1P5ZB

Structure of human dck complexed with cytarabine and adp-mg
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
241
structure length
229
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure of human dCK suggests strategies to improve anticancer and antiviral therapy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p5zB00
1Z83A 2I4IA 4PSKA 1MABB 4MGZR 2IYRA 5EJEA 3E2IA 3I92A 3UANA 1CXZA 1QHYA 1ZUIA 2AXPA 1T5IA 2QROA 2RB4A 1E2KA 4JLOA 4QGGA 3BC1A 2P5TB 3B78A 3U3JA 4B3DA 3ZZUA 3AH8A 2C77A 2ZRGA 3W6NA 4DSTA 1RRPA 5KUTA 4DZZA 1Q44A 1Z28A 2KE5A 3P26A 1WBBA 2QM8A 2RHDA 2BM0A 2FEOA 4YXWA 4GRAA 3GJ5A 2JASA 1ZU4A 4G3XA 4JSTA 1KI8A 2Q3FA 4AYXA 5JCZA 3DMNA 4PPGA 4LBWA 3QENA 4MGKR 2YWGA 1GAJA 3EIEA 4MKIA 1NVWQ 3O8CA 4NKRA 2GXSA 2DHRA 3KB1A 4TLEA 3N70A 4TLCA 3VX4A 1XD2B 2J1LA 4C9BA 1NBME 1T0HB 4PZYA 4U00A 1NLZA 2JA1A 221PA 3UXMA 2FWRA 4TYQA 2AKAB 2XZPA 1XU4A 3IHLA 3IIKA 5D3QA 3AUXA 3O47A 3K8YA 4HUQB 2C96A 3C15C 3C5HA 4PHTA 5EE3A 5LB4A 5CDFE 4UQOA 3SQXA 2A78A 3RSLA 4TN1A 3T61A 3SJZA 5FOSA 1P72A 4ASUD 4CEIB 4GI7A 4S2EA 2G6BA 2JGNA 2GJSA 1RIFA 3CLVA 1KO8A 3K09A 4EPRA 1ZIOA 2CE2X 2VP2A 2CVHA 3TUIC 2GEDA 3AKDA 3CUEF 2XZLA 1A1VA 3EPKA 3FYHA 4P4SA 2NMVA 3VKGA 4GOJA 5GJVC 3BFVA 4WW0A 3UKDA 2XGJA 2DFNA 1W0JA 2XNSA 3FKQA 4RD0A 3EARA 4M9SA 5HCNA 4L5BA 1YZQA 1P3JA 1UKZA 3L8YA 2CJWB 4BZQA 1OYWA 2V7QD 3A1UA 2WM9B 5EE0A 3WYFA 1R4AA 1OB5A 1T91A 1N3BA 4AKHA 1Z5ZA 1QRAA 4BFYA 4GFDA 3DPUA 4HAXA 4LJ9A 3BFKA 5CLQA 4B3BA 3AKCA 1GSIA 5KHOC 1JJ7A 3ICQB 2P6UA 1PJRA 2VH5R 4URUR 3KQLA 5D3MA 1H8ED 2B8TA 1NN1A 4TL6A 3P4XA 5AJWA 4Q1BA 5KPJA 2DFLA 1Z3IX 1ELOA 1W4BA 4PZLA 4BLSA 4C0QC 4P33A 1II8B 3OE7A 4JLMA 3WP0A 1TTTA 1R10A 4U7DA 2PZGA 1GRRA 4UNRA 1EX6A 2VL7A 4JKYA 1K5DA 2O8DB 2ZI5A 4GSYA 1LTQA 1AS0A 2IX3A 1RYFA 2WVJA 1P2UA 1ZM2A 2QTHA 3BE4A 2C8VA 3I73A 4L9WA 4M9ZA 1G16A 3LX8A 2XB2A 1DPFA 1XBTA 2QTVB 3NEYA 4M1SA 5SZIA 4MYCA 3QE0A 4V03A 2IXFA 1E9RA 2QENA 4NHOA 2REXB 2GZDA 2QMOA 3LBNA 4TMZA 4Z8XA 1KAOA 5JZVA 5C4MA 1UPTA 1YVDA 2J3EA 4DBLC 2YKGA 2GWHA 3H2YA 1ESNA 2A5YB 2QM7A 4KJZA 3I61A 2OXCA 4TQAA 2LKCA 4QL3A 5AWFC 1TQDA 4B43A 2E87A 5H68A 3H1TA 4DCVA 2QN6A 4LHXA 4L16A 1CBUA 4LJ4A 4ZKDA 1FUKA 1DELA 1GITA 2Q3HA 1AKEA 2CBZA 4DUGA 1JQLB 3CW2A 2ZRFA 4DB2A 2GJAA 1GILA 2C04A 2FGKA 3OEEA 2FDCA 3X2SA 3PITA 3TH5A 1SQ5A 2XAUA 3AP3A 4KYIB 5JEEA 1VECA 1G41A 4B47A 4QNRA 1MT0A 3B5JA 2GCPA 2QP9X 2Q9BA 1DS6A 1OHHA 1UBCA 1P9RA 2XZOA 5CYOA 1ZM3A 2PMKA 2RCNA 3X1YA 3H4MA 3GEHA 4AC9A 4Q9LA 4DSNA 2FZLA 3AP1A 1OXUA 4LBYA 4Q18A 1KI7A 2H57A 1NSFA 3L0IB 2CL0X 4RJLA 2AXNA 1CULC 3THYB 1N6HA 2GK6A 1E2EA 1TPZA 4E5UA 2W2VA 2ZYUX 3WMEA 2HYIC 1F3OA 2WWHA 3SYKA 3C8UA 5GADl 1T4GA 4JT2A 5FL3A 1NY6A 4YMSA 3QOFA 2IYVA 4JLPA 2MSEB 1CF4A 4EQ6B 2LWIA 4MYUA 3LAWA 4FIDA 4XTRA 2F9MA 2WJJA 4BLQA 4B2PA 4B34A 4IDPA 3LXRA 5K8LA 2JLXA 1ZCBA 2AFHE 2ZRJA 4P31A 2BCJQ 5L3RA 4LV6A 5CJPA 521PA 3UK6A 1CJKC 1G8FA 2AKYA 2HJVA 2VYFA 3OF5A 4QGFA 3TSZA 3DM9B 1G3IA 3WNDA 4IXMA 5FI1B 4EFNA 3IPXA 5CIWA 1SULA 1KY3A 1NVXQ 4Q21A 5FUVA 4Z1MA 3GFPA 4IFBA 3L2OB 2OBMA 3BERA 4NP6A 1JQJC 3U5ZB 2J0QA 4I81A 3T1TA 4BECA 1DADA 3OEHA 4TLAA 2KB0A 1KO5A 3DEFA 5HZHA 3WRXC 2AN9A 4NCKA 2V8OA 3MD0A 1NN3A 2WKQA 4TMKA 4G5OA 2QAGB 1DG3A 4PC1A 4QHTA 3MFYA 3ZDQA 1E1QA 4DRZA 1QVAA 1NVVR 4G5QA 4LJAA 4TYYA 1RVDA 4ZO4A 5AJXA 2D7CA 4MUBA 1LS1A 2ZUDA 1RRFA 3T12A 3MJRA 1KI9A 1NBMD 4BFXA 1XMVA 4ACBA 3W5IA 3CX8A 2FSFA 2JJ1D 4M22A 5E7MA 4EPXA 1L4YA 2BMFA 4AYTA 2IC5A 4DCSA 1B23P 5FTMA 1Z6AA 4X8MA 3B2EA 1B0UA 3LWNA 5G3YA 2PMDA 1E3MA 1RJ9A 4MRRA 2VF8A 1FTSA 4IVPA 2CMKA 5FR1A 3PEVA 1YZTA 3MGCA 3AF1A 2XXAA 2F1IA 1TF7A 4Q7MB 4HZUA 4H9GA 3W6PA 1E2JA 1MO4A 2ZETA 4F38A 3GLHB 3CF2A 1LNZA 2ORIA 1WCV1 4XD7A 3I1FA 4LOAA 3F8TA 2J0UA 3A1SA 4XWKA 3QKUA 5JBQA 4IEEA 2HEIA 4Q5IA 4QFMA 2J87A 1I4LD 2WWXA 3CRMA 3UATA 2XJ4A 4QGHA 3VFDA 1YZUA 1UF9A 3A4NA 5FBLB 5FTLA 4EKDA 3VNVA 4U02A 1O87A 3FMOB 4LDJA 3GFOA 3NHAA 4ZCMA 1PLLA 2IYQA 2ZRAA 1OFHA 5CIQA 2SHKA 2C2HA 1L7VC 3H84A 3K70D 4UJ5A 3K0AA 1XEWX 2DR3A 1D5CA 1Q1EA 1RKBA 3KTAB 1E4YA 4HDCA 5JWHA 2W58A 2VP9A 4PO1A 4ITRC 4D4MA 2IUTA 1Z2CA 2OBNA 3SJCA 4A8JA 5LBIA 4D26A 1G4AE 4MQBA 3VR2A 1ZM9A 1W4RA 1XEWY 1YU9A 2GBLA 4NYMR 3LD9A 1NLFA 5L3QA 2HDNB 3DVLA 3FHCB 4BASA 1E99A 1FX0B 5JJLA 4O2RA 3LX5A 5KNCA 1W0JD 1XWIA 5EQTA 1O3YA 4BQSA 1VYUA 3MSXA 2YV5A 3GPLA 5EZ5A 3UPUA 4MH0R 5TXGA 3U61B 1HURA 3SE0A 1W4CA 3MWKA 1BKDR 3LBHA 4JLJA 3TQCA 2JEOA 3EASA 2CK3A 1IJFA 4DDTA 1W44A 2F3RA 4M1TA 4TLDA 1NNEA 2WSMA 2EQBA 3CWZA 3MWJA 1HTWA 4BFWA 4BFSA 4ZIRB 5JSZA 2RKOA 2PBRA 2VSFA 1D2MA 5B2ZA 2IHYA 4ZDJA 3GD7A 2ZRNA 3C41J 1E2GA 3T1VA 4PQYA 4EJSC 4QJ3A 3IIMA 4IHQA 2ZUCA 4XWOA 1D9XA 3OE7D 3Q72A 1XMJA 2FFHA 2O8CA 2QE7A 1GKYA 1KK0A 3S1AB 1ZAKA 4JLAA 4US2R 2VSXA 4M9XA 1G291 1AS2A 2C99A 1OH8A 2NIPA 5JJIA 5FL7A 4GOXA 3B1YA 4AIIA 4D80A 2VLIA 3CZPA 4X8HA 3GLFA 1IN5A 4OQNA 3CONA 2VEDA 3LBIA 2R2AA 3K9GA 4TLBA 3KX2A 4QM7A 4Q4JB 2JLVA 3DMDA 2WJIA 4OQXA 1P75A 1GOTA 5DHAA 4EUNA 5EXPA 5FPTA 5EXSA 5J47A 4W9MC 3FVQA 2IYZA 1MR3F 2HT1A 1KO7A 1N6NA 3BS4A 3C16C 3E70C 4DCNA 4AY2A 1RRCA 2VBCA 1GNPA 3GLIA 1HQCA 1GDDA 5IT5A 3B13B 4DEYA 2BC9A 1ZP6A 2WMNB 2PZEA 2WAYA 4QBFA 1ZU5A 2WV9A 4CW7A 1JPNA 3RRZA 2V6JA 3Q7QA 2GK7A 2NO0A 4N0DA 4C0AC 1J7KA 4PO8A 5FTNA 4CT4B 4DUGD 4NYJQ 3DKVA 1N5KA 2GJKA 2ZJ5A 4Q48A 1EK0A 2F7SA 3OEED 3SBEA 3I8SA 1RYHA 3I4LA 2WMOB 1JXOA 1NJGA 1GKUB 5BW8A 1XD8A 5AUQA 4ZDKA 4P3YA 2GNOA 2JLZA 3H0KA 2IHBA 4JVMA 3AVQA 1G64A 2EFGA 3AF4A 4QJ5A 1ZNYA 4NONA 4XJXA 1QHNA 1XCPA 3HR8A 4HEJA 1OW3B 5CJ2A 5IHPA 1XTRA 4K81B 1AS3A 2MMCA 1XXHA 3PEUA 2ZSBA 1BO6A 4W5HA 2VHJA 1M6NA 2YZ2A 1XTIA 1N0WA 4HAUA 3B1ZA 4IOMA 4BGDA 2REBA 4KBGA 4LUCA 1S9HA 1F2UA 4RD4A 3AF2A 2JLWA 3AEZA 2GCNA 4ZI2A 2FMXA 4Q9IA 1N0VC 4CGZA 1UFQA 3V4FA 2GF0A 1HUQA 3TR0A 2ZYWX 1NG1A 2BKEA 4NTZA 2H16A 4A15A 2KJQA 3U4QA 1T8TA 3SZRA 1OIWA 2XOKA 2PCLA 4R98A 4LK2A 2CCKA 4OHWA 1OJLA 4G5RA 1E6CA 4TL8A 5FPKA 2EU8A 3TUZC 2NO6A 1E0AA 1PLJA 5GVSA 4NCHA 2OXRA 1KSJA 4FMCF 1OKKA 2Z43A 5BQ5A 1M7BA 1T6NA 3K0FB 2H5EA 3VR1A 4URXR 2QP4A 3B1XA 3V9PA 4Z1MD 4HB4A 5J4HA 1Q1ZA 2EWWA 1NMYA 3X1ZA 1EFTA 3EG5A 4EDHA 3SC3A 2AK3A 3RWOA 2OLJA 4EPYA 4JLNA 3M1IA 4JLKA 3WNCA 3OEHD 2W6JA 5HKKA 3HU3A 1OH6A 3TSWA 1R0ZA 1XXHE 3U3KA 3A1WA 5FOUA 5M04A 2NTYC 5E7JA 3EA0A 4TMTA 1HT2E 3ZYCA 5AUPB 4OHYA 3WYGA 1W46A 1A7JA 4B2LA 1U98A 1M1YE 2WWIA 4I4LA 4N0EA 3ZQJA 4KSCA 2IF2A 1E1QD 4TQ9A 3QVUA 2H8KA 1G3RA 1EFUA 1SVLA 3A8TA 4A0FA 3QY0A 4LGMA 1G3QA 1VMAA 1JALA 2EYUA 3B1VA 2GHIA 5TV2A 5IF9A 3FFAA 1QHXA 2GETA 4BRUA 4KFRA 2FNAA 1E9EA 1QF9A 5KO2A 2BWJA 5H70A 3RS3A 4BWYA 3Q8XB 1SVWA 5A0FA 2D06A 3L43A 2HUPA 4V0MA 3SDZA 3LLUA 2QY9A 4PAQA 2IWHA 4BEBA 4B35A 3ND9A 1AZSC 5C4GB 5A4JA 4KYUA 2ZI4A 1RFLA 1OXSC 1XJQA 2ANCA 3NEJA 1IXSB 1FL9A 3O8BA 3D8BA 1SVMA 2IYYA 3MCAA 2P2LA 3A4MA 4TMXA 4QHSA 1F2TA 2H18A 3PUZA 2D4HA 4PTLA 5CYPA 3VAAA 3LLMA 5DSZA 3VR4A 4TL7A 3CX7A 3T35A 2B8WA 1Z8FA 2A7QA 3HU1A 4LYAA 4PSVA 2G83A 2HCBA 1Z22A 2C9YA 2OV2A 4XD7D 4ZDWA 4B71A 3OIWA 5BWMA 3KQKA 1AM4D 2EFHB 2G0NA 3FKSA 4NZYA 2FPLA 5JS8A 3MRSA 3LA6A 5CB6A 1G6HA 3MMPA 3QJYA 5LD2B 3A37A 3IGFA 4DSUA 2WKPA 1KKMA 2PX3A 2YOFA 1KSGA 2RGNC 2RHMA 4PPFA 2EW1A 4E03A 2ZRIA 3KQUA 1VYVA 2GTPA 2AD1A 4OQFA 4Q1AA 1JBKA 1A4RA 4R2IA 4S35A 1U0JA 2F1HA 4V0ME 4JKIA 5DYIA 3TMKA 2ERXA 2FFQA 3JVUA 1KO1A 2VHTA 4NE2A 3NHBA 2A9KA 2V3CC 1VCMA 5FPHA 3CNNA 3SJBA 2FFBA 3GCGA 4HAYA 1T9HA 4QGAA 4MA4A 4I99A 4D6PA 4IRUB 2XB4A 4LX0A 4Q4HA 1RE0A 4AK9A 4H1UA 4MDFA 5HZKA 1EWQA 3BORA 3FOZA 3E1SA 1W36C 1D2EA 2F3TA 4P4TA 1R7RA 3SYNA 3TW4A 2P0EA 2R8RA 2F9LA 4QHYA 3N5CA 1ZUNB 1Z0KA 4HDOB 1MH1A 1CRQA 1N5JA 1FPMA 2P67A 1G5RA 1ZJ6A 2A5FA 2Q9AA 3C14C 3CR8A 3U60B 1OB2A 3CB4A 2E9SA 3A36A 1E9CA 1PZNA 2CK3D 3VR3A 1E96A 3K9LA 3EAQA 3QQ5A 1LVGA 5FUWA 5IK2A 1G5TA 2YC2C 3TE6A 1G9XA 1W2GA 5E7IA 5G41A 3IO5A 3OZXA 4PPQA 5TB5A 4DDWA 3IBYA 1W49A 1G8YA 3FWYA 1F5NA 3L82B 3PUXA 3BB4A 4OQLA 3LQRA 2QE7D 3BK7A 1C9KA 4UKDA 1DG1G 2CNWA 3B60A 3LRPA 5FL7D 4FMBB 5L3VA 3C5CA 1OSNA 1CKEA 2BDTA 3IKJA 4NCNA 1TQ6A 4QJ4A 2CDNA 5DNYB 1CTQA 2QAJA 3QPVA 1P73A 1E1RD 2IYXA 2WWGA 1SXJA 5DH9A 4ZV4A 3AVUA 4R9UC 4RFSA 1E9BA 4MRPA 5JWRA 2IA5A 3WNBA 3N2EA 5EZ6B 1KKLA 2ZI7A 4UXIA 4Q1EA 2NPIA 3BGWA 2HLDA 4HB0A 821PA 1E2PA 4DLTA 2D7DA 2IS2A 5E3HA 3LFUA 3E5HA 3LW8A 3LW7A 1UAAA 3CR7A 2R6FA 2DY1A 2OAP1 4OK3A 1V43A 1LY1A 3RVBA 2GILA 2ZRCA 5KNBA 4LBZA 2QMUA 4AKEA 1Z6GA 1MRNA 1MOZA 3EPJA 2A3RA 4LZZA 4RCYA 2H7VA 4QRHA 2ZI9A 1Z08A 2ORVA 4MKFA 3THWA 1JR6A 1Q22A 2RGEA 1P62B 2YOHA 2WPDA 5L3SA 2NO9A 1IN6A 4OJQA 1E79A 1GIAA 1WRBA 2JATA 1NG9A 3AVXA 3HU2A 3PUVA 3AVTA 4KFTA 1FP7A 3WP1B 2VHCA 3EW9A 1VCOA 4B2IA 1Z63A 1SKQA 1W5TA 5GJBA 2QZ4A 2X1VA 4PFSA 1SZPA 3U2QA 3F0TA 1NMZA 3PG5A 3THXB 3NC1C 1SXJE 4FN5A 1IOZA 4Q19A 4PX9A 1RJ9B 2LCFA 3UWOA 1XEFA 2DFKB 2ZE8A 4M8NE 1ZIPA 3QG5A 5KOYA 3CRRA 2XXAB 4LWZA 2FX3A 2O8EA 1US8A 5KDOA 1FQJA 1N5IA 1XPRA 4V0LA 3PEWA 1DAFA 2R9VA 1HV8A 2AK2A 4HAWA 4LPSA 2NG1A 3QNUA 4CEHA 3KQNA 1JEEA 3HP1A 2CL6X 3EZ6A 3QF4A 2XOKD 1G4UR 1KGDA 4C2UA 1Z0DA 1EESA 3KJHA 3PV0A 2QMHA 4GNKA 3M6AA 1AGPA 5KDDA 3PUWA 1FZQA 2BMDA 2HXSA 4M0LA 5HE9A 3WHLA 1T8UA 3ETLA 4GMXA 1OKKD 1GM5A 3GLGA 2PEZA 3T1OA 4JL6A 621PA 4FMDB 3BBPA 4QBIA 1TF2A 3K0AB 1J70A 2YINC 1NF3A 3Q9LA 2F43B 1S8FA 1VHLA 3ZLJA 3RRMA 2WJGA 4RD2A 1JECA 1GZSA 1KI3A 1G7TA 5CK5A 2X2FA 2W6JD 5HKKD 2ZXUA 2ZSAA 5EUMA 3TR5A 1CJMA 4FXPA 3I3SR 2D62A 4JL5A 4D81A 1IAQA 4DT1A 1Z2AA 4N1AA 3NTUA 5CM9C 4FCVA 5L3QB 4A36A 2X8AA 1ZNZA 1GKIA 4EPVA 1UEIA 2BM1A 4YLGA 4D2IA 2OAQ1 4A2PA 2W0SA 2Q3MA 1KSHA 4JBWA 3NBYC 3QKRA 2CLCX 1TNDA 4RZUA 1MO3A 1G18A 2C5LA 2OG2A 3P1JA 5HCIA 3NDBB 3RWMB 3TVTA 2W2XA 2G1JA 2CHVA 4LHYA 2ZJ2A 3DM5A 1NSTA 4IW3B 1E2IA 2XNDA 3B9PA 4YMWA 4BPBA 3G0HA 1DAEA 2VSOA 2IW3A 3CPHA 3CNOA 2AFIE 2BKUA 3HPRA 2PT5A 3LVRE 1Y3AA 4C4PA 3GLGE 2IS4A 3DZDA 5JSZB 1VKJA 4V0NA 5BXQC 2AX4A 2CLSA 4IKEA 3ADKA 2RMKA 4LY6A 2AR7A 4IDOA 3FHTA 2ZUBA 2IUUA 5F3WB 5FOVA 4TT3A 3CM0A 3CPEA 4NPHA 2ZQ5A 1E98A 1T3SA 2XEXA 3NDPA 1TAGA 1LW7A 4CEJA 4E07A 1NRJB 3AQ4A 4D0NA 2B92A 3NBXX 3B7GA 3OIVA 5C1BA 2ZRDA 2MSDB 2ZANA 2ZS8A 4CRWB 2GXAA 1P60A 121PA 2B6HA 1GUAA 2I3BA 1N6OA 3FKSD 5KDLA 2ZM5A 2YHSA 4NH0A 1GL9B 1PLKA 1R5BA 2HF9A 5J5CA 4F4CA 3QI2A 3U7FB 4PQFA 4LJ7A 3O8DA 2NPFA 3ZGXA 1FNMA 2WOJA 1XNJA 2ZRKA 3RYTC 1CJTC 4EJSA 3I32A 1CLUA 3K0EA 5FH9A 4D0LB 3TQFA 4IEIA 3X1DA 2ORWA 3CPJB 4G01B 4Z54A 2OE2A 2ASEA 3BOSA 4QNMA 5FPYA 3PVSA 3SFZA 2OT3B 4D4LA 5FFMA 3R8CA 2IEZA 3U3MA 4Q4AB 4TMVA 2BEKA 3OAAA 2GKSA 3KKQA 1NLYA 2P3SA 3KFVA 1IJEA 4MRVA 5DLQC 4OI0A 4QBGB 3AF0A 1GTVA 1HQYE 2Z5FA 3UIEA 2W2TA 1VIAA 3D6TB 4B32A 1WMSA 1TMKA 1COWA 3K09C 4MITA 4XIGS 3BXZA 4W5JA 2G77B 4JVSB 5B30A 2XSZA 3VHLB 4C0HA 3NBFA 1GG2A 1R0XA 3EWSA 4LHWA 4U5XA 1XX6A 2R62A 4HB3A 3EIQA 1KJWA 1U8ZA 2MSCB 5JLJA 4IFEA 3I5YA 1XD2A 2OILA 3AGQA 4QKQA 1XXHB 1DARA 1I2DA 1XEXA 2X19A 4POAA 4ZDIA 2BBWA 2AWOA 1J2JA 4KFSA 2PCJA 3RS2A 1TU4A 5IK2D 1P7CA 1E69A 1SHKA 1ZM4A 3BB1A 2XTNA 4M1WA 1K5GA 5JHGB 3ADCA 3THOA 1F2UB 1E2DA 2BOVA 4KXFB 3JZMA 1WE2A 3ZS9A 5KSZA 4DDVA 2ZVPX 3B85A 3NIBA 1KOFA 4L8GA 3Q5DA 3NXSA 5AJVB 4BRWA 1EG7A 1G19A 4PHGA 1F48A 1N6KA 3AP2A 5K8TA 1VHTA 1KDTA 4GBMA 2CNWD 1HT1E 2QPAA 5UKDA 4AKGA 4KODA 3IDQA 4V0KA 1DAMA 1KZGB 3MG9A 3CKLA 5HE8A 2GCOA 1LFDB 1KAGA 4P32A 3U44A 1SXJD 1W48A 1CEEA 2EFEB 3EZ9A 3IHWA 3RABA 4MRNA 2VIIA 4OHZA 1GNQA 3M4YA 2ZI6A 3AGPA 2ZYTX 1R8SA 2HLDD 3AVWA 1ONBA 2Z6VA 1D6JA 5C46F 1X8LA 2FH5B 2OZEA 1XZQA 3KB2A 4QBHA 3TLXA 5JS7A 3ZS8A 5AK0A 2YC4C 2P5SA 4L9SA 2CHGA 2ZRLA 4LRWA 1KTVA 1UADA 1II8A 3X1WA 2V4ZA 3ZD7A 1W47A 4WZ6A 4URVR 2GZHA 4LV8B 1X8KA 5DN6A 2O8DA 2NO7A 1P2VA 1H8HA 2ODNA 2GA8A 1YZNA 4CVNA 2WPDD 3IEUA 3REFA 2WBLC 1YRAA 3GEEA 4DLZA 1E79D 1NL3A 3P27A 3DDCA 4P0TA 4TMWA 2QBYB 5F98A 2RGDA 3KXKA 1PV4A 1GP2A 2FSIA 1W7AA 2X2EA 4HZIA 2Y8EA 3SJAA 2OCAA 5J4LA 2OCPA 2WICA 2ZE7A 1JB1A 5DI3B 4NU0A 4ACAA 3TUJC 4BEJA 3R20A 2CL7X 2ERYA 2KI5A 4F4JA 4R2HA 3RC8A 1F2TB 1ZBDA 3TAHA 2F1RA 4FW9A 2WJVA 2OEPA 3WBKA 1KI1A 1DOAA 4F93B 2Q21A 3F5FA 1NVVQ 4JLVA 3BJIC 5AUNB 4C7OB 2FA9A 4JS0A 3KQHA 1QHSA 2ZEJA 1TQ2A 1E4VA 1DTSA 1CR1A 2D2FA 4HLUC 3ZZ0A 5EP1A 1KDOA 4URWR 2WWFA 3FHOA 2F1JA 3GP8A 1FMLA 1EFHA 5FOTA 1MRSA 3TBKA 3PR1A 3HYTA 5J4YA 2G88A 4OI1A 3RS4A 3V4RA 1G21E 4LV5B 4X8OA 1HH4A 2VP5A 4AKIA 4DHEA 1DO0A 1T3LA 2ZU0C 4HSEA 3ASYA 1W0KA 4KBFA 2D2EA 1HE1C 4X8LA 4GZLA 4DWJA 1E1RA 5JRZA 3Q3JB 4BLRA 2ZJ8A 3QIAA 5LDDC 3T1QA 3GJXC 2W0MA 4YONB 4B76A 1SGWA 3PQCA 5AR1A 1Z07A 3LV8A 1EFRA 3PENA 2KBFA 3AB3A 2DWQA 1PUJA 2AL7A 5EP3A 2ATVA 5JHHB 4EQ6A 4V0OA 5FTKA 1R0WA 3AKYA 2VPPA 3IBGA 3CRQA 2KSQA 2ZTSA 5EXXA 4ON9A 3M0EA 1DAHA 1RC8A 2RGNA 1N6LA 2FU5C 4QXAA 5JCPA 3KL4A 1R0YA 4I1OA 3PXGA 4C2TA 2N42A 1E0JA 1Z29A 4YMVA 1HYQA 3LDAA 5EP2A 2OCYC 5KSYA 3OIUA 4ESHA 3U7EB 1R8QA 2VQSA 5F9HA 2V6IA 4K46A 1OH5A 2XNDD 1FMJA 1QHHB 2PLRA 2F55A 1SVKA 1G17A 5J4KA 3GLFE 3A1VA 2OESA 1CP2A 1W5SA 4XOIA 4W5WA 5JI3E 1VYTA 2WZQA 4LYHA 4KLNA 1XP8A 1NN5A 1IONA 1VIYA 3EPLA 4Y0VA 1Z0JA 3GJ3A 1W1WA 4J0QA 4NYMQ 2VHUA 3VR6A 2WSSA 4FMDF 2FF7A 1U8AA 4TT3D 2LKDA 4RKFA 3RAPR 1YQTA 2CE7A 4NYIR 5EUQB 4YQFA 3GLIE 1ZVQA 3RS0A 5JWOA 3EZ2A 3LNCA 4E22A 3LO5A 4PC2A 2ZREA 4PC6A 1SXJB 3QF7A 4PC7A 3HJNA 5AJZA 3UMSA 4A0HA 1GWNA 5CM8B 1TUEA 4RFSB 4GP7A 5TY0A 1IXRC 2OO7A 4B3CA 1E2LA 4TYWA 4KV9A 3X1XA 4JT4A 5G40A 1RRGA 1ZYUA 2O0KA 4KU4A 4UNPA 3R7WA 3K70B 2FPMA 3IEVA 2QP3A 4EAQA 1JXMA 2ZI3A 4Q1CA 4NBSA 5L8VA 1KK1A 1OFUX 1TEXA 3CX6A 1EXMA 1AA9A 3DHWC 1KMHA 1A2KC 3PFIA 4DLSA 4JZKA 1E0SA 1A2BA 3OAAD 2HV8A 2QRNA 3THWB 4URZR 2YVUA 5B64A 3W3AA 4ARZA 4P4SB 4GT1A 4BZPA 2ZRHA 4KVAA 3GLHA 4OJKA 4A2QA 2ZR9A 4JJZA 2DFTA 4TWZA 2W00A 1COWD 3L0OA 4XVUA 3QKSA 3OIYA 1VCIA 3K0CC 1KDRA 2XSZD 2ZR0A 1YZLA 4NL4H 3EXAA 1HEIA 3J81k 3W8NA 3A1TA 3NC0C 3FMPB 5DGXA 1RW4A 4ILEA 8OHMA 4LC0A 2DYKA 2IL1A 4BLTA 2ZRBA 1DE0A 1KZ7B 1DBSA 3LH5A 3QXCA 2BJVA 1NN0A 1UBGA 3ECCA 3ADBA 1BYIA 4M1MA 1RZ3A 1YHNA 3KKOA 4HLDA 4Y0AA 721PA 1GRQA 1XCGB 5DE3A 4GZMA 4M9QA 4Q9JA 2O8FA 1Z06A 1SVOA 1US8B 3BIFA 5D3MB 5SZKB 1FUUA 2YWHA 1JR3D 5EE1A 5LB2A 4ESVA 4GP6A 2NO1A 2WTUA 2OLKA 4EPWA 3I72A 4Q9KA 1KYIA 1VG9B 2PH1A 1AN0A 1VDZA 3P4YA 4Q1FA 4KFUA 1FX0A 5A5GA 1KIMA 2HCJB 4GMDA 2ZS7A 2IT1A 5EE5B 1Z6TA 4LI0A 1WB9A 5ANRB 3BWDD 2BCGY 2ZVQX 5CK4A 3GLGB 4LYJA 1S4QA 3SQWA 1Q1QA 3K53A 4WOPA 1OF1A 4TYPA 3SN6A 3W8RA 4F7WA 2WWWA 5C18A 2HYDA 1U0HC 3REGA 1U99A 4MGIR 2FSHA 1CU1A 1QZXA 1QVRA 1IBRA 3GJ8A 3IIJA 5H1YA 1UBEA 4MKHA 5G53C 4ZIRA 2YJTD 4Q7JB 2RGCA 1EFCA 1G5PA 3QG1A 4HYYA 4US1R 4Z51A 2KWIA 2ZSDA 4B44A 4BE7B 4DSOA 2QNRA 2OFXA 3OFNA 2ZROA 3SNHA 1BOFA 1MKYA 1AQUA 3RDPA 3S1AA 3VMFA 3KUCA 3UG6A 2GVDC 1Z47A 5DN6D 2C9CA 3AF3A 1G6OA 1UDWA 3QVVA 1F60A 4RVCA 2IUSA 4XTCS 1H8HD 2R44A 1M34E 3WBJA 4G1UC 1JJVA 4HUTA 1E9SA 2IXEA 3CNLA 3CIOA 5FOWA 3UWKA 1V5WA 3NVAA 2WIAA 4Q4JA 4WVFA 1SKYE 5BN3A 1XTKA 3SR0A 1C1YA 4C0BA 2QA5A 2QAGC 2FG5A 1KO4A 4M4SA 1GVNB 3I5XA 4HB2A 1VG8A 4GPTA 3WY9A 5FBWB 3QBVA 4RKEA 3ZZTA 4F4IA 2DCUA 4DIEA 2PX0A 3W9YA 1Z6YA 2QGNA 2IYSA 1U8YA 1VG1A 1Y63A 1OIXA 2JIZD 2ZRPA 2OBLA 1M7HA 3LXXA 4JYCA 1ZC3A 4M2LA 3MWLA 5EXTA 3QSYA 2V55B 1IHUA 1ANKA 1XRJA 3LVQE 4WXPA 2VF7A 1CS4C 3EC2A 4OI2A 2QUZA 5KNDA 1ODFA 5GJCA 1D2NA 1YE8A 2OM2A 2ZR7A 1BMFA 3CZQA 4C0SA 2ONKA 3SI7A 1R5NA 2K5UA 4RY2A 1G8GA 4BLPA 1WA5A 4XVRA 1OXXK 1IN7A 1K6MA 4WIAA 4DLVA 3B1WA 3D7MA 4H1VA 1U9IC 3K9NA 4NCIA 3L0SA 1E9DA 2TMKA 2P65A 2NOAA 2UVQA 3EA5A 2R6AA 2R6CA 4WA7A 2ONJA 1W0KD 3RNLA 3A6PC 3KFXA 1QG4A 5TVKA 2VTKA 3H86A 1OFIA 4L15A 2NZ8A 4CYMA 1N6RA 2B21A 2X77A 3ZVLA 1EFRD 3BD9A 4AYWA 4LPKA 1OIVA 2WHXA 5FOXA 3QBTA 3QEJA 2AHOA 4JLBA 1M74A 3P32A 5BYKA 4Q7KA 1P2TA 1G8HA 2IXGA 1UEJA 1KJYA 2IEYA 3ZIAA 1E0KA 3ADDA 4B33A 1ZD9A 2V1XA 4JLDA 5KTYA 1DVRA 4P4UA 3MUFA 2FN4A 3ONWA 1S1CA 2NZJA 3FTQA 3VU9A 1X3SA 2J45A 4O25A 2QI9C 3LY5A 2C78A 2JLQA 4QM6A 5FBQB 3WRYC 2FE4A 3R8FA 4IVQA 1N0UA 2J0VA 3RC3A 2V9PA 1FFHA 3BH0A 3CRVA 1XEXB 3ZQ6A 4ZI3A 3FE2A 3K0FA 4Q03A 2ANBA 4OK5A 3NH6A 1T5LA 1LV7A 2D74A 3C4JA 4YDHB 4IVRA 3W34A 1A82A 5FBVB 4JBYA 3CH4B 2XITA 2RH5A 2ZPTX 5SZHB 3KUDA 1KHTA 4CF7A 2FSGA 2IF0A 4AD8A 3BRWD 1GL6A 3AVYA 1KDPA 1Q20A 2GF9A 4WAUA 1W36D 5J4VA 2WSSD 3T34A 3AVVA 5HR5A 1TADA 1P2SA 3K0SA 1JAIA 2W6IA 4JIMA 2BHRA 3AVOA 4HZUB 1DAKA 4HLCA 2Q6TA 2GCOB 2O8BA 2J0UB 2PZFA 4G0NA 3SYLA 4A0RA 5TDHA 1ZUHA 3U44B 1CRPA 3EIHA 2QSZA 2ZYVX 1IY0A 1AQYA 4AG5A 3MAAC 2BBSA 4PAMA 1P5ZB 2QPTA 4YDSA 3T5DA 5TMPA 4M1OA 4Z8YA 4PR0A 4TZ0A 1QBKC 4HLQB 4A1FA 1D9ZA 1G7CA 1XDBA 3FB4A 4PQRA 2QT0A 5F2EA 5IRCD 4D25A 4F91B 1G3MA 4QC2A 1I4TD 1H65A 2GVZC 2ZIAA 3ASZA 3FGNA 1C4OA 1FW6A 2W83A 4PZZA 1TX4B 4B3FX 1N5LA 2OFOA 4LJYA 4A8JB 4DLUA 2PT7A 1FOEB 2WIBA 5DO9A 1KK2A 3RLFA 1OPXA 4IOLA 1T0JB 2PL3A 2I1VB 1ZNXA 3HYRA 2QEQA 1HY3A 4Q1DA 3DKPA 4IOKA 1KI6A 3KDSE 1II0A 4AG6A 2PJRA 2GEUA 2WKRA 3SS8A 4KSBA 5KPDA 1ZD1A 1XPUA 5FUYA 1KNQA 1E2HA 4K8OA 2IS1A 1WXQA 1DAGA 1LF0A 1WQ1R 5G3ZA 2BJWA 2UZIR 3RS5A 4UNSA 2A5DA 2GXQA 4MKGA 1S2MA 2BMJA 3DZ8A 4E09A 2PJZA 3CBQA 3AUYA 4FINA 6Q21A 2ECKA 1J90A 2AD5A 1QG2A 3Q7PA 4NCJA 2ZU6A 3VTKA 2FPKA 2BEJA 1UKVY 4RFVA 5FUXA 1UM8A 2G0TA 3VR5A 2G3YA 4FMCB 4LJ8A 2ZJZA 4PAOA 4BFZA 1KSFX 2J5XA 2ZJAA 3MWYW 2O8CB 4DLWA 3TIFA 1XZPA 2WJHA 1SVSA 2J9RA 3MLEA 3G5UA 2C9OA 1TL7C 2JCSA 1SHZA 5DI9A 3GLFB 2OUKA 2GXUA 2RAPA 4KVGA 2JLRA 1WDTA 4FD2A 3QPWA 1K8RA 2JAQA 1TF5A 4HATA 4OKSA 3DL0A 2EYQA 1X8JA 2DB3A 2ZITA 2IYLD 4EIWA 4HI0E 3AKEA 1D8TA 1VPLA 4V02A 2J59A 1Z6XA 2G1KA 1G3UA 2PLFA 4KLZA 1SXJC 2ODEA 4PXAA 3O8RA 1LB1B 1ZD8A 4HLUA 5K8UA 3GLIB 1RPZA 1XCMA 1IY1A 1U81A 1ZMXA 1II9A 4Q02A 2XX3A 4HDQB 1MABA 4GL2A 3NKVA 4IJMA 4JYBA 3B8HA 4PO9A 1GL7A 4OHVA 4B3GA 2NQ2C 4AWXA 4EPTA 3U3OA 3R9WA 3LQQA 3OFND 2N46A 2PEYA 3HPQA 2J0SA 5F9FA 1ZW6A 1PUIA 2JJ8A 4LC1A 4PSAA 4BZXA 1KNXA 3K70C 2G9NA 1YJ5A 4JSYA 3GJ7A 4RZ2A 1YR6A 4TSFD 1E9AA 2D3WA 1XTJA 3GJ0A 5DIFA 2JLUA 3QEOA 5E4FA 2YWFA 4RZXA 3WMFA 1OT3A 2A30A 3GJ6A 1AJEA 5SZJA 1VCNA 1E32A 5KU1A 4O3MA 2Z4SA 4DIDA 2RGGA 1PVOA 1KI2A 1S0UA 3T5GA 1M8PA 1S9DA 1UJ2A 2B7BA 2EWVA 4DJTA 2J7PA 5HPYB 1XTSA 3QXJA 1W36B 2XTMA 3G82C 2JLSA 1U94A 1KK3A 2XJ9A 4KAXA 2HJGA 1TU3A 1XJ0A 2VA8A 4Q01A 2WJYA 2C95A 3SEAA 1N6IA 4HUQA 1NI3A 1YR9A 3RHFA 2ZRMA 2DWOA 4Q66C 1TEVA 2A5GA 3EC1A 4M53A 2IBMA 5KSOA 4US0R 3CWQA 1JR3A 4KI0A 4CEIA 4ERNA 3ZD6A 4C3ZA 3U4QB 3F3YA 1U2RA 5EP4A 1BMFD 2REOA 3VNUA 3OHMA 5IDVA 1AIPA 1NMXA 2GJ9A 4L4UA 4YMUA 5CLLA 4RD1A 3PIRA 3I62A 4BFTA 2YNMA 2CJWA 5GVRA 3R7WB 5B57C 4I1VA 3GFTA 4DC9A 5BN5A 3THXA 1NY5A 1Q3HA 1CIPA 1VG0B 1HE8B 2CCJA 2BVNA 5J40A 1F6BA 3VX3A 1S1MA 2IYWA 1E2NA 2KBEA 1XTQA 1KMHB 2ZJOA 3WXMA 4OI4A 1Q1BA 4FWIB 2P6NA 2H17A 3D31A 5DISB 1CR0A 2OHFA 3NBZC 4ARZB 5LD2C 1G8PA 4YXWD 3FMIA 2Q0HA 3ICEA 1UDXA 4ZKEA 3QPUA 1MV5A 3EWAA 3ZIAD 2FZ4A 2JDIA 3U6BA 4A9AA 4B74A 1NP6A 3QKSB 1R5OA 4IOJA 4A92A 1JR3E 3L0PA 3AVPA 2FOLA 2B7CA 5KYKA 1KI4A 2ZSFA 3TK1A 5JI2E 4RD3A 2FV8A 4NYJR 3B6EA 3IO3A 1Q57A 2UZ3A 2YYZA 4MYHA 1BYUA 1AK2A 4IDHA 1OE0A 1EGAA 1IQPA 1UBFA 4N3NA 5JJKA 4MDEA 2JJ2A 4C0KA 2ZE5A 3RRNA 3SBDA 2O8FB 4Q9HA 5BYJA 3FPAA 3FMFA 3EX7C 2F43A 4O0MA 2AWNA 1ZM7A 2GEVA 4A82A 5AJYA 4W7SA 3UG7A 4LBVA 3Q5EA 3FFBA 4PPNA 4WXRA 2CCGA 1XFAA 1GNRA 1YR7A 2UKDA 4B6FA 3ZJYA 2DBYA 3K0CA 3GEIA 3T15A 1P61B 2JIZA 2F6RA 1BS1A 1L4UA 2W6ID 1Z0IA 3AV0B 2C98A 4TZ6A 4OK6A 5JRJA 3QXHA 1SKYB 4DCTA 2OSBA 1IXZA 3KKNA 3OESA 421PA 1G20E 2IYTA 3ZVNA 2IK8A 2BV3A 4UXJA 3RRYA 3TRFA 1E9FA 1CJUC 3BAFA 4XSHA 3B9QA 4C0LA 3ZVRA 4JVLA 1LS6A 1XMSA 2WAXA 5ELXA 4Q47A 1OH7A 2R65A 1NIJA 2Q9CA 1LF5A 2H1LA 3ND8A 3TSOA 4DLYA 2YOGA 1JPJA 1T3HA 1P6XA 1S96A 3IQWA 4A6PA 1G7RA 1S3GA 2QMEA 3DOEA 4M21A 4Q00A 3KJIA 4I1SA 4M1KA 4MRSA 2CLDX 1P9NA 3THYA 1JNYA 2VO1A 2ZJYA 1A5TA 2QL6A 3K9HA 2VP4A 1KMQA 1P9WA 1I4DD 4NMMA 4A2WA 2QORA 5FPSA 4YMTA 3V00A 3KJEA 4CDGA 1NIPA 5K8IA 4Q4HB 4KHZA 2IWRA 5JMTA 3PUYA 4JJKA 3KZ1E 3CO5A 3U7HB 1DEKA 3L8ZA 4DKXA 5B58C 3CH5A 3BH7A 2DWPA 4WZBE 1NVUQ 2N1BA 1U0LA 4C0JA 1XB2A 3IUYA 1HA3A 4HAZA 2ODBA 4JVNA 3HR7A 4OQMA 3RANA 1YR8A 2GESA 2HT6A 4XSGA 3RSOA 5BN4A 4LJ6A 1WF3A 3PCRB 2C03A 2FEMA 3EZ7A 5FR2A 4CT5A 3TNFA 1XPOA 3FDIA 1L8QA 4QG7A 4Q4AA 1Q21A 4ASUA 4B6EA 5JFGA 5E95A 1OXTA 3GQBA 4TQUS 1EX7A 2OFWA 2V54A 1BIFA 5FTJA 5JECA 4URYR 1Z0AA 1XD9A 4MGYR 4AURA 1NKTA 3IQXA 3C7KA 3KJGA 2O0HA 1E2QA 1G1MA 5DHFA 2V1UA 1OYYA 2CEAA 2GRJA 2QAGA 4ZCIA 1KY2A 2GZAA 2QTFA 4LJ5A 3R9XA 1OHHD 4UXHA 3QXSA 2GAAA 5DYGA 1ETUA 1ZINA 4UJ3A 4C30A 3UMFA 4CIDA 2V7QA 3SFVA 1FNNA 4JMPA 3DO6A 4R7ZA 2ZAMA 1N25A 3WMGA 1E94E 4BLOA 1X6VA 4Q7LA 3CRW1 4DLRA 3NG1A 1AZTA 1KJZA 4B73A 1IN4A 3CF6R 3U6KA 3KKPA 1S3SA 4NDZA 1DO2A 5H8WA 1JI0A 4IXNA 4B48A 1QHGA 3SHWA 3TKLA 2A5JA 4KCGA 2ZE6A 1H8EA 3I8XA 4D82A 2QSYA 2BMEA 4XWAA 1XMIA 3BH6A 1FP6A 2QRZA 2OCBA 4YC7A 1U9IA 1YRBA 4B75A 2YWEA 4MUAA 4OHXA 4OYHA 4XVQA 1XJCA 3VU9B 5GJWC 4FWTA 2VP6A 2L0XA 5AUOB 1IY2A 5EE9A 2ZSEA 3SOPA 2Z83A 1CR4A 5L3SB 2VP0A 4FI3C 3KXLA 3QXXA 3BFXA 4GDFA 1TQ4A 3TJZA 1IN8A 1MO5A 3W3ZB 2XTZA 4A8JC 3U7GA 4FCTA 1CJVC 3EZFA 2GBLC 2Z0MA 5JEDA 1Q12A 3ZVMA 4TTRA 1M2OB 3TAUA 2DPXA 2VHQA 4BFVA 4O2LA 3K1JA 4WBSA 4AI6A 2CHQA 1NJFA 2BBOA 1GRNA 2J7PD 3KKMA 3AM1A 2CVFA 3KXIA 1Q3TA 1OLOA 3UMRA 3DOFA 2ATXA 3SHFA 1W2HA 1U90A 2GJ8A 2EFCB 4MYTA 3T06B 1SVIA 4LCBA 1MO6A 2NGRA 1E2FA 4TTPA 5CITA 5LPNA 1N2CE 4TTQA 2O8EB 4QOSA 2RGAA 2BIFA 3KTAA 4M1YA 3D3QA 4BUJA 2O8BB 4RSGA 3HDTA 2H92A 2O52A 4LHZA 1W4AA 4PHHA 4CEHB 3TW8B 1J8YF 1X1RA 5C2JB 3QF4B 3ZH9B 3WYAA 1QDEA 1R6BX 1UKEA 1AKYA 4TL9A 2QBYA 1OFTA 4B3XA 3VKHA 4XH9B 3EPHA 4RZ3A 1P4SA 4DEXA 4TYNA 3GLHE 4IDNA 1OXVA 4FCWA 2HF8A 1JAHA 5DI3A 3R9IA 4II7A 2MMGA 1IM2A 1BH2A 2R6DA 3A4LA 3NWJA 3Q85A 5TARA 3MJHA 4EFMA 1TUIA 3WHKA 3IILA 4D0GA 2CXXA 1AGRA 1Q0UA 4NYIQ 2ZJBA 4CZ2A 1J8MF 2VRWA 3PJRA 1ZNWA 3RS7A 4ZCLA 4JL8A 3TVDA 1G7SA 2QU8A 4DT1B 4DVGA 4UNQA 4C7OA 4WZAE 1GFIA 3VKWA 1ESMA 2I1QA 1J99A 3N2IA 5FI0B 4DXAA 1E2MA 2RGBA 4DLXA 4I1UA 2JDID 2JLYA 1JEDA 1KI6B 1N6PA 2HXYA 3JVVA 2ZS9A 3B82A 3QUSA 4R71A 5CB8A 2QGZA 2R6GA 1DAIA 2QG6A 3QKRB 3JZAA 3U3RA 2GDJA 4UNNA 4TSFA 1YZGA 4DB4A 4PHFA 1YKSA 2QT1A 2O5VA 1EWRA 1L2TA 4JBXA 3BB3A 3QKTA 1CR2A 4PC3A 5P21A 3W5JA 4A6XA 2A2ZA 3SU8A 1XF9A 4G5GA 4EFLA 1ZCAA 2JJ2D 4A0GA 2WWYA 1OV4A 2QQEA 2IS6A 4D4KA 4DCUA 2EVWX 2E1RA 2ZAOA 2FGJA 3A58B 4RCZA 3VHXA 4IDQA 2FJUA 1WP9A 2GAOA 4G5SA 3HWSA 2QPOA 2J7KA 1X1SA 4LYFA 2J46A 5KSPA 4RD6A 1NKSA 4CEJB 2EFDB 4HAVA 4Q4LA 1WBDA 2Z4RA 4OBEA 5FBRB 4A4DA 1VTKA 3NH9A 2FFAA 4ZPXA 1I2MA 4PANA 1UKYA 1QHIA 3VQTA 3GMTA 2ODWA 4KITB 1FTNA 3GJ4A 4D4JA 1Z0FA 1ZRHA 3CF0A 1YZKA 2P6RA 2IYUA 3PEYA 4BFUA 2RGXA 1NBMA 2J41A 1X86B 3TGPA 1M7GA 4LHVA 4ABYA 1ZC4A 1QHHA 3W6OA 4GOKA 3P20A 2WOOA 2BBTA 4KO8A 1FQKA 1R2QA 4EJSB 2QQ0A 2JJ1A 2O0JA 5HTKA 4DDUA 3IPYA 4OL0A 5CDFA 4LSGA 4F92B 3W90A
chains in the Genus database with same CATH superfamily
2V45A 4YT5A 4ZAXA 1U0EA 4ZPJA 2YVQA 1YACA 2AYZA 1JIVA 3E2IA 3FTNA 1DQSA 1CXZA 2E4VA 5B53A 5GTDA 3RFXA 4B3DA 3U3JA 4KR7A 3BC1A 3UYKA 2VJLA 4RSMA 1XVTA 1GUZA 3FLAA 3ZZUA 4YRSA 3AH8A 3W6NA 1XMOB 1RRPA 3SP1A 3O8OA 4DZZA 1Z28A 4A3SA 2XTJA 2XMBA 2QJTA 3BXOA 3FTEA 2ON6A 4YXWA 1KJIA 4JA2A 3V8VA 2AEEA 4NBUA 3GJ5A 1O6ZA 3TTXA 1ZU4A 3LVFO 4H0FA 2WWVD 4BQNA 1OLUB 2V6MA 3OLWA 4WK0B 3RVKA 5JQGB 3SYRA 2Q3FA 4AJKA 4J4TA 3ISTA 2AMJA 1TKRA 2V6GA 4E5SA 2DT5A 3ENZA 4MYDA 4UEOA 2AX3A 4X62B 2VG8A 3OQOA 2IP2A 4NOMA 4HTFA 5C81A 3WISA 4MGKR 1IZZA 4O29A 1Z33A 3QJ5A 1TM7E 1NVWQ 3MB5A 3TNLA 2RIRA 3BIWA 3DHEA 1VLJA 1ABBA 5IKEA 2J1LA 3EHDA 2EL7A 1NBME 1T0HB 4FGZA 4C9BA 4U00A 1JHDA 1NLZA 2L2QA 3MXOA 1MZPA 2JA1A 3PYMA 221PA 4F0JA 3PX7A 2FWRA 5D3QA 1XU4A 2EKLA 3IHLA 2I2BA 1TW3A 4PHTA 4PG5A 5LB4A 5CDFE 1ONOA 2NQ8A 4OTZA 3T4EA 4Z4HA 1KAMA 5I7AA 3RSLA 4TN1A 3T61A 2QWXA 5FOSA 1P72A 1D07A 2QSUA 2WF5A 4S2EA 4AZ0A 4CEIB 4L0CA 3JALB 1FDIA 3CLVA 3JQGB 3K09A 1ZIOA 4K28A 5EWJA 4EPRA 2G67A 2GEDA 4PAGA 1A1VA 3IKVA 5PGMA 2NMVA 2ZULA 4ZT7A 4A0QA 5DGHA 4QDUA 3BFVA 4OYYA 1U63A 2XGJA 2AE1A 2JGEA 1IZ9A 2BISA 5HCNA 2IOYA 1TK3A 5CLHA 3TQOA 3UHOA 3SS7X 3Q8KA 3MTIA 1P3JA 2JHCA 1UKZA 4H27A 3T94A 5BQPA 2OQVA 4YJKA 1I1NA 1OYWA 1Y8RA 3D9QX 2H85A 2WM9B 5EE0A 5T3UA 3X1JA 5CAEA 1DAPA 1KU6A 4E4RA 2W6OA 5AHWA 4CCWA 2ORYA 1OGYA 4R8KA 5HF9A 4CTJA 3RRBA 1W1IA 2QDXA 2XV1A 4HOYA 4I4TA 4Q12A 1CZUA 4JR0A 1PV1A 3NHFA 4XQEA 1JG2A 2AA3A 1BE1A 4FN4A 1NNUA 1M10A 1SBNE 4AY6A 4P84A 1K0UA 1W5FA 5L6MB 2O1XA 1GSIA 1QH1A 2G5PA 3DE1X 4FS8A 3W4JA 3N0RA 2P6UA 1PJRA 4BMOB 5KHOC 2DAPA 3KQLA 4B7CA 1NN1A 4MKXA 3N0WA 5AJWA 3E9YA 1IVSA 4G0VA 1ELOA 2A7XA 3NUQA 3OE7A 5FKJA 2MWMA 4KC0A 4RIGA 1ZVKA 1PEKE 2WJ3A 4JMLA 1RU3A 1ISMA 3WLTA 3WZLA 2PZGA 5JJBA 4U7DA 2MTBA 3KQOA 2FWAA 1QQ7A 2VL7A 5TR9A 4C89A 5TC4A 2ZI5A 5DM4A 1TECE 5IC6A 1A77A 2R1ZA 2C3UA 3P19A 2OGWA 3BE4A 2P2DA 3C6ZA 1IZ8A 2ERCA 3H83A 2C8VA 1E1CB 1MHTA 4HT3B 2CBXA 1X1CA 2FTKE 2O07A 4AKTA 3INYA 3TM5A 2DJIA 3QE0A 3B7WA 4HQKA 2FN8A 1KEEA 4HGYA 1AV6A 4PRYA 4XJTA 2IXFA 4X6UA 4NHOA 3SLGA 3WLEA 2REXB 4EF5A 2YWDA 2V9ZA 1IHYA 1Y6ZA 3BHNA 3EIXA 3HA5A 2E2WA 3DZHA 3JQRA 3LBNA 1KAOA 3ESQA 3MPUA 4GM1A 4MR7B 3AQIA 4PZPA 1SXHA 3C8MA 4XFJA 2Q8NA 5KYVA 3WSTA 1L7NA 1R64A 1FSZA 1RVV1 3E9ZA 4INPA 4KJZA 3ZU2A 4FFSA 1PCXA 3KPWA 4MMZB 4ZEOA 4L4ZA 2ODPA 4B43A 5ECWA 1H5NA 1SUEA 2M6SA 3F6YA 4OXNA 4TGLA 3ZNOA 3H1TA 4L02A 3IUBA 5FJIA 1BZYA 5TF0A 1VE5A 2P3QA 2X1HA 4L16A 1FUKA 1DELA 3B70A 3JQAA 4LJ4A 4FFBB 4OHRA 5E6SB 3DOOA 3OCVA 1Z16A 3AETB 4MIEA 1EVJA 1PF7E 1Y4AE 1F51E 1RRVA 5F9MA 1L4HA 3CJTA 3CW2A 1I10A 1PG0A 4RHYA 4CLEA 4D43A 1CIJA 4CUJA 1EINA 3CG0A 5IX8A 4EKGA 1NC3A 5HJEA 4KRFA 4NPAA 3PITA 3TH5A 5DXJA 3WXBA 5JEEA 1VECA 1G41A 1I94B 4MV3A 4QNRA 1BU5A 3AFMA 4BS9A 2W2NA 3A1NA 2W4IA 1DS6A 1OHHA 3DS8A 3SCZA 5K0NA 4Q0MA 1Y1PA 4QTTB 2VJMB 3AESA 2WAMA 3G8DA 1M6VB 1KY4A 2ZBQA 3H4MA 4F3KA 2EARA 4KMRA 1OXUA 3LPAA 4UDOA 3O3OB 5AK4A 2QQGA 1MX5A 2AXNA 2J6CA 2VDPB 1DOHA 4KQ6A 5AO9A 3TIXB 1I36A 5IT9A 3ZJTA 2ZYUX 5DFAA 3U4IA 3PGKA 1PT8A 4P54A 2G9UA 3PXBA 4HGZA 5GADl 3CR3C 1BQEA 1JDBB 1KQ3A 3A6DA 5JUWA 5FL3A 3OPNA 1NY6A 2B3DA 2HQRA 4YMSA 4YJ2F 2X8WA 1KEZA 4JDPA 4JLPA 3F5DA 1YOVB 3JWIA 2LWIA 2HREA 1CETA 1EB8A 3AC0A 3RI3A 2OXFA 4FU0A 1HG0A 2E21A 3LXRA 3PQ2A 3T1YB 1ZCBA 4P31A 1K3TA 2R1VA 1U2DC 2Z09A 1ISPA 1R3UA 2WQ6A 4JBIA 2GTIA 3D6AA 1G8FA 3TSZA 3EFBA 3OF5A 1TW2A 3WQQA 4ZOAA 1G3IA 3PNKA 2O23A 3N8KA 3L0DA 2ABWA 2BFEB 4WFKA 5FI1B 4KGVA 5BN4B 3R8XA 5C8YB 1T34A 3ZXIA 5FUVA 2VNIA 4Z1MA 3GFPA 1VE9A 4IFBA 1Y8QB 1JQJC 1R9GA 3U5ZB 4MW4A 4HS4A 4I81A 3T1TA 3OEHA 1L7OA 3WJAA 5JS1A 1FSPA 2R68A 3EW7A 1GUFA 2KB0A 4M76B 3T9DA 4A16A 1KO5A 2WY2D 3NBMA 1LJLA 3W7BA 1KEWA 4EYQA 1EEXB 1RMTA 2HSZA 1KZ6A 2XVXA 4KQCA 2NUTB 3RU3A 3B9RA 1C1DB 3DFIA 1NN3A 1PW5A 1MVNA 1LUAA 1CJBA 5CT4A 1HGXA 2FMIA 3IJRA 3GMDA 2DY0A 4KTTE 5K4HA 4Y9TA 2OHIA 1V11B 4G1MB 4LJAA 1DCMA 3HSYA 5GZ3A 3GA0A 1GZ6A 1N2HA 2QG4A 2XNJA 2ZUWA 3E5NA 3N0VA 3UJ3X 3STHA 3ZQ4A 2D0IA 4J0DA 4MUBA 3PICA 4WNCA 3MCZA 1RRFA 4ZQEA 4COOA 2VH2A 2QVXX 1GKKA 5K0BA 1RI1A 3ZWVA 2D5BA 3U81A 1BN6A 4HD8A 4EATA 4ETWA 1XP5A 2ZT5A 4O08A 4ACBA 3COZA 1XK6A 3CX8A 3DLIA 3LKVA 1U3FA 4KR0A 2RH4A 4JASB 4IIGA 4MV8A 3TLBA 4RJTA 5A9TA 1YNOA 1M9NA 4AYTA 3S2GA 1B23P 5FTMA 1Z6AA 1YT5A 5EPOA 2D0PB 2WSIA 3HO1A 2A9JA 4OMUA 2PMDA 3LT2A 1T9AA 1E3MA 1GKLA 2ZTHA 1AHHA 1J23A 1YASA 2A9VA 3NKFA 4LZJA 1OGJA 5ALRA 3NHZA 1FTSA 4IVPA 1QF6A 2AUTA 5KEIA 2XB8A 4TSRA 4GLJA 2OFFA 1EE1A 5FR1A 4DIBA 2PNFA 3MGCA 1LPBB 2ZYRA 3FOWA 3FNIA 3DFUA 1B6GA 1TVKA 1P7WA 1TF7A 2F1IA 2GX6A 3AF1A 4DFDA 3WGHA 4HZUA 4PS0A 5HZMA 4INOA 3W6PA 7ADHA 4F38A 3CF2A 1CP3A 1LNZA 4ZCTA 4PCVA 4GEKA 1WKVA 1Z5PA 4JUBA 5LWQA 2XEDA 4ZOCA 4BV3A 3F8TA 2ZT6A 5E38A 5J2TA 3A1SA 1W5BA 5IBCA 4XWKA 3QKUA 4BEWA 2FG7C 1H0SA 2ALJA 2PTHA 2QKYA 3IBFA 4QFMA 1NJ2A 4GKJB 3SIXA 3K9FC 1NP7A 3UATA 3DDSA 1FY2A 5CT5A 1WVIA 2XJ4A 4QGHA 3GMIA 1R6UA 5FBKA 1R6DA 2XMDA 2RAUA 5B4TA 2I3GA 1YZUA 3K8OE 2Z2ZA 4GR5A 5FTLA 3PKZA 3FROA 5LSAA 3WICA 2CXUA 1O87A 2D5CA 2PS0A 1EHIA 3FMOB 5I9BA 1ZGBA 3NHAA 1PLLA 4IJQA 2ZRAA 2M98A 4CLXA 4MROA 4RKWA 4D4IA 1IYZA 3I6ZA 5I7VA 1JV2B 4KWCA 1Q1EA 2DR3A 4QDXA 3TPZA 4DABA 1RKBA 2W58A 4PO1A 3MMXA 2WIGA 3G8BA 4I8XA 2WE8A 3HCDA 1PR4A 4K6HA 4CLOB 2VYVA 3DL7A 1QG0A 3U7RA 3QV1A 1MX9A 4ZYUA 3I2HA 3WLLA 5BR8B 3VR2A 2GBLA 1G21A 5DHSA 1CVIA 2CFSA 1GQRA 1OTXA 3EVCA 1E60A 2HDNB 2GBPA 3FHCB 4RK7A 4ZVRA 4BASA 4P2GA 3LX5A 3OZTA 3QRWA 5DEOA 1KEVA 1O3YA 4EF4A 5IWCA 4B46A 4LWPA 1EH5A 1M2KA 2BF4A 1E8MA 2J3MA 2ZB7A 3GDFA 2K2QB 3JQ8A 3L7OA 3GQVA 4MCJA 3ANTA 5EZ5A 1N1GA 3QVXA 4MH0R 1G38A 1GVHA 4FSDA 4DJAA 4NMWA 5KCZA 3SC4A 3GHYA 1I6LA 3MWKA 4Q4DA 2PSDA 5BPFA 2VQ6A 4JLJA 3K30A 1MLDA 2JZCA 3DXFA 3FF4A 4HQRA 4NULA 3TRHA 2VTEA 2B98A 3ORYA 4U9IS 3P96A 4TV9A 3PUJA 4KNWA 1FTQA 1EK1A 1O03A 2CK3A 1IJFA 3EIWA 3HY4A 4MUYA 4DG8A 2FX2A 4FLFA 4DA4A 1HT3A 3RCBA 4TLDA 3CSDA 1S3IA 3C3WA 3EH1A 4GMKA 1QWSA 2OZKA 4XSVA 5KKCA 4P0QB 1UL1X 3H2KA 4BFWA 1UZLA 5JSZA 3P4UA 2RKOA 3P71T 3FR8A 5B2ZA 3F78A 2IHYA 4ISBA 5IYZF 4ENPA 4ZDJA 5AW3A 4PQYA 1AGXA 3CGGA 3IIMA 1HE5A 1T1EA 4OGLA 3Q72A 1XMJA 2O8CA 1GKYA 4Y2UA 4JLAA 2L82A 5DWDA 3HDJA 1X87A 1FE8A 4CMBA 5G1NA 5BV1A 1OH8A 5JJIA 1ILEA 4QU5A 4AIIA 5HMLA 4D80A 3CZPA 1JLLB 3A1CA 2NU8A 1IN5A 3RRJA 1Z38A 3BEDA 4DBZA 1MCZA 1PFYA 1WSWA 5KTKA 1N32B 2X0IA 2R2AA 3K9GA 4TLBA 5JW6A 2D2XA 3Q0IA 3HYCA 3TPFA 2BGTA 2YHIA 1L5SA 1QE0A 3DMDA 5E8RA 1I2AA 5F52A 5BN3B 1P75A 4O63O 4RS4A 5DHAA 2R5WA 5EXPA 1DOZA 3KZXA 4J76A 4CF4A 3DVSX 3FVQA 5JVDA 3Q12A 5HDBB 3KEOA 1KJ9A 1U1CA 2A1IA 4Z0NA 2F48A 1AVTA 3SVZA 3VHXB 2JKYA 1DWUA 2C4MA 3B13B 2OAEA 1OWLA 3NALA 4OFXA 1Q14A 4QD3A 2WMNB 2I54A 4OMDA 3RSCA 1NR5A 2IYAA 2OV8A 5BWCA 5JC8A 3TCKA 4BO7A 3PFGA 4BQEA 2DEUA 4N5HX 5ILOA 3RRZA 4UDXX 5C1OA 3WYEA 5BW6B 4BPRA 3B89A 5AM2A 2NO0A 5EIEA 3N2YA 1J7KA 1Q11A 5KYUB 1RQRA 2VJAA 3JAKB 2GN1A 4UMDA 5CGQB 1PGNA 4R6XA 1R66A 1P0FA 1UKBA 3OEED 4HAOA 3QEAZ 1TAHA 4WBNF 2A84A 1RYHA 3LLCA 1Y7TA 1FTYA 3L6UA 5D6OA 1JXOA 2JIRA 4ZEMA 1D7AA 3BFJA 5FLEX 4BVGA 4B4WA 4ZDKA 4P3YA 1ZK4A 2GNOA 4K9RA 4TVSA 3VJRA 3VR6H 1KRWA 1C8BA 1GG5A 1ZJ5A 1E20A 2ET6A 2FZGA 2IHBA 4JVMA 3JQ7A 5F33A 5CEFA 3KVRA 3LRXA 1BTOA 2LZ0A 2MIIA 3UJNA 2ZIFA 1QHNA 2OORC 2V5VA 5IHPA 1V35A 3OICA 1XTRA 1AS3A 4NJEB 1KVSA 1FVFA 1XOIA 5FYQA 1HDOA 1SUAA 1QIHA 2CZCA 2PZLA 1ORDA 2H4ZA 1CUUA 2X4DA 2YZ2A 3KQSA 5K8CA 2ACVA 2I8AA 3B1ZA 4IOMA 2REBA 1AUOA 4KBGA 4TX1A 3AF2A 4IQFA 3AEZA 4NE9A 4ZI2A 3D6NB 4DF3A 3T9CA 3ES9A 2H2GA 2HJ9A 1IEVA 2ZYWX 3EYAA 2BKEA 1WETA 2A57A 3U4QA 1R16A 1V9CA 3SZRA 3ZDYB 1OIWA 2XOKA 4CIWA 3QA9A 1I14A 1L5YA 1MJNA 2CCKA 3WGZA 1FS6A 4ZK6A 4AO6A 4TL8A 2MSNA 2NU9B 1XJWA 2VXCA 3OSUA 4PG8A 4NCHA 5CCDA 1ADGA 4E4YA 2OXRA 4J7CA 5BQ5A 2HWUA 2ICAA 1M5RA 5F73A 1J1UA 1T6NA 3F73A 3VR1A 4URXR 3BGSA 2XVYA 1KDZA 5FLKA 4NBVA 3L01A 1NMYA 3WLNA 4I5FA 4KDCA 3W3AH 2XCUA 2IHNA 3DO8A 1M33A 2AK3A 3GAAA 3RW9A 4ZHSA 1X7YB 3RWOA 2FN9A 2OLJA 3OF3A 3M1IA 4JLKA 1EJ6A 4Z7NB 1SIOA 4G65A 4C0WA 4NENB 2WHPB 3GLQA 2IGBA 4MW0A 1XZAA 4LGVA 5FOUA 4U0JA 1G42A 3I9KA 2HSDA 1UQUA 2CXQA 4N8SA 3SMVA 3T7IA 2BI7A 4UD6A 5AUPB 3WYGA 5F7JA 4B84A 1QU3A 4JXXA 1I3MA 5BR4A 3AEKA 4I4LA 1NQXA 2WWIA 1LBSA 5FNZA 2HWXA 3IAXA 2IF2A 4GWKA 5KTRA 1M8FA 2RH8A 4M55A 1NX6A 1QYRA 2DKFA 1G3RA 4WKBA 1EFUA 1MP0A 1CS0B 1L1FA 2VHVA 1HOTA 1TEHA 3IB3A 2VSYA 4JP1A 3DWGA 1BXZA 2ID8A 4LGMA 4YDRA 3PQEA 1LPAB 3IRUA 2BEVA 2EYUA 3N8IA 5TV2A 1P1CA 5THXA 3FFAA 3IXMA 5P8WA 4ZODA 1CUJA 3AR3A 3D1LA 1SG6A 2BWJA 5H70A 3UJ8A 3NRBA 4Y2VA 2VQEB 2Z04A 3PNQA 3QE3A 5KVCA 4E5KA 1Z4LA 4LG1A 2Z9BA 3T3OA 1C3OB 2HUPA 3TLZA 2NYUA 4YREA 3GLVA 4B35A 1KQGA 2I6GA 3ND9A 3SXJA 1JEYB 1KTIA 4LE1A 2PO5A 3P9QA 2PIAA 3I0ZA 1B76A 4G1VA 1RFLA 1RLTA 1XJQA 3PFWO 1C0PA 1FL9A 3O8BA 5TQ2A 1SVMA 5T67A 1NBOA 1M34A 1L5GB 3HRIA 1ZMBA 2H18A 4MQFA 2D4HA 4ZP1A 1AHPA 5DSXA 3U1BA 3IL2A 3LLMA 1IOWA 1GR0A 1HYEA 1TE2A 1ZLXA 2JBHA 2LR0A 3CX7A 4UC0A 3T35A 1X1AA 3T7EA 3WJ7A 3HWWA 2OM6A 4ZDWA 4DLAA 2E4YA 1AQLA 1XZBA 1THGA 1VGQA 2XKBA 3G0DA 4B71A 1DJNA 4QECA 4B5KA 1AM4D 2H5LA 3VC3A 4G4SP 5LYJF 2P1RA 2WMYA 1N3YA 1WB5A 1Z2PX 3VPDA 3QTTA 3MT9A 3LA6A 4HF7A 5CB6A 3QZUA 1PRYA 1G6HA 1EIZA 2FQWA 3KRTA 4ER6A 5JCXA 5LD2B 10MHA 4RM3A 5E1OA 2YOFA 1GA6A 2CSUA 1W75A 1ITZA 2JH3A 4INAA 1VHQA 1G59A 1Y5MA 2EW1A 2IXDA 4PYNA 1E0DA 3IUNA 1C7JA 1ULTA 2GI4A 2GTPA 4CMKA 5C8DA 4OQFA 4Q1AA 1A4RA 3B3AA 3DZKA 2F1HA 3O8QB 1SHUX 1VP9A 1AE1A 2BUAA 3PWSA 2AFHB 1KYXA 2EG5A 5DYIA 1Y1QA 1Z7WA 2ERXA 3WK5A 5KYXB 3PPIA 2VUSA 1KO1A 2VHTA 3JVUA 3DE7X 3NHBA 4GW3A 3U80A 1VJ0A 2QE6A 3LUGA 4I7EA 2Z2XA 2AIRA 2YY6A 1ZGCA 2FFBA 2OB2A 3LL4A 1S2DA 3GCGA 1E62A 3V8NA 4QGAA 3VU0A 4ZGWA 4MA4A 3JARB 3GDGA 1D1PA 4LX0A 4Q4HA 3F46A 3L8CA 2J3LA 4H1UA 3K71B 1V7PC 3JSXA 3WGMA 3E1SA 3B36A 3OQIA 3FOZA 4IIJF 2H48A 4RORA 4YRPA 2PBLA 5F76A 3EPRA 2ZUFA 1XMPA 3TTWA 2WVHA 4FPXA 4YPVA 1H6CA 3N5CA 1Y5IA 3NKLA 3IESA 1FP1D 3D3JA 1MH1A 5B3JC 1CRQA 1BXGB 1G5RA 2A5FA 1FYEA 3H2HA 2Q9AA 2VAWA 3HS3A 3GNLA 3L7AA 2E9SA 2RBGA 1C9DB 2RHWA 2YW9A 3R4CA 3RIEA 1E9CA 1KP2A 3GCZA 1E96A 2NVBA 1PO7A 3HUEA 3K9LA 1EB9A 5ALJA 3ZQKA 4AY4A 5KNDH 1SBZA 3D2LA 3W5AA 5E7IA 1DQPA 1KDYA 4DR4B 1JT9A 2X6RA 3CRNA 1RAGA 2AF3C 3IO5A 3OZXA 4MI9A 4Y30A 4DDWA 3IBYA 3QELA 5ALQA 3T7CA 4KVZA 1G8YA 1G6KA 3BXHA 4R1MA 5DBIA 4ENUA 4IMRA 3QMWA 4JBLA 3G2JA 2CMHA 3MWGA 2W7TA 4MV0A 1CQXA 1PL0A 3R0JA 4CR8A 3EZNA 3HB7A 4E5VA 5JE8A 3MUEA 3DYBA 4GBED 1WHSA 2BSXA 1V3UA 4GUAA 2CLMB 3FPBA 4XFDA 4G09A 4NCNA 4ECAA 2VJDA 5CVVA 4BBAA 2JEYA 2PGDA 3WB9A 3ZUPA 1UP7A 4M9RA 5DNYB 1MBZA 1E1RD 2HFKA 4IX9A 2WWGA 1SXJA 4ZV4A 2A33A 2EEZA 3TQRA 4EP1A 1GO2A 4DREA 1L7BA 5JWRA 5IC5A 1J20A 1P7YA 2O4CA 1CDDA 1R6XA 2ZI7A 2JZOA 1P44A 4YCDA 1HWYA 1ZJZA 3HA2A 3ZXYA 3N2NA 2CDBA 3KXPA 5LZ9A 4FM9A 2HLDA 1L8AA 2XQGA 3DFZA 1H0RA 5DRYA 4ENTA 1TZBA 4BO2A 4IQ0A 5I3CA 3R5KA 1H2WA 3FFWA 3L8GA 1RQ7A 3Q7EA 2DY1A 3L07A 3O2NA 1Y7HA 1SVNA 2FLVA 3A9WA 3G5LA 3IT1A 4NG4A 1J8FA 1NM5C 3UH1A 2QN8A 5KNBA 3AHDA 4LBZA 3BSWA 4K9SA 4ZC1A 5H0IA 2A3RA 4RCYA 4FHGA 1VSTA 4OU4A 5AKJA 1AZWA 1DRJA 3USES 4UVIA 2Q5JA 2ORVA 3THWA 2XQFA 1Q22A 2PX6A 2H5JA 1A7KA 3PFNA 4O5AA 2H65A 5L3SA 4OJQA 3ZIUA 1KDVA 2B8JA 2RHLA 2VZLA 3EF1A 2OKGA 3FUWA 3MYRA 1VBNA 1AO3A 3RVPA 3H2JA 3AVTA 5LOVF 1LNQA 4KO4S 2VHCA 2HBQA 1GQQA 1TA4A 2I80A 1GPWB 3PGVA 4B2IA 3HFGA 3MTDA 1Z63A 4LDAA 4JJ4A 3RE1A 3FPJA 1M2OA 3U2QA 3SQOA 1XK7A 1HDIA 1A8UA 1MJHA 3QU4A 4ZV7A 5BN5B 3DLHA 2RC6A 1QR6A 2FR0A 5DGIA 1VJRA 1CG6A 4FN5A 2Q9UA 1X80A 4GP9A 3WLAA 3FYDA 4PX9A 2YYAA 3W9SA 4DMCA 3QA3E 1ZK2A 4FHZA 5BUQA 4YV2A 2EX1A 3N86A 4ZT6A 4CHTA 4M7WA 2DFKB 4PNPA 4G36A 2PMFA 1ZIPA 2UZ4A 2H3EA 1V5IA 4MLDA 2XE8A 4DNQA 2F2TA 4UTNA 1HSOA 3PXUA 2OWDA 5H80A 4AN0A 4BFLA 1E5TA 2EERA 2YX1A 2WDPA 3AYXB 3E3LA 5ALWA 4EI2A 1DAFA 1Z5GA 2E4UA 2IRWA 2A14A 3AO0B 4KXWA 5TVGA 2AK2A 4HAWA 1RM4A 2OQRA 3ILXA 1UJNA 3GCXA 1NVGA 4HPWA 1QIKA 5EIHA 5IBPA 1AK9A 1GUBA 4EG3A 4RV5A 2G1PA 3ENKA 2CWDA 4MICA 5M29A 4AJHA 3H9UA 3M6AA 3V1KA 5CNJA 1QGAA 3PGMA 3PUWA 2HXSA 3ZE0B 2XR1A 5ETJA 3ETLA 4IHJF 4UUBA 3UGQA 5JZBA 1GM5A 5IKPA 4L22A 4JGIA 1X38A 1USUA 2QVGA 1H3EA 1CB7A 2RBEA 2PEZA 3QVWA 1PKXA 3I39X 5AXCA 2VAMA 4JB2A 2LXNA 3BBPA 4L76A 4W8GA 1OXMA 5AOBA 5HCUA 5DKFA 4BMXA 3K0AB 5B7GA 2AC4A 3CLTC 1HO3A 3U5TA 5HKBA 2F43B 4HPXB 1BEZA 3FSGD 3ZLJA 4UBOA 2R84A 2BM9A 4RD2A 2IKSA 3O2JA 3R3SA 4LOJA 1G7TA 1XQYA 3PP8A 4HC4A 4RS3A 2DPLA 1FFWA 4Y2YA 3TR5A 1Q7EA 3SC2A 2W6MA 1RHJA 1Q6ZA 4FXPA 3ANLA 3QEMA 3PE4A 3LKZA 4J8PA 3CLUD 3VNQA 5CM9C 1NXQA 4FCVA 4A36A 1AV7A 2EIHA 4DUPA 2EEPA 1ZNZA 3KZVA 2Z1NA 3H2IA 5JNTA 3FRJA 4DM4A 2OAQ1 3IR7A 3ZGVA 3RKUA 2W0SA 3EGWA 4BNKA 3BWYA 2UYYA 1KSHA 1X77A 3QKRA 4R1TA 1TNDA 8GPBA 5K45A 3ASUA 1G18A 5HCIA 2OG2A 3LOQA 3E15A 1YDWA 1JPUA 3TVTA 4DR2B 2W2XA 5HEKA 2G1JA 3H99A 2CHVA 4EA8A 1CUWA 5IKXA 2A0FA 1U8FO 4HDAA 4ESEA 5I9LA 2QXTA 3B9PA 1J2EA 3ELYA 3CPHA 2HNBA 3CNOA 1J6UA 3K3PA 1WD7A 2FB9A 1WPGA 3EXHC 3ZS8A 4C4PA 4RETA 4JUDX 4ERXA 1K6IA 3GLGE 2IS4A 3HDGA 3IDAA 3NOQA 1GYQA 3MS7A 4JQOA 4KN5A 4ZJZA 1ESCA 1O08A 1K88A 2CLSA 2ZYDA 2FX5A 1YVRA 3ADKA 1BS9A 4RL4A 1E7SA 1QANA 2D1TA 2PM8A 3DZIA 4ND4A 4WOJA 1ACJA 5DLPA 3RUDA 1JDPA 5EKTA 1NVMB 3LUCA 1PZHA 2ZQ5A 1T3SA 1LEHA 4IV0A 4RPKA 4E07A 4D0NA 3P94A 1K92A 1R12A 1NOJA 1XTPA 3A04A 3WLOA 1OLXB 3IBSA 2IY8A 121PA 2MSKA 1EFLA 3OCCA 1QG6A 3P0RA 4KXUA 2I3BA 4DG5A 3AG6A 3VYRB 4L9AA 1QKKA 4LTMA 5ES3A 4WDRA 4XQCA 1KU0A 1IUNA 4XPIA 2J3HA 1XLVA 2YHSA 4NH0A 2GZMA 1WCIB 4F4HA 4PTYA 5A5VA 5JRDS 1MUUA 3T5CA 3GLKA 4L73A 4B6SA 3GRYA 2JIQA 4BQOA 1VE6A 1CRZA 1XNJA 3PD1A 2QN7A 5JCJA 5CDYA 1YBMA 3EUAA 4N8DA 1Z82A 1RQ2A 4PRKA 3KT8A 3HUFA 2BTEA 2H2DA 3N53A 3AUUA 2VRCA 3WWZA 1GN9A 2A6PA 3M4NA 3CFYA 4MJLA 1IPEA 4D4LA 4Q4AB 4AUKA 2RARA 8ATCA 5A3VA 4QLBA 3OQ6A 3OAAA 2GKSA 1ZN7A 3GF4A 3OZUA 5FHQA 3SIRA 4OI0A 3FJYA 3NGLA 3EA4A 2V0NA 3AF0A 1OREA 4CFZA 2R86A 1HQYE 1C7EA 4WASA 4YXFA 3W78A 3TX6A 4CETA 4HDSB 1OLUA 4MB0A 5JQGA 3BTUA 5FA6A 3II6X 3CVJA 3K09C 2W2KB 4MITA 4BNGA 4F3YA 4XIGS 1KWKA 2DBZA 5JTUA 1KFBB 3E4DA 5BT9A 5BQ3A 2R11A 3Q3HA 1PEAA 4C0HA 1P17A 3IP9A 1DJPA 9ATCA 4LHWA 2WD8A 4HH4A 4U5XA 1XX6A 3QX3A 3WLKX 4HB3A 5JLJA 2A1TS 1VJTA 4A73A 3L1HA 2OILA 3AGQA 2JD0A 2WJAA 5FA5A 3NV7A 1QH9A 4POAA 1HKUA 1E1KA 1ODIA 1DDGA 1CYEA 4OP2A 2HRQA 3GEDA 3NHLA 4EB3A 4F8YA 2PCJA 3KV1A 2NP6A 4WKCA 4X20B 4AW9A 1PP4A 1E69A 3BB1A 1ZM4A 4M1WA 3THOA 3HN6A 2VI5A 3ADOA 5ERYA 4YUWA 5CCBA 5KSZA 4DDVA 2ZVPX 3RQIA 2PKQO 3JALA 1WUJS 3H65A 3O93A 2GN2A 3JQGA 3INGA 4CNQA 1MAWA 3O92A 1KE1A 1EG7A 4MCIA 2H1VA 1ODJA 3AP2A 3HKDB 4HNUA 5K8TA 2EATA 2DQSA 4GBMA 5BVGB 4WGFA 4GEGA 4B83A 1J00A 2C4KA 2IHUA 1RRMA 4N7MA 4U6SA 1BWSA 1D2AA 3M6VA 4V0KA 1KZGB 1SZCA 3MG9A 1H1LB 3PXDA 4J0IA 1X7ZB 3R7AA 4LCEA 1QIFA 1USVA 1KPIA 1CUZA 2EP5A 2GCOA 2XRFA 4JFRA 3O1IC 4PN7A 4XIYA 3DMTA 4ZHQB 3PFKA 2ZBGA 1QK4A 4Y2JA 3RABA 4MRNA 3EAGA 2PUDA 4Y67A 2VIIA 2WWTA 3M4YA 1H1DA 5CDTA 1CNEA 1SCDA 1YZVA 1B8OA 2Q2WA 3AGPA 2QZ9A 3OIGA 1V9SA 3QXGA 4FVTA 1AMNA 1YK0A 4WD3A 3G2QA 1SC3A 4EH1A 4DAEA 1T8PA 2HMUA 5C46F 1XZQA 4QBHA 1QK5A 2OQ2A 1LX7A 3GJSA 1D09A 4JC5A 3ZY2A 1VHDA 3O83A 3Q87B 4B7XA 4M6WA 2CHGA 4G24A 4GX0A 1KTVA 3X1WA 2V4ZA 3SQDA 2J5KA 2GZHA 4ZI7F 3WYBA 4NPCA 2ZTUA 3RS9A 1ST2A 1C8LA 1J9EA 5DT9A 1X92A 4ZC8A 4BCDA 1MH9A 2GA8A 4PLZA 5DBGA 4BUCA 1YRLA 1SKMA 1JS1X 1CIVA 1M0WA 4TLMB 4JQZA 1E1CA 2QBYB 4UU8A 4J7UA 1ZZGA 2BKAA 3KXKA 1PV4A 1LI7A 4JQYA 1HK7A 2DXIA 1W8DA 2I5PO 3IXLA 2QPLA 5K3SA 2LUOA 2X2EA 2COUA 2Y8EA 4IF6A 5DRTA 3SJAA 4E14A 2OCAA 2JAHA 3BIJA 3MELA 4DMUB 5J4LA 2VTBB 3DE5X 1VHWA 5D6NA 2WICA 1U3VA 3G0IA 2VZ9A 2TRSB 2W8BB 5F1KA 3NORA 4ACAA 1B93A 4MR7A 4RSHA 5D84A 5EKSA 3TUJC 2E49A 1L5WA 2DG2A 3ODPA 1TUGA 2I4LA 4DWVA 1ZCJA 4RQBA 4R2HA 3KTFA 2I62A 4LOKA 1OI7A 4FNGA 4HCJA 3HHPA 2JFYA 3DE6X 3NHRA 2WJVA 2OEPA 4FW9A 5HBRA 1C0KA 1DOAA 1JB9A 2Q21A 1DHTA 1NVVQ 3F5FA 2QRLA 3INTA 1KYQA 1H3NA 2FA9A 5AUNB 5I4IA 4C7OB 2TYSB 4FFBA 1WUIS 1O4WA 2ZJ1A 5E6SA 5IJZA 3AETA 3C3BA 4LQDA 3EH2A 4JOQA 1KDOA 5C31A 4QAQA 2IHZA 4E2XA 3O82A 4F3NA 3M2PA 2F1JA 3SAJA 2E5WA 1FXWA 4DKXA 3E5MA 1TA9A 5FOTA 3TBKA 3DO5A 2F00A 1GV0A 4OI1A 1ATZA 1JI3A 1P0QA 2P62A 3OE4A 2GO7A 5CDGA 2AQ8A 5LBUA 1RYDA 2VP5A 3WL8A 5FWXB 3PQFA 5HJ7A 1DO0A 1N2EA 2IIBA 2QUHA 2XKKA 2VJMA 2NVUB 4DWJA 3FTPA 4GRIA 1E1RA 1M6VA 4BLRA 1MIOB 1TRHA 5LDDC 2AVNA 3MT8A 3G89A 1UBMS 2QT9A 1J5PA 1PVVA 1SGWA 1AKUA 2UYOA 5JXHA 3BE6A 3CH6A 1X7GA 1Z7EA 2D8AA 3DONA 1UBUS 2E89A 3PQCA 5AR1A 1R0KA 2O2GA 3GGCA 5AW9A 1HFJA 1L5VA 2PLNA 4J2HA 3LV8A 3D2CA 3DBLB 3W9UA 2JHPA 3TZ6A 5G0SA 2PX5A 4RVNA 2IYOA 4IZIA 4RYDA 2BKVA 1VSVA 4YK7A 1QZZA 3GRZA 1YOVA 1SU7A 2HK8A 1R0WA 2JVKA 3CISA 4DMHA 2VPPA 4RIIA 4JROA 2ZTSA 3C74A 1I6WA 3W5VA 2W6CX 3R23A 1FP4B 3CYFA 4RHXA 1RC8A 2VWGA 2IEGA 4RELA 3KL4A 4GC9A 1KRHA 3WAKA 4XVCA 4RTQA 1XFDA 2CT8A 1DSSG 5DMHA 5F2OA 4EA7A 5BQXA 4K7JA 2Y93A 1E0JA 3U3DA 4BE9A 3F8WA 3HHEA 1K7SN 4JIGA 3U4DA 1WSDA 3KOUA 3ODGA 1IBCA 4W5QA 1R6AA 5DBOA 5C8YA 2H7YA 1R8QA 1I9GA 2AOXA 3CEJA 1JDSA 1JNXX 2C54A 2V6IA 5KX5F 5F9HA 1ZD5A 1UC4B 2OV6A 1PJLA 2XUGA 3L7JA 1SVKA 1G17A 1H2ZA 3GUYA 4NATA 4EENA 2F55A 1CZOA 4HNRA 4Q3OA 1W5SA 1Y8QA 4XOIA 3OFKA 4YCJA 4C1NA 2WYVA 4PRZA 4Q7QA 3SC6A 3AYZB 3Q9NA 1XP8A 3BRWA 4KK4A 3IP1A 3OMWA 1IONA 4BYMA 1BDHA 1V3QE 3JZFA 2GYWA 3GJ3A 4NYMQ 4OJNA 2VHUA 3CO0S 4FMDF 3I1YA 4GPAA 1A9RA 1E92A 1QH8B 2LKDA 2R79A 1CHNA 3P2KA 4Y2TA 1C1DA 2BLLA 1OX6A 4UVDA 4JLUA 1SU8A 4G56A 1TM3E 2UYGA 3KPVA 4OD0A 1NMQA 5AH0A 1UFVA 1ZVQA 5JWOA 3EZ2A 1IBSA 1P0CA 4LXXA 1EXNA 2RHBA 1OA1A 2PDAA 3T6KA 2ZPUA 1G5FA 3UMSA 2V59A 3A4VA 3HJNA 3RFTA 5GONB 4Q37A 4F2PA 4OGKA 3KR1A 4RPIA 3ECSA 4UBKA 4RK5A 1ETHA 2BFBB 2PPVA 5EI5A 4E1VA 4TYWA 4KV9A 1OX4B 4MIYA 4BTLA 4O2AB 4MK4A 3W1WA 4JT4A 5FNVB 3MTEA 1T2FA 2VDRB 1OU0A 3THRA 2ROQA 4ZQHA 5G40A 3PUHA 3CRZA 4C6TB 1LTKA 1DFIA 3JQEA 4KU4A 3RM3A 3KTDA 2H07A 2FPMA