A 3ZY5A 3OZVA 3M0EA 4EI8A 4Q3KA 5DM0A 3CF4G 1P9NA 3IO5A 2JFOA 1ZI6A 2CCJA 2CMFA 3M6XA 4I9FA 4N5NA 3ZCUA 1A77A 2AR0A 5FL7A 3V5NA 3ZQ6A 1ZOOA 4KC0A 1ECFA 2IYXA 2WF7A 9ATCA 3V7UA 2PRYA 1LVHA 4CETA 1TYBE 4G5QA 1B3RA 3F6EX 1SELA 1IYZA 2CLMB 3JD4A 4MRNA 4KXLA 4INPA 4RANA 4Q4HA 3WLPA 1A5SB 2X41A 3ZHQA 3RJZA 5BVHB 1QYDA 2BR4A 2J6HA 1NQ5A 2PG3A 1OH6A 2GZ3A 3GH3A 3QU9A 4TTVA 4G5GA 3ESCA 3T7DA 3AY6A 5F64A 2B82A 4RPHA 2OP1A 4PCUA 1Y3IA 3D6VA 1FJHA 5AK3A 3D1LA 1NBEA 2BCEA 3L0SA 3NPMA 4URHA 4MYSA 1ND5A 1JKMA 5EKUA 3G9XA 4WE3A 4ZQFA 5FO1A 5FYQA 3VSEA 4LWZA 3UUEA 4Y3UA 2GYVA 1IN5A 4DR3B 1VLQA 4H7HA 1PN3A 4IDPA 3WWCA 3NDIA 3GJTA 3LPAA 5HMMA 3R8FA 1AZTA 3DYBA 2DHQA 2XF8A 3HU5A 4NPCA 3E5NA 3TNLA 1ZVKA 4LIPD 4DC1A 3FYDA 3V97A 2XGMA 3A6JA 4RTSA 2V74B 2ZDQA 3HRKA 2PX4A 1N2CE 4PTZA 5TQ2A 2PFKA 1NBIA 1YR1A 4BFCA 3BKWA 4LJ4A 1JLSA 3ELBA 2BMDA 1T5BA 3HVIA 5AHOA 1Q11A 2D0DA 2P9HA 4WXPA 5EG5A 1K98A 2FETA 4HUQB 3IOBA 4XVHA 3DXZA 3PQ4A 4LEIA 1RLIA 3FVQA 2IH5A 1CNEA 1L4NA 4Q9JA 3ZHXA 4AF8A 1YZGA 2ID9A 1ZFNA 3DEHA 4KAFA 2AC2A 1NW5A 4Q9LA 5HF9A 5L3VA 3TB4A 3OZIA 3W9YA 2J0SA 2W58A 1ACMA 3LA6A 1X8LA 4QM6A 3LPNA 1U8TA 1BOFA 3IE1A 1MAWA 3HP4A 1W1UA 4MJXA 2QVYX 2GN9A 3KB1A 3KQQA 4RSHA 3CBGA 1M2GA 4JJIA 4KOAA 5T8KC 3ZDYB 2X6QA 1QANA 2FZ5A 5TIIA 2ODPA 3RYHB 1H2FA 4LC9A 2AXPA 2ZYGA 4I1IA 3GC6A 4JLWA 4XIYA 5I9MA 4BNTA 2PK3A 2EYUA 2YDYA 2YCLA 2XCRB 1NX6A 4GOXA 4FQ5A 1K5GA 4RM3A 2C2KA 1KXJA 4UM7A 5THXA 3WLJA 3X2SA 4BBPA 2VT7A 2CVHA 3PHBE 1SXHA 4DZTA 2Z0MA 3WYDA 1C4WA 1G21B 1USVA 2GJ9A 2QPAA 2XNKA 3OJ0A 4P36A 1GAQA 3D4NA 3ZGNA 4ZTBA 1P2TA 1WXDA 4AMZA 1QRTA 3JAKA 2B4RO 2RBGA 2NO0A 4PYKA 2QUIA 4F21A 2FOIA 2VKQA 2O7VA 1SKBA 3E2PA 4DLBA 1CKEA 1UOQA 2GUWA 1GU7A 4QC2A 2VQDA 2PH1A 4GL2A 1HNXB 2XDYA 4NPAA 3SYKA 4EY8A 1SU4A 3WYNA 1VMIA 3HKCA 3SNKA 4IJMA 3AFHA 1XKQA 2C54A 4NABA 2B7BA 4O0LA 1EA5A 1WCWA 3WIUA 2L2QA 4KN5A 5TPZD 4FCTA 4ZDJA 4YUAA 3GV0A 5IYZF 4KQGA 5AUPB 2FAXA 2W0SA 1CNFA 1DIOB 2OHXA 3FJYA 1M54A 1ZUD1 4D8YA 5F7XA 1IQPA 4Q1CA 1A50B 3LU1A 1DKPA 1ZMOA 2ZUDA 1TYAE 4Z51A 4RTOA 4DDTA 2RGNC 3SIRA 2JI6A 4BFVA 3QU4A 2X9LA 2G9NA 2IHUA 5G0SA 5JBIA 3IAM1 1C0IA 3H1GA 3T4UA 3U0BA 5KX5F 4NDNE 2XCTB 3LBHA 1ULUA 4G6ZA 4M53A 1FFWA 4PLPA 3O2SB 4OXKA 4AKTA 4E4RA 2PMFA 3D3EA 1H9AA 1WY7A 1DOAA 3EEFA 5KI6A 1KI3A 3NHPA 16PKA 1PHPA 3GWZA 3VZQA 1B93A 5CITA 1NONA 3CUSA 1XOIA 3GFBA 3ZWYA 4KE7A 3VR2A 3BXXA 5DHAA 4PC3A 2AN1A 2R62A 2GFQA 2NW6A 5FBRB 2HMTA 2HQOA 3N3AC 1IG0A 3SVLA 2HSZA 4M8LA 4XUGB 2C8KA 5HR5A 3FPAA 2ZBPA 4N48A 3Q7IA 3WYAA 1O6ZA 1XXLA 1WTCA 2B98A 2J7PD 2FZLA 3FYHA 4G5YA 4M7PA 4EB0A 1I0ZA 1JIQA 5E6RB 2NM0A 1BHJA 3BFVA 2IK8A 4GXQA 2O7QA 4HDRB 4LMBA 4N01A 2HDNB 3UWMA 3AKZA 4HWRA 3RSFA 1WZ2A 1B2LA 2JDIA 4MUJA 2W90A 5G2OA 3GN2A 2CVQA 1RCUA 4XYLA 4LQCA 4P22A 5L53A 3QPWA 2EG9A 4EYGA 5KSWB 1NW3A 1DEHA 1KE2A 4PN7A 3M6MD 4YRNA 4ESVA 3MWEB 1GRRA 4O2RA 3E1KA 2XWPA 1M74A 2Z4RA 1FVFA 4PTYA 4EIWA 5JH7B 5JCJA 5DSTA 1RLJA 1I10A 1Q3TA 3MTIA 2A9OA 1B0UA 1XZAA 4Y8VA 1FTQA 2VDQB 1N9KA 2ZI4A 1KAGA 1YS9A 3WGOA 5CJPA 3SR4A 3DNFA 3KZNA 2E4YA 4RTJA 4FOTA 1Y1TA 2D1SA 4M0UA 4ZT3A 1T4CB 7REQA 2QQFA 1BE8A 1YQQA 4I5DA 2ZIGA 4F1KA 3RIHA 1B0ZA 3EFEA 2Q0SA 5LLDA 1U0OC 4A5OA 3ZDDA 1ZCFA 3QUTA 1DINA 1UZLA 3PGA1 4JU8A 4YMWA 1EWRA 1NXOA 3GFQA 5EWJB 2HSWA 4BGVA 2J59A 2GZHA 1T4BA 3CJRA 2D06A 4JT9A 4UOZA 4ZCSA 1M1YE 2J8ZA 4PWYA 3K20A 3E1GA 3L3BA 4Q4HB 4F71A 4J1TC 1TJ3A 4W7HA 4I1OA 1JPVA 5F4BA 3LOQA 4M9CA 2JIOA 4DXAA 2VP0A 1KDTA 4OMUA 1DP4A 3W5JA 2MYPA 1FBNA 4A2PA 1EXNA 3LXMA 4KQ2A 4HVAA 1XEAA 4EUNA 3U1BA 1DFHA 5I7RA 2V4ZA 3LQYA 4C0QC 4ZO9A 1AS3A 1CULC 2GAOA 1E5QA 1GA1A 1HFEL 1TEVA 2OAQ1 3NC0C 4UJ3A 3TM4A 9MHTA 1T2UA 4URZR 1KAQA 4K2AA 4W8OA 4X7BA 2HTEA 4U3JA 3NBFA 3R8CA 3RDPA 1MJGA 1IVYA 1XF9A 3RT7A 5BYAA 2X1HA 4I55A 2HIAA 2P2SA 1V3TA 3H1PA 2MMCA 1H1TA 2ZJ2A 2QMYA 3DOUA 3IP9A 1P2SA 2O4CA 3WGNA 4L57A 3H65A 1ZK3A 2RHMA 3PU6A 4YX9A 2HCRA 4OX9B 4G4SO 2XT6A 5J2TF 3BZBA 4J43A 5CCBA 1QZXA 3QOFA 1V6SA 2PN1A 3MGAA 3RADC 3ZYZA 1IXZA 4PYOA 4XUDA 3LUDA 2CHFA 4WV3A 3PKZA 3MD0A 2QTFA 3KZ1E 1LBQA 5K5EA 1QVWA 3OX3A 5A3VA 1AY0A 1XAGA 1Z8FA 4F93B 1VSQA 3DDUA 3GJ3A 5TVKA 2NSHA 2XZDA 1SK9A 3GRPA 2Y1XA 2NV6A 2ETXA 3KOUA 2EF0A 2MT9A 2O1EA 3N8HA 4MO2A 4TZTA 4Z9AA 4ISBA 4ABTA 1FNNA 1WMAA 1USIA 2X2FA 3RJTA 3MCUA 3MT8A 1WCYA 3AM4A 2VNIA 1REQA 5KO2A 5LQCA 1KH3A 2YXPX 1Z0JA 5CXUA 3MN1A 3K9LA 3LKDA 3L01A 5I8ZA 4I1PA 3ZGZA 2OO7A 1G41A 1SK8A 1XJCA 3KUUA 1ZW6A 1MAVA 1RI3A 4N0PA 4DUPA 4FDAA 1M6EX 4RJKA 2OGUA 2QU7A 2E85A 3CUKA 3O73A 3C3BA 4YRJA 3TBKA 4A0QA 5KQLA 1DIAA 2F00A 2FHPA 2QYOA 3ORSA 5E9JA 3ZDEA 4DAOA 2HIHA 2CHGA 4R1PA 4R9SA 5D7NA 1KH1A 1J0CA 3GLHE 4LXIA 1N5IA 4UEQA 4UVIA 1TQ4A 1AUXA 2DJ5A 3C6ZA 4DDHA 4YC7A 3O8QB 3SZMA 4C6TA 1Q1AA 1P3JA 4OSOA 3QLUA 5EZ6B 5T57A 3WK4A 4CKEA 4A23A 3BZWA 2PHZA 4FX2A 3ZV3A 2WYWA 1IXRC 3PUVA 4R1OA 1BXKA 1D5WA 2G6TA 3LWBA 2INGX 3LE8A 6Q21A 4QTYA 1LI4A 3MWKA 4IIFA 3GRYA 3LGXA 1NVAA 3CTPA 4WX2B 1ZOLA 3PFKA 5JJKA 1JDBB 3VPGA 1RXIA 1L6IA 3GFTA 4R98A 3ABSB 1R0SA 3CPHA 4RXTA 5P8WA 2EX4A 4EGCB 1QFMA 2VP6A 4G81A 4R41A 5DK4A 1MC8A 2R25B 3IDFA 3PXEA 1B26A 1V6AA 3OTQA 5AKLA 3QBVA 3VV2A 3VAYA 5AI4A 1YWGO 1XZEA 3ZUGA 4EL0A 3Q4GA 5FTMA 3DMGA 1MX9A 1RC1A 4X95A 3PIIA 5ALZA 3UXMA 1BJKA 4H0CA 5T7BA 5C52B 4BXOB 3INNA 2OSVA 1M0TA 1WXHA 4JJ4A 1P7VA 2YW2A 1TF5A 3WJ1A 4QVIA 3C87A 3SBXA 3QKWA 3RRXA 1O96A 3GP3A 2ZZMA 3P4UA 1NBME 2Y92A 4Q4LA 4KV9A 2PRKA 4ZU6X 3JVIA 3KJFA 1Z5NA 3O95A 4GU5A 2I6SA 1KP2A 1T6XA 5IKEA 2V6BA 3EQZA 1A2BA 2IYPA 4Q24A 3O8OA 4YMSA 1V7QA 4AL4A 3GELA 4B4VA 4NLLA 2BJHA 3PUJA 1GPNA 1NVKA 1ZZGA 2YJ3A 2Y3IA 3DG9A 3B6JA 2R86A 2A9RA 1AGNA 2J9RA 2VHUA 3C3EA 4O33A 2B6NA 4ILKA 1ZQ1A 4PLGA 2OQVA 3OQOA 1D2GA 4J9VA 1DAGA 4OY3A 4C0KA 5EKTA 1JSCA 3NMUF 2VUHB 1GT91 2J5XA 2CB9A 4DV7B 5ADHA 4IZHA 1N6OA 5DCYA 3SC3A 1AHPA 2QN8A 3HXPA 4FFWA 2P2LA 5KYGA 2QXTA 1BX3A 4LRXA 1AK1A 3BGOS 3PDJA 5GZ3A 2AI3A 3O92A 3PIRA 1C3OA 3H5OA 2DKFA 4OLFA 3FRIA 3ZWPA 3UOGA 3A0UA 5AM1A 2BAGA 4MW9A 3TZKA 2RHHA 4ZQCB 5CBPA 4G1BA 1PYOA 2BY4A 3HG7A 1O9HA 1HDXA 4GMGA 4IW3B 4KQFA 3M1YA 4KWTA 4RCVA 4TRNA 5DCLA 5L7YA 4OB8A 4JUCA 2ETVA 2IKSA 4I1VA 4TL8A 4RTKA 4WY5A 2IUFA 3OFSA 1EVIA 5HKLA 3VZSA 3A26A 4BLPA 4ENPA 3GF4A 2JZOA 1YUNA 2BFMA 2H4HA 4PZUA 3VR0A 3FHOA 4D9JA 3T5PA 1Q6ZA 1U8EA 1G1MA 3DMPA 3IDOA 3SCZA 1YRYE 1CZRA 4ARIA 1XZDA 3VOTA 1G2QA 3WL3A 2FZ4A 4JQZA 5AK6A 3RUHA 3RVNA 5ITZB 4YRFA 1GZ3A 1O97D 2CXTA 2ZI5A 4I8DA 4WLOA 3O7WA 4E5DA 4EFNA 3LQKA 4INAA 4N82A 1ELOA 3G7UA 4UE3S 1Y8ZA 1SKYE 4HBZA 5H02A 5L6LB 4U6QA 1APBA 5G0TA 1B15A 4QXRA 5KYUB 3D8BA 4DA4A 2QX6A 2WUWE 2FKNA 4X5OA 5JSKA 1EVZA 2HRZA 1Z8HA 3VR3D 5CFPA 5HUHA 4NCBA 3W78A 4EMBA 3S6JA 4KN9S 1JLMA 1WSAA 5FOVA 2W42A 3S7TA 3G7SA 4YV7A 2GFIA 1IAQA 3EBLA 3HYCA 3OD1A 4I55B 4D92A 1PL8A 4OI0A 4XTRA 1V1RA 5CTAA 2OWEA 4LZPA 3TWOA 4KAXA 4G09A 3HCRA 2HU2A 2X0RA 2I55A 3KWMA 3EA5A 3LUPA 4LUCA 2JA2A 3IURA 1SRQA 2Q6LA 5SY9A 2GTHA 1JHRA 3FPFA 1XAIA 3G2OA 3SEFA 3MRTA 3OESA 1I4WA 4IV0A 2MSNA 1LV7A 1UM8A 3CLUD 3COPA 2YY7A 1CFZA 3DJYA 3DVRX 4RZQA 1WDTA 3K9GA 2VSNA 4TKLA 3MCWA 5EZQA 2YWHA 1WTAA 4N6NA 5KWIA 1YU6A 1QHHA 2PCJA 4BEBA 5K3FB 2O8CA 3RW9A 2NZXA 4FS3A 1UKBA 3KYCB 1T0PA 4PANA 3DCNA 3CW2A 3JW8A 4QAJA 5FLYA 3NNSA 3PE3A 1UBNA 2IHBA 2GN0A 1REQB 1QE3A 4DW8A 2X1LA 2XSZA 5AVTA 4KQHA 1XPOA 1GJRA 3EFHA 2RBKA 1HE1C 1T2FA 1X1SA 1NC1A 1RJWA 2CZQA 2ORIA 3TOVA 2K87A 3BK7A 3D3WB 3A4IA 4KQXA 2NVUB 4EVQA 1PK8A 4LSGA 1KOGA 1O5OA 3F47A 5FFNA 3WRYA 4GYJA 3QA9A 2JJ2A 1EXMA 3QU5A 1U4NA 1U9JA 4DCCA 1C0EA 3GGOA 4FBGA 4G0MA 1A8SA 4Q03A 4OYRA 3RQSA 5H4GA 1ZVJA 5JVDF 1J2UA 1M6YA 1R10A 2JI9A 2R6GA 3F2IA 3GCZA 1P4AA 1R8XA 3PD1A 4XYMA 4ZAXA 1NXVA 1SZPA 2AWOA 3K2BA 3FY4A 5HF5A 5CJJA 3KZKA 1JG3A 1I01A 3NKFA 2BHRA 4OYLA 5F5NA 3USES 3ZNPA 2W6PA 4LYHA 2A7XA 3V1YA 5IJZA 1T9DA 4C6TB 1RVDA 5E4FA 2PSEA 3A4MA 4UHJA 5ALWA 2JB9A 1USGA