1P5ZB

Structure of human dck complexed with cytarabine and adp-mg
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Structure of human dCK suggests strategies to improve anticancer and antiviral therapy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p5zB00
4E09A 3MUFA 4B2LA 2WKRA 4IKEA 3A36A 3Q8XB 3PXGA 3EZ2A 1XTQA 1RKBA 2ZI3A 3IPXA 4IOJA 4C30A 3PV0A 3RNLA 3TLXA 4A8JB 3AP1A 4RCYA 1T0JB 2BMEA 1ZRHA 2XOKD 1DAHA 2ZJOA 2ANCA 1EK0A 2J59A 5DHFA 3B1ZA 3CUEF 2GJAA 3ASZA 4DIEA 1SXJB 3R20A 4XWAA 5KTYA 4M4SA 3AVYA 2IF0A 1IN4A 2FZ4A 2ZRMA 4Z51A 2ZR0A 4TLCA 2GZHA 2BJVA 1IAQA 1E6CA 4JSYA 4BLQA 3GJ5A 2REBA 3H84A 4WAUA 3ND9A 2QBYA 5JI3E 1SHZA 4PC6A 5CLLA 5KDLA 1O87A 1KI3A 4W5WA 1LF0A 2YKGA 1WDTA 1HYQA 5CITA 4F38A 4NMMA 2HV8A 4UNQA 4A2WA 3VFDA 3W90A 4TSFA 4KFUA 1F2TA 2PMDA 4NCHA 3RLFA 1XPRA 1VIYA 4POAA 2XNDD 1EFUA 1G291 4JLOA 4QHYA 3RC8A 3B85A 4LBYA 4NH0A 4DVGA 3B60A 4L15A 2KB0A 4DLYA 3M1IA 2OCPA 1IY0A 4KXFB 5AR1A 4M53A 1U0LA 3AGPA 3LQQA 1PV4A 4B6EA 1H65A 3KQHA 2IYWA 1TL7C 2QPOA 5FI1B 2FG5A 1E9FA 2WJGA 3K0CC 4TLDA 2OAP1 5AK0A 1R7RA 4BECA 3AKYA 2QENA 4I81A 1W49A 4AKEA 4CGZA 1VIAA 3EIEA 4BRUA 1AN0A 4XD7D 2XJ4A 1A2BA 3LBHA 5IRCD 4A0GA 3GCGA 1NG9A 4DB2A 3Q9LA 2CNWA 4IOMA 4RZXA 4LUCA 4PHTA 2B6HA 4M9QA 1YZQA 4GL2A 1E9EA 4KCGA 2AHOA 1NY5A 3W6PA 1N5LA 3NTUA 3W34A 1G5RA 3FMOB 5JJIA 3SJBA 2HYDA 2QORA 1XTRA 4LK2A 4URZR 1WMSA 2C9YA 2UKDA 1HA3A 3EZ9A 4HB0A 1AQUA 4Q66C 1TQ4A 2GRJA 2ONKA 1T3LA 5CLQA 1F2UA 5FOWA 2NZ8A 2C96A 3GFTA 3BB4A 4US0R 4HDCA 1KMQA 1I4DD 2OLKA 2AD5A 5FBLB 4URYR 5GJWC 3R8FA 1G8FA 1IY2A 4WOPA 2R44A 2H5EA 3SYNA 2IUTA 3FHTA 4CVNA 1PUIA 3BAFA 1N6KA 2GCOB 1N5IA 1TX4B 2ZSFA 1KZGB 1JJVA 4AURA 2WVJA 2F3TA 3KJIA 4R2HA 2QMHA 4F4JA 4LBWA 1W1WA 2G83A 3LNCA 3TAHA 1UEIA 4GBMA 4HDQB 1E3MA 1YR9A 4GOXA 4A6XA 3PUZA 4DSOA 2QY9A 4TSFD 1W44A 2H92A 5FBVB 1G7CA 3MJRA 1CLUA 5K8TA 2D2EA 4DEXA 2GJ9A 2OFXA 1II9A 4IFEA 1P4SA 4FXPA 1TUIA 3WRYC 1E1QA 2BKUA 2QM7A 4C0HA 4XVQA 3X1DA 4PC7A 4ACAA 2VP4A 1M1YE 2ZJAA 3PQCA 4FMDF 4CF7A 4GZMA 2IEZA 4BE7B 1VTKA 2CLCX 1JR3E 4UNRA 2O8DA 1ZJ6A 3WMEA 3GEHA 4NL4H 4D0GA 3LW8A 5E7JA 1D9XA 5FOSA 5FOUA 2R62A 4JL5A 3CX6A 1XFAA 1D2MA 2X2FA 1E0AA 4Q1BA 5J4KA 2C8VA 4ABYA 1DE0A 3ICQB 4L8GA 2IUSA 2AN9A 3P27A 3W8RA 5JRZA 1U8YA 1US8B 1TQDA 3B9QA 4JLDA 2B7BA 3NG1A 3ADKA 1G64A 3LX8A 1NLFA 4RZ3A 4TYPA 2GJKA 4MGYR 4EJSB 4CEIB 4FCTA 1KJYA 3CBQA 4UNSA 2FWRA 2IUUA 3RRZA 3PEUA 1XTIA 1GDDA 3NBYC 2W2TA 2NPIA 4G5SA 1VYUA 4GSYA 4I1OA 4QGAA 4OI2A 4QJ4A 4KFRA 5DE3A 3V4RA 4AKHA 3QPVA 3W3AA 4TMVA 5FR2A 1SVKA 4AD8A 2CJWB 3THXA 1KY3A 1JR3A 1E9AA 3RANA 2JLZA 3RSOA 1Z83A 2J3EA 1AA9A 1MV5A 2G6BA 2C77A 4WW0A 5KNCA 3IILA 1Q22A 1XTSA 2FSGA 4TL6A 3OEEA 4TMKA 3KQKA 2C5LA 4JYBA 2RGNA 2IYRA 8OHMA 2G77B 1E2FA 2C9OA 2YOHA 1II0A 2AFHE 4Z54A 2VSXA 5JWOA 1IOZA 4D0LB 2REOA 3QXHA 3SEAA 4PQYA 4Q03A 4YMVA 1G4AE 2QEQA 2ZIAA 4M0LA 5K8LA 2BDTA 3UWOA 2YC2C 4E22A 4P33A 4BLSA 4FMCF 5ELXA 3DM5A 1E1QD 1NN1A 1D2NA 3GJ4A 1GOTA 2W6JA 2FNAA 3TJZA 3RSLA 4ERNA 3BE4A 3JZAA 5BWMA 1DELA 2F9MA 3GPLA 1Q21A 2ZRBA 3K53A 1HEIA 1ZM4A 4IDOA 4C0QC 1JNYA 2RGCA 3EA0A 4Q4HA 2ZRAA 3FMIA 1K8RA 3TR0A 3KL4A 3CH5A 1AS0A 2VRWA 2QTFA 5JS8A 4TT3A 3TMKA 2NMVA 4MITA 4HLUC 2QT1A 1U0JA 4PPQA 2VSFA 3FYHA 3PG5A 4AKGA 4FCVA 5G3YA 4FIDA 2QAGB 4Q19A 1E96A 1CXZA 3B8HA 4ZIRA 3X1XA 3NBZC 5E3HA 5DYGA 3THWB 1NBMA 2C99A 3K0FA 4R71A 2ODWA 2ZRLA 2GAAA 2ZEJA 1DAKA 3BFKA 4O25A 3OEHA 1VKJA 4TN1A 1XCGB 3K09A 3NC0C 3WBKA 2WWGA 4B73A 1NVXQ 3C5HA 4M9XA 1KMHA 4ARZB 1JR3D 3CWQA 1CTQA 3BC1A 1G3MA 2P5TB 1DAEA 5EUQB 3SNHA 1KI7A 2CL0X 4MYCA 4LV5B 3EIHA 4WXRA 3RS7A 1DTSA 5CJ2A 5FUWA 4RZ2A 1W48A 3C7KA 5BN3A 3P32A 5CK4A 5DH9A 1JBKA 1XBTA 1K5GA 1N0WA 2MSCB 3BGWA 4QHSA 3U4QA 3QENA 2O8FA 2O52A 3UWKA 2QE7A 4Q7LA 4OKSA 4V0NA 1JXMA 4GMXA 4LWZA 5AJVB 1OHHA 2NTYC 3A1SA 3C4JA 2EFGA 1TU3A 2SHKA 4LHZA 2FEMA 5LPNA 4RD6A 221PA 2DCUA 1ZCAA 2PMKA 2WM9B 3SN6A 1F60A 2ZPTX 2VF7A 1KGDA 3FFAA 3MWJA 2ZRCA 3QNUA 2W6JD 4OJKA 3LWNA 2G0TA 4BFZA 1NI3A 2MMGA 1HE1C 2CL6X 4KLZA 2D3WA 1KI1A 1Q3TA 2NIPA 1KO4A 3PITA 4RD2A 5DO9A 4EJSC 1T9HA 2OCBA 4EUNA 3QKSA 621PA 3C14C 3NWJA 4D81A 2JLUA 5EXTA 4C2TA 3UPUA 1N6NA 3K70B 2AXPA 4A15A 4H9GA 4TT3D 4IRUB 1P6XA 1OH6A 4BLOA 1XD8A 1FUKA 1J8YF 1GNQA 1U98A 2KE5A 3HYRA 4HB2A 2BBOA 5HE8A 3TNFA 5BXQC 1BOFA 3NBXX 2DWPA 2AWOA 5C2JB 4IDQA 1Z8FA 5J5CA 4QBFA 5DIFA 1N6HA 3PIRA 1MABB 4Q4JA 2NOAA 4EFLA 3FOZA 1K6MA 3FTQA 1DEKA 1OB2A 2EU8A 2G9NA 4M1MA 1CR0A 4PHHA 1G41A 3K0CA 1T91A 3ASYA 5EJEA 5FTLA 1Z5ZA 1W4CA 1UDXA 1N0VC 1IXRC 3P1JA 2GJSA 2Y8EA 2FEOA 4DBLC 3J81k 4U00A 4NCKA 1E79A 4ZDWA 3L43A 4FCWA 3NEYA 3OIYA 4CIDA 3IHLA 2FZLA 3OAAA 4KO8A 4Q9KA 4DEYA 3HPQA 4OYHA 3TR5A 3ADDA 3TUJC 3QVUA 2VF8A 4PZLA 4D6PA 4NYIQ 4UXHA 3KKNA 1QHIA 2QE7D 4LJ6A 4Q9LA 5ANRB 4DXAA 1R6BX 4E07A 2KBEA 4LJ9A 1FNMA 2C2HA 4OBEA 5EP3A 2N46A 4MKIA 3KKMA 3QF4A 2RGDA 3MFYA 1AGRA 5G40A 1VECA 1KIMA 2W83A 2NPFA 1P62B 5JCPA 4XTRA 1G5TA 5EP4A 3TW8B 4RSGA 1E0JA 3CRMA 4NYMR 2GDJA 3AUYA 2JDIA 4KI0A 3K0SA 2OCYC 1TEXA 4ZI3A 4KJZA 2J0UA 2Z0MA 2VH5R 3BIFA 3ZIAA 3D6TB 3CW2A 3ADCA 1NSTA 2XTMA 3T35A 3I5XA 1S9DA 2ERXA 3A4MA 3SZRA 4E03A 4BFTA 4AY2A 1QHNA 3CRW1 1QRAA 2FX3A 2CMKA 2IC5A 1MH1A 3RYTC 3QKTA 3FMFA 1I4TD 3BXZA 4ESVA 2G1KA 2VP9A 4B34A 3AB3A 3WY9A 2RHMA 4NKRA 3ZLJA 3VKGA 1KI6A 2DBYA 2VA8A 5CM9C 3B1WA 4KSBA 3TAUA 2IK8A 3A1WA 2EFDB 2GVZC 3LO5A 5DISB 4KFSA 2IXFA 3AF0A 3FPAA 4B76A 1QVRA 4QJ5A 3QSYA 2YWHA 1U94A 5FI0B 3DPUA 4NZYA 3W9YA 3W8NA 5HCNA 4DB4A 2QP9X 1TQ2A 1W2GA 1RC8A 2A5GA 1E99A 1E79D 1P9RA 2GNOA 5EE1A 4JMPA 3OAAD 2ZRIA 2Z4SA 3WP1B 2Q0HA 2YWFA 4W5JA 5KU1A 2HYIC 1L7VC 5DLQC 2ONJA 1GSIA 4L4UA 5L3SB 4PO9A 3SFVA 2BKEA 5FUYA 3UMSA 3KUDA 3TE6A 2PT7A 4O3MA 4CEHB 4BFXA 3K70C 1XMSA 3AQ4A 1NNEA 3AH8A 5B30A 2OBNA 4OK6A 4ZO4A 3AVVA 4RKFA 2BOVA 2FE4A 2ZAMA 4QBIA 1GITA 2Q3MA 3L0OA 1W7AA 3T1OA 4HUTA 1TNDA 2ZQ5A 1OIWA 5CM8B 1Z6AA 2IHYA 3GJ0A 3R9IA 3ZIAD 1E9DA 1WXQA 1BH2A 4Z1MD 2VP6A 3GP8A 1U90A 1ZIOA 4JJZA 5AWFC 2HDNB 3GJ8A 4IW3B 2ZUDA 4BRWA 3ZGXA 5E7IA 1K5DA 1T5IA 4OHYA 2AWNA 3GLFE 5UKDA 3AGQA 1F48A 2HEIA 1KNQA 1EWQA 1F3OA 4K46A 3VHLB 4IVPA 3A4LA 4NYJR 1XTJA 3SQWA 2REXB 1Q0UA 4HSEA 3IQWA 4DDTA 3Q7QA 1GKYA 1NF3A 3VR3A 4ZKDA 1OF1A 4R2IA 3I8SA 4XSGA 3W3ZB 1FTNA 3VHXA 4Q1EA 4TL7A 1XPUA 4AYWA 4QNMA 4AWXA 1ZM7A 3NVAA 3AKDA 4U5XA 5KDOA 1FNNA 3Q5EA 1XXHE 1ESMA 3G82C 3WP0A 1R0WA 4OHVA 5CIWA 1T3HA 2XZLA 3U5ZB 5JJLA 4DLWA 2GWHA 1W47A 1QBKC 2BJWA 2Q21A 3AVPA 3AKEA 2DYKA 2ZAOA 2GCOA 3GLFA 1YU9A 5E95A 3JVUA 3IDQA 2ZSEA 3TSOA 3WNCA 3MMPA 5FTKA 4BEBA 4NE2A 4KHZA 2B8TA 1BYIA 1KI9A 2JIZD 3B7GA 3OHMA 1XJQA 3NKVA 3K1JA 1FL9A 4QG7A 4B74A 3U3OA 2C98A 1CJVC 3VR1A 4D25A 4ITRC 1KDPA 2FGJA 2ZRHA 1AQYA 2EYQA 3GEEA 2CLSA 1SVOA 2W00A 1TEVA 121PA 2H16A 2E9SA 3ZVRA 5JECA 3DL0A 4LX0A 1U8ZA 3T1QA 4OI0A 1XXHA 2F43B 3GJXC 1YR6A 1HV8A 2V1UA 1E2PA 4N0EA 1RPZA 1SVWA 2PZGA 2DPXA 1G9XA 2ZYWX 2QMOA 4L5BA 1UKVY 4CDGA 2IS1A 4EPRA 1ANKA 1SZPA 3VKHA 4Y0AA 4DZZA 4GMDA 2IS6A 4G01B 2WJYA 1N6RA 5L3QB 3MWKA 1FX0B 4TLAA 2FFQA 3GJ6A 3CO5A 3CF2A 2X8AA 4D4LA 5SZKB 4PAMA 3PR1A 1C4OA 4PC1A 1JJ7A 4QC2A 4H1VA 5AJXA 1OPXA 2YJTD 2O8CB 2MMCA 4EQ6B 4P4SB 4Q1CA 3ZYCA 2CE7A 1OXUA 3U60B 1NKTA 1ZUHA 4EJSA 4CEIA 2J45A 4JLNA 2ORWA 1E32A 3CM0A 1KO5A 1FTSA 1ZM3A 2VEDA 3QBTA 2GESA 3LBIA 4MYHA 1GL6A 5HTKA 3CKLA 2CJWA 2PLRA 3L8ZA 2NO0A 1GZSA 3WHLA 4DT1B 5J47A 3WMGA 3LDAA 3A4NA 3THYA 4BFSA 1OXTA 4DCUA 2VIIA 3L82B 2CEAA 1A1VA 4M1YA 4CRWB 3UXMA 5A0FA 1XEXB 5FTJA 1HQCA 4MGZR 1C9KA 2JLSA 2RB4A 4BLTA 1W4AA 4TQAA 1XJCA 3C5CA 1E2MA 1XPOA 4H1UA 2O8EB 2DR3A 1RJ9A 2PH1A 1YVDA 4QGFA 5JHHB 1E2LA 2ZXUA 3MG9A 4A0HA 3TVTA 1E9CA 1LVGA 2CK3D 1G6OA 1NIJA 4HLCA 4MUAA 4MRRA 4RD3A 5SZJA 4BFWA 5DHAA 2PT5A 2ZJZA 1HT1E 2YZ2A 4PPFA 4B44A 2LKCA 3VKWA 1RRFA 1Q44A 3AVXA 4TL9A 5F3WB 2QN6A 4HYYA 3QXSA 3U61B 2WPDD 3M6AA 4A92A 3NH9A 1E2DA 2XGJA 4FWIB 4BQSA 2J46A 3W5IA 2OBMA 3K0EA 4GFDA 4EPXA 2BBWA 1WE2A 3I1FA 2XX3A 3I5YA 1NN0A 2OBLA 2P0EA 2ASEA 2OCAA 3GEIA 3HR8A 5FOVA 1AJEA 1Z6TA 3OIVA 4NYIR 2EQBA 2ZJ2A 4QBGB 5GADl 3QKUA 1WP9A 4LC0A 5EQTA 3THWA 5FPSA 3ZD7A 1NVUQ 3FKSA 3MD0A 3GLHB 2OXRA 2F1JA 3FWYA 4LZZA 1E1RA 4NDZA 4US2R 1AM4D 5A5GA 2G0NA 1OIXA 1W0JD 5FPKA 2GZAA 2RGXA 5J40A 4B47A 4G0NA 2CXXA 1S1MA 1QG4A 3HR7A 4WVFA 3AVUA 4HAYA 2J5XA 1GAJA 2CVHA 3LXXA 3QEOA 4XJXA 3U3RA 3HJNA 3AP2A 1Z22A 2PCLA 2RCNA 4GRAA 3H4MA 3SOPA 1L4UA 2X2EA 4QM7A 1RZ3A 1UKYA 2PLFA 1Z0JA 1XD2B 2VPPA 1FPMA 2MSDB 4JLPA 3Q85A 3FVQA 1JAIA 1Z2AA 4HEJA 3B1YA 1JQJC 2FOLA 4U02A 3K9LA 1LW7A 1BMFD 1V5WA 4V0KA 5SZIA 4B6FA 3E70C 1HT2E 2LWIA 5TV2A 2XEXA 1OH5A 1EXMA 1JI0A 4WA7A 1DS6A 1E2EA 3I3SR 6Q21A 5KOYA 2ZJBA 1ZMXA 3SJZA 4JIMA 3IEVA 4F4IA 4LYHA 4E5UA 2H8KA 3W6NA 1IHUA 4IOLA 1NMZA 4NYMQ 4ZKEA 4A2QA 2P5SA 4KITB 4JZKA 2WMNB 1FFHA 4HUQB 5TMPA 4EAQA 3K9NA 4D4JA 2GEUA 2J7KA 3LLUA 2ZRKA 3B2EA 1R8QA 1W36B 5JMTA 4PC3A 1OFIA 3PVSA 3AF1A 2CCKA 2QZ4A 5F9FA 1E2IA 2OEPA 3RDPA 3MGCA 3RS4A 3ZVMA 3VNVA 4KODA 1XEWX 2JLXA 4ILEA 3KUCA 3EPLA 3C16C 2HJVA 2ZI9A 3LV8A 2D2FA 2H18A 2C78A 4AIIA 2CDNA 4DLSA 3QPUA 2EWVA 2ZI6A 4A36A 3E2IA 3KB1A 1G3RA 1V43A 3AVOA 5HCIA 5GVRA 3S1AB 2UZ3A 4MKHA 2XZOA 4M2LA 4TYYA 2XXAA 1NG1A 4NPHA 3QIAA 2Q3HA 4A0FA 4JLKA 5KSPA 5JSZA 1UADA 4LSGA 3UANA 1XF9A 1R4AA 3B1VA 2WSSA 1GM5A 2IXGA 5BW8A 2QU8A 3BH0A 4KBGA 3FFBA 1SKYB 1FP7A 2J87A 4JBYA 2YOGA 4JJKA 5EP2A 2ZETA 2W0MA 3I4LA 1E2NA 3TH5A 4DLTA 3EXAA 3VU9A 1F5NA 2NO6A 3CX7A 4KVAA 4RD0A 2DB3A 3PJRA 2JJ2A 4M22A 4R7ZA 1WCV1 3Q5DA 4QXAA 3CIOA 2FF7A 3M4YA 2BCJQ 4CEJB 4A8JC 2IA5A 1E2GA 4HAZA 4CW7A 4RJLA 3QOFA 4LPKA 2A30A 2BWJA 4IDHA 3KQLA 3QVVA 3VX3A 2ORVA 2IYVA 1SXJC 1ZU5A 4RD1A 3QXJA 5E7MA 2GZDA 1PLLA 3U44B 5FH9A 1CJKC 1RRGA 4PC2A 4PTLA 3HPRA 2CNWD 1GKIA 2AKAB 1KO1A 4IVRA 4JL6A 3SQXA 4ASUA 4JT2A 1VMAA 3F5FA 1KKLA 1N3BA 1W46A 3CNOA 4G5RA 1KI4A 5EE3A 4G5QA 4ZDJA 1OE0A 3E1SA 1IN8A 1SHKA 2FU5C 4PXAA 3U3MA 1DO0A 2YHSA 4GNKA 3TSWA 1IXSB 1X3SA 5EXSA 1G7SA 1SKQA 1X6VA 3K0AA 1KSGA 5JLJA 5EZ5A 3TUIC 1U99A 3TKLA 4PQRA 3GJ7A 4U7DA 4NCNA 5F2EA 4NYJQ 5G3ZA 4URWR 5BN4A 1FQKA 2G1JA 1KK1A 3IBYA 3OE7A 1N2CE 2VBCA 3HYTA 2J1LA 3A8TA 4Q4LA 2OFWA 4Q1DA 2KJQA 1R0XA 1ETUA 3LBNA 4IFBA 2I4IA 1IN7A 4TL8A 1G18A 2WSSD 2IWRA 821PA 4TTQA 3L0PA 4G1UC 2ZS9A 5DYIA 2WWFA 4CEHA 4QBHA 3U3JA 3CH4B 1UPTA 1NBME 4Q1FA 3PUWA 4JVMA 1VHLA 2OFOA 2ZE6A 5C46F 3UKDA 2JJ2D 3VQTA 1IN5A 2J9RA 1KI8A 3NXSA 1W2HA 3BORA 1W36C 2VYFA 1OFHA 1OIVA 1E0KA 5DI3B 3MRSA 1KJZA 3N70A 4YMSA 4C4PA 1MR3F 3GLIB 2HLDA 3CF6R 1J70A 4B2IA 4MRVA 4BWYA 2QG6A 1XZPA 1ZD9A 1ZNXA 3REFA 1KTVA 2QRZA 3DM9B 5BQ5A 3CR8A 1OXXK 1RE0A 4Q5IA 2QTVB 2OILA 2DHRA 4IOKA 1YRBA 3LY5A 3EWAA 3T5GA 4PAQA 1ZNWA 1U8AA 4UNPA 4LOAA 2V8OA 1ZM9A 5CK5A 2AD1A 2DFTA 4KU4A 3R7WB 2VP5A 5B57C 1XNJA 4MRSA 1H8HA 2Q3FA 5GJCA 1O3YA 5AJWA 3SYKA 2YWEA 3RAPR 1P60A 4I4LA 4KLNA 4A6PA 2R6DA 2WV9A 5B58C 1CJUC 2QP4A 4PSKA 3IKJA 3EC1A 4Z8YA 3KTAB 5EUMA 3T1VA 1ZUIA 4NHOA 3AP3A 3PENA 3CR7A 3CWZA 4LJYA 521PA 5IHPA 5J4LA 3UG6A 3ZVLA 1RW4A 3OIUA 4GP7A 3OF5A 3UMRA 4MA4A 4OJQA 3OEED 4QGGA 1EG7A 1YKSA 3VTKA 3BOSA 1LFDB 1AS2A 2WJVA 1TAGA 4YDHB 2B92A 4A2PA 5GVSA 4LYFA 1WF3A 2WWWA 4Q4AB 4OQLA 2ZR9A 3I73A 4QHTA 4RCZA 1CR2A 3LQRA 2J7PA 2X77A 1XD9A 2QBYB 2AR7A 1GWNA 3B78A 2D4HA 4QL3A 2JLWA 1T6NA 1Z3IX 4PANA 4M1WA 1VCOA 4MQBA 2F3RA 1Y3AA 2ANBA 5KPDA 4KVGA 1MRSA 3QEJA 1GFIA 2BHRA 2ZJYA 1B23P 1Q1EA 2HLDD 3QXXA 4WBSA 1EFRA 2WIBA 3SBEA 1N6PA 5E4FA 1OSNA 1WBDA 3P20A 3JZMA 2ZU0C 1D6JA 2WAXA 1KY2A 4BGDA 2ZSBA 2YNMA 1P2SA 4JKYA 2BEKA 2QRNA 4JS0A 2W0SA 2OE2A 4LDJA 1TU4A 1YRAA 1I4LD 2IYZA 2ZM5A 3I32A 5L3QA 1FX0A 2GXSA 5JS7A 4X8LA 2F1RA 5TB5A 2AK2A 3FB4A 1NBMD 3RRMA 3SDZA 1UBCA 5C1BA 3OEHD 4TMXA 4WIAA 1DG1G 2O8CA 1LF5A 4Q9JA 2BBTA 2YV5A 3EWSA 4OQXA 3RHFA 4PAOA 4TZ6A 2GEVA 4P4TA 5LB4A 1A5TA 2QPTA 2O8BB 3FHOA 2EWWA 5H8WA 1YE8A 2V3CC 1RFLA 4MYTA 2A5YB 3LAWA 3UG7A 2FMXA 3EASA 1P73A 4TTPA 3SBDA 2L0XA 1XZQA 2AKYA 2W58A 4B48A 5HKKA 1P5ZB 1E94E 2OESA 4QNRA 3DDCA 4HI0E 3H2YA 3KB2A 2VLIA 4M8NE 1P72A 4DT1A 4GI7A 2OT3B 1ZVQA 4O2RA 3DOEA 4N1AA 5IK2A 5K8IA 1T0HB 1CR1A 1Z28A 1OHHD 4DRZA 4C2UA 2OLJA 1LTQA 4LI0A 1HH4A 4LHYA 3CF0A 4OHZA 1JQLB 2OV2A 1AZTA 1XEXA 3N2EA 3HU1A 3ZZTA 3ZH9B 1EGAA 1LNZA 2GHIA 4C0BA 3VX4A 4A82A 5CB8A 3KQUA 5FL7A 1OB5A 1VG1A 2P2LA 4X8OA 4C7OB 2QAGC 1JR6A 4TMTA 1DO2A 1XCPA 2A5JA 1FP6A 2OG2A 2GK7A 3FMPB 4FWTA 3AM1A 1Z47A 2IHBA 4OK3A 3H0KA 4NTZA 1GG2A 4XOIA 5BYKA 1SXJE 2KI5A 2WKPA 1P9WA 1VG0B 4DSNA 1EFRD 5GJVC 5G53C 1E9RA 1BKDR 2ATXA 4HAWA 2ODBA 2D62A 3K8YA 2R2AA 4JLJA 3A6PC 1JAHA 5C4MA 5KHOC 4AKIA 1X1SA 4Q00A 3DMDA 2ZRJA 5FBWB 3IBGA 4PZYA 3ZJYA 1YHNA 2O8DB 3U6BA 5KDDA 5A4JA 2FFBA 2XTNA 2ZREA 2D7CA 2ZE5A 1DAFA 2BMFA 2JLRA 4LY6A 3EA5A 5HZHA 1JXOA 4A8JA 2C9CA 5JRJA 3KXIA 1WQ1R 1UJ2A 1ZNYA 4F91B 3PFIA 2GF9A 1GVNB 4N3NA 4MYUA 3QKRB 1SXJA 1M6NA 4OI1A 4LGMA 3SJCA 3RS5A 4DLXA 1G19A 2ZVPX 4I1VA 1QDEA 1IBRA 2J0SA 1LS1A 2TMKA 3TGPA 3LXRA 2P3SA 1DARA 3SYLA 4L9WA 1D8TA 3BERA 1T5LA 4Q7MB 2WJJA 1N0UA 5FTMA 3THXB 3ND8A 1NP6A 3VNUA 4GPTA 2Q9BA 4ON9A 3ONWA 1KJWA 3R8CA 2WHXA 2ZROA 4JLAA 1KSFX 5FL7D 2JCSA 1ZNZA 2GXUA 3TQFA 1G16A 2JDID 4TLBA 2AFIE 5TARA 3L8YA 5CYPA 3R9XA 3H1TA 2Z4RA 5C18A 1KNXA 1FZQA 2QAJA 3RS3A 1ZINA 1E2JA 5FOTA 4FD2A 4IHQA 5L3RA 3RABA 3ZZUA 2IYTA 1KKMA 1NLYA 2OZEA 4JKIA 2F55A 4BPBA 3WMFA 2VL7A 1N5KA 1MOZA 4CT5A 2QL6A 3Q72A 5F98A 2I1VB 3WHKA 1GTVA 1OXVA 3IEUA 4HDOB 3EPJA 4Q4HB 2ZYTX 2H17A 1SQ5A 1M7GA 4HB4A 4M1TA 3VR2A 4LRWA 3HU3A 3WYFA 1DADA 5JZVA 1GRRA 2KSQA 5EP1A 4DCSA 4DDUA 1CF4A 1ZP6A 1Q12A 2O0HA 3N2IA 3OFNA 1NL3A 2VHUA 3QPWA 2DFKB 3X1YA 2H1LA 1OYWA 4URVR 1SXJD 2ZYUX 5J4YA 2ZS7A 4ZIRB 3EPKA 1J8MF 2ZR7A 1AK2A 1PUJA 1YQTA 4OQMA 4HLUA 4AG5A 2V6IA 1IJFA 3K0FB 5JHGB 1U2RA 4UQOA 3S1AA 4B3BA 1FQJA 2DFLA 5JFGA 1AGPA 3D8BA 3SS8A 2AX4A 1KMHB 1SGWA 3KZ1E 1E4YA 3PUVA 2ZU6A 1LS6A 5P21A 2VO1A 2WIAA 5JWRA 1BIFA 1YZNA 1SULA 1VG8A 4J0QA 4NU0A 1S2MA 3CONA 5FUXA 1ZIPA 1QHGA 2ZRFA 2EFEB 1Z0DA 5L8VA 4QOSA 3UATA 1CS4C 1CBUA 2ZE8A 1OFTA 4D82A 2O8FB 2IT1A 1FMJA 2JASA 1I2MA 4DDWA 3D3QA 1W4RA 1KSHA 3E5HA 1IQPA 4C0AC 4MUBA 3AEZA 2O5VA 1ELOA 3D31A 3EZFA 3QF7A 4LC1A 3WBJA 3T61A 4NBSA 1UKZA 1E98A 4CEJA 1CP2A 4UKDA 3VAAA 3T12A 4A0RA 1SVLA 1J90A 2P6NA 2J0VA 1KK0A 1NY6A 4QRHA 4RY2A 1TUEA 2DFNA 1PZNA 4EPWA 4V02A 2QP3A 3I8XA 3VR4A 2V55B 3DOFA 1GKUB 3O8RA 2KBFA 2RGGA 2ZI7A 4IDPA 4UXIA 4QFMA 3QKSB 4HAVA 4OL0A 1M34E 3NHAA 2VHJA 3KDSE 4GZLA 3IO5A 3AUXA 3EW9A 1US8A 1FUUA 1UEJA 1W36D 2R6AA 1Z0AA 4V0LA 1Q3HA 5FUVA 2RKOA 5IDVA 3U2QA 1OW3B 3O8CA 2XSZA 1LB1B 1TPZA 5EZ6B 4WZAE 2OAQ1 1TF2A 4Q1AA 3DZDA 4Q7JB 4LHVA 1P3JA 2VP2A 5C4GB 3AF3A 1UBEA 4B3DA 2Q6TA 4XWOA 1Z0FA 4P31A 3KX2A 4DLUA 1VG9B 4KYUA 4YC7A 5BN5A 4ZCLA 4YXWA 5M04A 3UK6A 3SHFA 4DIDA 3QG5A 1IN6A 1VYTA 2RGAA 3EAQA 2QUZA 3B1XA 3EG5A 4FINA 3THOA 421PA 2CHQA 2G3YA 2YWGA 4TMWA 2NGRA 1IONA 4DSTA 5KSZA 2P67A 2WWYA 3PEYA 4PR0A 4XSHA 5FTNA 4KBFA 2HCBA 3EARA 3SFZA 4ZDKA 2WWXA 4EDHA 1AZSC 2QGZA 1Z29A 5AJYA 5AUPB 3KQNA 4OHWA 2IW3A 3DZ8A 2FSIA 4PHGA 1G8PA 2JGNA 1E2QA 2YYZA 2EFHB 1D9ZA 5DI3A 2ZRGA 4JVLA 5FFMA 3UMFA 1ZD1A 2XNDA 4BLRA 4I99A 4IJMA 2JA1A 2WMOB 4G5GA 1Q1ZA 1UKEA 2GCPA 2JAQA 2QNRA 4DWJA 1NKSA 4M9ZA 3P26A 4FMDB 1BS1A 3WYGA 1E69A 1MT0A 5FPYA 3CPEA 2F7SA 3IUYA 1VYVA 4XVUA 1TF5A 1S4QA 4MKFA 2QAGA 2QMUA 4JT4A 1NIPA 5JEDA 2GKSA 2R8RA 1G1MA 3IQXA 1M2OB 3R7WA 4EKDA 2JJ1A 2PZFA 2OUKA 1IY1A 5DGXA 3TIFA 2FSHA 4UNNA 5J4HA 2QT0A 3AVTA 3MJHA 1KI6B 3SJAA 1ZU4A 2PJZA 2ZUCA 4HB3A 4ZV4A 2V54A 1YR7A 4ARZA 3KTAA 1QZXA 4Q02A 5CJPA 1GRQA 4XH9B 1TQ6A 1DOAA 1GUAA 4F4CA 1JB1A 1VCIA 2FFAA 2ZE7A 4JYCA 2Q9CA 3EZ7A 4DCTA 2ZSAA 4Z8XA 4YXWD 4B3GA 1VHTA 5F9HA 2WICA 2OSBA 3MWYW 3NIBA 1W5TA 2R9VA 2X1VA 4S2EA 5JI2E 2IYUA 2HF8A 1DVRA 5KSYA 1G7RA 3PUYA 3NH6A 4II7A 4MRNA 2ZJ8A 4Q4AA 4BEJA 2GK6A 1II8B 5JWHA 2RMKA 2V7QA 2BCGY 1TADA 2NG1A 1RYHA 4NP6A 4JSTA 3U3KA 1L2TA 1CKEA 1SVSA 1MO4A 3GLGB 1JPNA 1IM2A 4DDVA 1I2DA 4B71A 1L4YA 4Q9HA 1HURA 1R8SA 1Z6GA 4LYJA 1NRJB 2HT6A 1YZKA 1D2EA 1RRPA 4OK5A 2P6RA 3HWSA 1XJ0A 4FMCB 5D3MB 2XNSA 4GP6A 2QA5A 2G88A 2H7VA 3SR0A 2I3BA 4DSUA 1W0KA 2IF2A 3B5JA 1FOEB 5BYJA 3RWOA 1BO6A 2P65A 3NBFA 1VCMA 4D0NA 4IXMA 5FL3A 4FN5A 4PPNA 4PSVA 1MABA 4CYMA 3TK1A 2CCGA 2JJ1D 2HF9A 3GMTA 3RC3A 1AKEA 4ACBA 4CZ2A 3FKSD 4G5OA 4BFUA 2A2ZA 3QQ5A 1E1RD 2RGBA 5CIQA 2EFCB 2ZYVX 1KI2A 1ONBA 1QHSA 3NDBB 1M74A 3CB4A 2O8BA 1N6OA 1NJGA 2Z83A 4IVQA 5JCZA 5LD2B 1FW6A 4ZI2A 3T06B 2X19A 3BH6A 4M1KA 5KO2A 2FJUA 2PX3A 4TTRA 1JEEA 2F1HA 3F0TA 1PVOA 2RH5A 2XZPA 3BS4A 3O8DA 4KSCA 1Z6YA 1ZYUA 3I92A 4NCIA 1S1CA 4RFVA 2PEZA 4YDSA 3LX5A 2NO7A 2ZANA 1U81A 4OQNA 1QVAA 2JJ8A 2RHDA 3BRWD 3SC3A 2A5FA 1UF9A 2J0QA 3SE0A 2WJHA 1P61B 4A1FA 1XB2A 4CT4B 3CX8A 3Q7PA 4DLVA 2V7QD 2YOFA 3GLFB 3A1VA 4Q18A 2IL1A 1YZTA 2FN4A 4HLDA 4C7OA 1OJLA 4B33A 4PX9A 2JLQA 1S3GA 1XP8A 1WBBA 1ZAKA 2GF0A 1UDWA 4HZUB 4PPGA 1F6BA 2V6JA 4X8MA 5IF9A 2JLVA 3ZZ0A 1NVVR 4TYNA 4YMTA 4YMUA 3K70D 2PEYA 4EIWA 2CBZA 1IXZA 4BUJA 4LBZA 4YQFA 1XXHB 1W0KD 3DHWC 4JVNA 1EESA 3DMNA 1GL7A 2ZITA 1UFQA 4IEIA 5EE0A 4LHXA 1YZUA 3K9GA 1OFUX 5CYOA 2GJ8A 1S3SA 2F9LA 4D80A 2Z43A 4Q48A 3BD9A 2WAYA 5JBQA 3CLVA 4TWZA 3QG1A 1Z6XA 3WNBA 4EFMA 1N5JA 3ZQ6A 3CZQA 3FDIA 4C3ZA 1HQYE 2ECKA 3CNLA 1ZD8A 1MRNA 4PFSA 2GETA 4DHEA 3ZDQA 2BIFA 3FHCB 3GFOA 4M1SA 1PLJA 1QF9A 2WOJA 4LBVA 2WOOA 3QKRA 4LJ8A 4AYTA 5KPJA 5DNYB 1JPJA 4FW9A 1XMJA 3G5UA 3QBVA 4RFSB 3X1ZA 4I1SA 4WZBE 1CIPA 3EIQA 1VCNA 3QE0A 4RZUA 1EX7A 1E2KA 2IYYA 1DAGA 1CULC 2V4ZA 4QM6A 4I1UA 3HP1A 4AYXA 2UZIR 5L3SA 1VDZA 1AKYA 2NZJA 4XWKA 3U7FB 1TTTA 3KKQA 4GOJA 4TZ0A 1J99A 5EE9A 3WNDA 2FGKA 4AC9A 4US1R 2BM1A 1DAIA 1KK3A 4RKEA 5CB6A 1Z08A 1G3IA 1ZM2A 3THYB 3KFVA 3SHWA 3BWDD 3C41J 1R0ZA 1ZCBA 1N6IA 1GP2A 2FH5B 3DEFA 4IXNA 1GL9B 2GBLC 2WKQA 1KK2A 2LCFA 1P2VA 3NEJA 2D7DA 2Z6VA 2FPMA 4JLVA 4S35A 1OT3A 1LY1A 2OXCA 4JBWA 4P4UA 1Q57A 4NCJA 3ZS8A 3K9HA 2IS2A 1QHHB 1RJ9B 2DWQA 3TW4A 2ZUBA 1G20E 2NQ2C 2GTPA 3VR5A 4ASUD 4C0LA 2C03A 3MAAC 2WWIA 5LD2C 3OIWA 3QY0A 5EXPA 3W5JA 3DVLA 4BZXA 4EPYA 4C0KA 5JJKA 3IHWA 4ZPXA 3KJHA 3CPJB 5HZKA 5JEEA 4Q21A 2CVFA 2ODEA 2BV3A 3QI2A 1EX6A 5LBIA 4A9AA 1KZ7B 5DN6A 2IYQA 2XB4A 1CJMA 5KSOA 1RYFA 2A9KA 1Y63A 4F93B 4K8OA 1G21E 2DY1A 2RAPA 2WSMA 1NN5A 3A37A 5TXGA 1E9BA 1A4RA 1X86B 5B2ZA 3LFUA 3OE7D 4WZ6A 2WJIA 3AVQA 1XWIA 2B8WA 4XTCS 3ZD6A 5SZHB 1P2TA 2RGEA 4UXJA 1A2KC 5KUTA 1X8LA 3CRQA 3M0EA 3O8BA 3SU8A 4TYWA 2EVWX 2ZJ5A 3OZXA 3KKPA 4O2LA 1XCMA 1NVWQ 3TVDA 1EFCA 5TDHA 1P75A 1TMKA 3GQBA 1OH7A 1KO8A 5B64A 1RVDA 3KXKA 4D4KA 1DAMA 1EFHA 1NMYA 3PCRB 1G8YA 4LCBA 1VPLA 1G3UA 1L8QA 2HT1A 3D7MA 5EE5B 3KFXA 3FE2A 3DO6A 3T1TA 2V9PA 1F2TB 2VHTA 4G3XA 4FI3C 4PHFA 4TLEA 4DJTA 5CDFE 1M7BA 2YC4C 2VP0A 3IIJA 4LJ4A 2ZRNA 2F43A 4O0MA 1Z2CA 3MSXA 5DI9A 5KNBA 1OV4A 3X1WA 1CU1A 3HU2A 2D74A 2EW1A 4QGHA 4XVRA 4IEEA 1TF7A 1CJTC 2AK3A 2BM0A 2N42A 3LA6A 4JLMA 4YMWA 4C0JA 3CPHA 3HDTA 1XEFA 1CEEA 5HR5A 4Q01A 4M1OA 3WXMA 1GIAA 4LJ5A 1Q20A 1Z0KA 2WTUA 4YONB 3LW7A 3ADBA 4RD4A 4JLBA 4KAXA 1H8HD 3CRRA 2W2VA 3KJGA 1W5SA 3PEWA 3RWMB 4KYIB 3MLEA 2XTZA 4JL8A 1KDTA 1KSJA 1ODFA 2HUPA 4HZIA 4PQFA 1X1RA 1AS3A 3BFVA 1SVIA 5DN6D 3VR6A 4EQ6A 4P4SA 3F3YA 2ATVA 2FV8A 3GJ3A 2HXSA 5CDFA 3N5CA 1A7JA 2ZSDA 3AV0B 4A4DA 2W6IA 4URUR 2QSZA 2ZRPA 2F1IA 1S8FA 4MH0R 1QG2A 2AXNA 4TMZA 3CRVA 2NO1A 1F2UB 2MSEB 2R6CA 1T4GA 5J4VA 3I72A 2XB2A 2BVNA 5FBQB 2AL7A 2PBRA 1R10A 2E1RA 4LPSA 1Q1QA 1HUQA 1UM8A 3H86A 3LVRE 5AUQA 4HAUA 5K8UA 2IYLD 4AI6A 2HCJB 2J7PD 2XXAB 3G0HA 1T8UA 3ICEA 3V00A 3TQCA 1S0UA 2KWIA 3BK7A 4JVSB 4TQ9A 3VMFA 3ZVNA 2WZQA 3UIEA 5LDDC 2O8EA 2I1QA 3C15C 3QUSA 3WRXC 1X8KA 4M21A 5JSZB 1M7HA 1U9IC 3JVVA 1P2UA 4QKQA 4V0OA 3EX7C 5FR1A 2GA8A 3QJYA 3RS2A 3GLHE 4GDFA 1HTWA 1YZLA 2R65A 4W5HA 3VU9B 1B0UA 1R5NA 1EWRA 2CLDX 2GVDC 2BMDA 1YJ5A 5IK2D 2J41A 2BC9A 1D5CA 1J7KA 2Z5FA 1Q1BA 1N6LA 2GAOA 4P3YA 1WB9A 4TQUS 5KNDA 4Z1MA 3I61A 1XTKA 4LYAA 3V4FA 4B2PA 4HATA 4KFTA 3LH5A 2XJ9A 1E2HA 4MDEA 4DLZA 1CRQA 4NONA 1P9NA 1ZW6A 3GD7A 4MGIR 4YLGA 4LJAA 2JLYA 2IXEA 3IGFA 4BFYA 1R5OA 2ODNA 3KKOA 4BLPA 3T15A 4OHXA 1XU4A 2IYSA 2VQSA 1KAOA 3GFPA 3GLGE 2R6GA 3GLHA 2VHCA 4B35A 3MCAA 2W6ID 4MDFA 5HKKD 1J2JA 3NHBA 3EZ6A 2PJRA 2YINC 2IBMA 3U7EB 4W9MC 5HPYB 2FA9A 3ZS9A 2ZTSA 3LVQE 4DCNA 4DUGA 5H1YA 4V0ME 1QHYA 1CRPA 1XX6A 2UVQA 2WBLC 1EFTA 3K0AB 5FOXA 1H8EA 1XMVA 4DLRA 2DWOA 4D2IA 2ZRDA 4B32A 3PUXA 2QTHA 4KV9A 1R5BA 2FFHA 4BFVA 2V1XA 4B3CA 2IX3A 2D06A 3CZPA 1XD2A 3MWLA 1YZGA 4W7SA 1GRNA 2JEOA 1NJFA 1II8A 1SVMA 1T3SA 2B21A 2QPAA 2BEJA 1G6HA 4ZDIA 3BB3A 3GLGA 3REGA 1KYIA 2JIZA 3DKVA 4B3XA 1T8TA 3C8UA 2LKDA 4PO8A 2QQ0A 2VSOA 1G8HA 2ZI5A 5AJZA 4L16A 1CR4A 5LB2A 3TBKA 1G5PA 1XEWY 2EYUA 4WXPA 4F7WA 4V0MA 1C1YA 3AF2A 1E9SA 5D3MA 1GNRA 3RRYA 5H70A 1NLZA 4L9SA 2CHGA 1UAAA 4MKGA 3PEVA 1G7TA 2PX0A 2QGNA 4HUQA 4HLQB 2H57A 1FMLA 1HE8B 3BFXA 1S96A 4DCVA 4DKXA 3B6EA 4TYQA 1SKYE 2GBLA 1NVVQ 4K81B 2OHFA 3TRFA 3R9WA 2ZVQX 1ZC3A 2QM8A 1MO5A 1JECA 5L3VA 3U6KA 3P4XA 2QQEA 4MGKR 2CE2X 4EPVA 4X8HA 3B82A 3BJIC 2QROA 1KOFA 5TY0A 721PA 4EFNA 4HAXA 1KDRA 2OM2A 3T5DA 2GCNA 4AK9A 4PO1A 4DUGD 1OYYA 1NSFA 2HJGA 2ZS8A 4B3FX 1A82A 3CNNA 1H8ED 4MRPA 3U7HB 1YR8A 3WYAA 1KO7A 2BBSA 4IDNA 1WRBA 3NC1C 3EPHA 5FPHA 1IJEA 1PLKA 3Q3JB 2W2XA 4JBXA 4DC9A 1KDOA 3DKPA 2E87A 3BH7A 3U4QB 1AIPA 2GILA 4PSAA 3IO3A 3I62A 4Q7KA 1COWA 2A5DA 3BBPA 2FDCA 3FGNA 3RVBA 5HE9A 2HXYA 4Q47A 3A1TA 4HZUA 2XITA 3SI7A 1DG3A 2GXAA 3KXLA 1RRCA 5KYKA 4FMBB 1E0SA 1XRJA 4URXR 1XMIA 2FSFA 3P4YA 4UJ5A 3LLMA 1R0YA 4LHWA 3IPYA 3U44A 2C95A 1R2QA 1JALA 1ESNA 1UBGA 2IEYA 2QI9C 5FPTA 1HY3A 1Z63A 4Y0VA 3A1UA 1MO3A 3B13B 3NDPA 3V9PA 2CK3A 5IT5A 3F8TA 4C0SA 5DSZA 5AUNB 2CL7X 1QHXA 2K5UA 1G3QA 1GNPA 2ERYA 1KHTA 2XAUA 2A3RA 4LJ7A 4QJ3A 1PJRA 3OFND 1UBFA 2CCJA 2GEDA 2N1BA 3IIMA 1OKKA 2F6RA 4OI4A 2WPDA 4ZCMA 2P6UA 2GXQA 4F92B 1NN3A 4D26A 3L2OB 2A78A 4V03A 3B9PA 4ESHA 4Q4JB 2RGNC 5FBRB 2FPLA 3U7GA 3L0IB 3TSZA 3LD9A 3KJEA 1KAGA 3EC2A 1Z0IA 1ZBDA 1ZC4A 2PCJA 4BZQA 3GLIE 2O0KA 2PL3A 5D3QA 4ZCIA 1XDBA 1DPFA 5AUOB 1OH8A 2IWHA 5G41A 5TVKA 4P0TA 2PZEA 4RFSA 2XOKA 2CHVA 3FKQA 1G4UR 4GOKA 4B43A 1GILA 3T34A 2QSYA 3AKCA 3ZQJA 1OXSC 4B75A 1W4BA 1OLOA 1NMXA 2VHQA 4XIGS 1G8GA 1BYUA 1DBSA 1W0JA 2BMJA 2YVUA 2B7CA 3BB1A 1JEDA 3W6OA 4PZZA 1M8PA 2WWHA 4LV8B 2OO7A 3QXCA 3AF4A 3RS0A 2IYXA 1G17A 3QF4B 4RVCA 2R6FA 1COWD 3A58B 2NO9A 3O47A 2VTKA 3AVWA 1WA5A 3TUZC 3LRPA 4BASA 3X2SA 1E4VA 2IS4A 4OQFA 3IIKA 3GLIA 2QMEA 4LV6A 1MKYA 1S9HA 1ZUNB 5EXXA 2FPKA 1RIFA 1P7CA 3ECCA 3L0SA 4GT1A 3RRNA 4C9BA 4AG6A 1QHHA 4P32A 4D4MA 2J0UB 4R9UC 3OESA 1BMFA 1X8JA 2O0JA 5GJBA 4N0DA 2JATA 1N25A 5H68A 1Z07A 2A7QA 3K09C 4Q9IA 4M9SA 2C04A 4R98A 1U0HC 1U9IA 2ORIA 1LV7A 1MO6A 1Z06A 4BZPA 4XD7A 4UJ3A 4EPTA 2XSZD 1OKKD 2ZI4A 3ETLA 2Q9AA
chains in the Genus database with same CATH superfamily
4PG6A 3SSNA 4YROA 1DQPA 5CD1A 1AUOA 2J6CA 3HB1A 5CPBA 3RAGA 1A9SA 3WGUA 3D1VA 3Q8XB 1P91A 4CNBA 1D5WA 3EZ2A 5IYZB 1N0IA 2RIPA 4Y2VA 2ZSKA 1RKBA 1LDYA 4DYHA 3V46A 3IPXA 4YAJA 1G2QA 2QNIA 1Z7GA 3FXAA 3TLXA 4HWKA 2FX2A 4TRRA 3V4LA 1ZJZA 2AG1A 3WZMA 5A4IS 5AH0A 2ZWIA 3CMMA 1JIVA 1QYVA 4JELA 3V2UA 1QGUA 3PE6A 2XOKD 1UZUA 1NBOA 4DQXA 3IV7A 4GM0A 3CUEF 2GJAA 1K6XA 1LJUA 1EK2A 3O95A 3EVZA 2PGAA 1GZHB 3G79A 4M4SA 2HRDA 4NOLA 2IF0A 2P91A 3A4IA 3HKBA 2NXNA 2BJVA 3PF8A 5DHQA 1ZO8A 8ADHA 4P84A 1LRJA 3UHFA 4BLQA 2REBA 5JZOA 3I01A 1N36B 3SQLA 2DBRA 5AOAA 1PSWA 4ZI7B 1KDYA 5EQFA 4UOEA 5JI3E 1VLQA 1PZMA 1X70A 4DAOA 1HEYA 4W5WA 3UV6A 1K75A 1O58A 1ZHHA 1HYQA 1K8QA 4KDFA 3A3NA 4L7QA 4A2WA 5CITA 1JH8A 4TSFA 1W59A 4I3FA 1DBWA 2J6IA 2H1WA 2BSAA 1WVIA 4ENTA 1VIYA 3LECA 4RNCA 4QHYA 3UWSA 5IJWA 3RC8A 3O8QB 5LBTA 1TK2A 2PVCA 2V7XA 4D74A 4DVGA 3I04A 3IV9A 3OOWA 2ZM6B 4NFHA 1C8VB 2OWDA 4DLYA 1MQAA 2XE6A 2VZ0A 5CVTA 3DVSX 1IY0A 3RHSA 4X71A 2J8ZA 5AR1A 2WJ3A 4YRDA 4D0SA 1ZN7A 1U0LA 3PCXA 4EG7A 3LQQA 2GOYA 3L8HA 1WAMA 2IYWA 1GQSA 1TTQB 4N39A 3EJWA 1V41E 5HW0A 4I81A 4PIMA 1W49A 2ASVA 1MA3A 1VIAA 1X1EA 2BH9A 2QG9A 3EIEA 3L0YA 3LUCA 4MQEB 1AN0A 4XD7D 1A2BA 1XNQB 5T41A 2Q2VA 4A0GA 3Q9LA 1T9BA 4R3WA 2CNWA 1DBQA 3PZBA 4PHTA 2C20A 5LP6C 4O4JF 2CNLA 1GPNA 1U7HA 2GJ4A 4GI5A 4KX5A 4UCXA 2BMVA 2Z5VA 3KVVA 3MHPA 3KEFA 2IVFA 4P1ZA 5HBRA 2AHOA 1NY5A 2JI8A 3MMZA 3W34A 1WETA 2XV1A 4UMVA 4F96A 1RM5A 1QIGA 2QORA 3GQVA 3L8FA 1EPUA 4EG0A 4Q66C 1MW9X 4HB0A 1AQUA 4EKYA 4YPFA 3BAZA 1XR3A 2GRJA 3WJ2A 2ONKA 3TSCA 3CUYA 3AMVA 1T3LA 2JH8A 1L7QA 3QW2A 5CLQA 3P9SA 4FGUA 4KDEA 2CVQA 3BB4A 4WUTA 1N8SA 1PFWA 4Q4DA 2GPNA 2O5RA 1E7QA 5FBLB 4URYR 1DIAA 2B4AA 4DKJA 3UWMA 4CVNA 3NCHA 1QH0A 4RTRA 1ABFA 2GCOB 1QRRA 4PLPA 1JJVA 5T67A 1PNQA 2F3TA 4R2HA 3H2HA 3HYNA 2G83A 3L8DA 1UEIA 4CPDA 2DUJA 4GBMA 4HDQB 2Q1YA 1QE0A 4TSFD 1NW8A 2EKQA 3EJ6A 5FBVB 4DEXA 1QIDA 1WIWA 4EO4A 2YIJA 5IWAB 1LPSA 4R8LA 4QBTA 1NWHA 4IFEA 4YRLA 3G88A 3LF1A 4PFKA 1Q50A 1RAEA 4HX2A 2CXUA 4MVJI 4F84A 4WKCA 1A7KA 4FIZA 1EP3B 2VK1A 2V3VA 1EA7A 2BKUA 3PNPA 1JBEA 3QPCA 5LVAA 4C0HA 3WYEA 4UFPA 4PC7A 3OBIA 5DV9A 2VP4A 3V1YA 1M1YE 1M73E 2QN9A 1TKCA 2ZJAA 3H4IA 3PQCA 4GZMA 4Q6BA 4O4LF 4R2JA 3FVTA 5B58T 1P44A 1XZ8A 2A94A 2EWMA 1LBIA 2OYRA 1N5RA 4K6KA 3UV3A 4PFJA 4NL4H 3L9WA 4ZD6A 1IQ0A 2W48A 2GPAA 5E7JA 3IEKA 2RK6A 4AUEA 1MC1A 1TEHA 4MICA 4FKMA 3UQYS 3LUAA 3QHQA 1DQYA 1U0GA 4XWTA 1MAHA 2JAOA 1WHTA 2ODTX 1YOVA 4J4TA 2WTNA 5IKPA 5TEVA 2JEYA 4Q1BA 2C8VA 2R8EA 3MCUA 2PV0A 2PX2A 2IUSA 5JRZA 5B4UA 2I2WA 4G86A 3V55A 5LM3A 3ZXIA 4XXHA 4FX5A 2E6UX 2NXEA 2Q5LA 1QH9A 2B7BA 2VK8A 3NG1A 4HGRA 4JLDA 4CEIB 3FDFA 2XYHA 1MG0A 1Y7HA 1EUZA 4UNSA 5TF4A 2FWRA 3CLHA 2C2OA 3QX7A 2IUUA 5B6JA 4P22A 4J3FA 4I1OA 2NPIA 3L8CA 1B8OA 3V4RA 4OI2A 4QJ4A 5B3JC 1ODTC 4AKHA 3QPVA 3W3AA 4JC4A 5FR2A 1RD4A 2HTEA 3R5FA 5L51A 1KY3A 1JR3A 2ZYDA 4TVOA 3RANA 5TQ2A 3RSOA 4E2ZA 1Z83A 5H9WA 2OP1A 3KBBA 2KPOA 4OQQA 3AIOA 4ZHQB 1U3GA 1AB5A 1ZK0A 2JBHA 2VJMA 1F12A 2F3PA 4Z0TA 2X40A 2FSGA 3UAYA 4EF5A 1M2VB 4X63A 3IJ5A 4MWZA 5KOHA 4O02B 3NV7A 2C5LA 4JYBA 4QVKA 2RGNA 2J6BA 5FQOA 3YASA 3L1HA 1WG8A 1EGQA 5AFSA 2JHPA 1VHQA 3DOHA 4TV9B 2VSXA 3RUEA 4BJ3A 1QF7A 2REOA 3QXHA 2VBGA 3QUBA 4C05A 1CIJA 1S8NA 4PQYA 3KPYA 4Q03A 5B1DA 2EF1A 4AQ7A 1GTRA 3AUUA 5JCOA 2ZIAA 3CHYA 4REQB 2BDTA 4G9EA 2WQZA 3RJMA 3AETA 2YC2C 4E22A 4ZC1A 2YY5A 5ADUS 4IDBA 5ELXA 5TNXA 1PNRA 1NN1A 1D2NA 2QYOA 1K3FA 4ERNA 1N4DA 1VC2A 2RHCA 2XZDA 3BE4A 4G2NA 2UZ4A 2Y6UA 5IVPA 1Z5VA 2ZRBA 3CX3A 1HEIA 4IDOA 4UVHA 4B4UA 1JNYA 2RGCA 3EA0A 1ADCA 3B20A 1O97D 5ADHA 3U40A 1ZESA 4P83A 5DCLA 4WRRA 4RPKA 1N2CA 3NDJA 4ZGGA 1AS0A 2QRJA 4LGVA 4C5AA 5MFPA 1MXFA 2V7BA 2AI3A 2CKMA 4ZALA 1W6RA 2HSDA 4MITA 3AHHA 4KXLA 5KJEA 4H0CA 3O7WA 4JI0B 2Y0EA 3FYHA 2UXDB 2FEAA 4AZ3B 4FIDA 1LLFA 3DJFA 2QAGB 3GXBA 5CVCA 1E96A 2ZBUA 4KNYA 4DPKA 3H0CA 1SCDA 4DIBA 1JHRA 5E3HA 2WIGA 3V6MA 4N76A 5DYGA 3FRJA 2C99A 2I2FA 4RKQA 2QTLA 2ZRLA 3GVCA 3L7JA 1ICEA 2ZEJA 4K9MA 1NM5A 5JW6A 4CMIB 1EFPA 3W3AD 1T8PA 2C7BA 3ORFA 1NT2A 1KMHA 3V32A 1JR3D 3CWQA 3F67A 4WBNA 3HXQA 2FMTA 1YR1A 5EUQB 2PXCA 1T1GA 4MYCA 4OBWA 1ZXXA 3EIHA 4WXRA 3JSXA 2RFLA 4OMUA 3MRVA 3N3BC 1VIMA 1EVLA 2E5WA 2GLTA 1PKEA 2W2LA 3C7KA 3COWA 4G9GA 4RS4A 5CK4A 1Y1LA 1D0SA 3R4VA 1FU4A 3DT8A 2X7JA 3IAS6 1JBKA 2MSCB 4ILKA 4YCDA 3WX0A 3U4QA 4OAPA 2QPLA 1NDQA 1X7HA 2O52A 1MAAA 4KKXB 3RBXA 2J3MA 4BN5A 5JLAA 3IQZA 3PD1A 4GMXA 1MTZA 1C50A 4LWZA 5AJVB 1TUGA 3CZ4A 4N5LA 4D9BA 4LHZA 3F97A 2LD4A 2XKKA 1BDMA 1KS2A 4RD6A 221PA 2PMKA 3PHBE 4XQCA 2WM9B 1JHMA 2D7JA 5AHWA 4GM1A 5FYQA 3AEUB 3B6MA 3GN1A 1RXSA 3OT5A 2IELA 2L19A 2V5UA 4WY2A 1JHYA 2HMAA 4MUEA 2G0TA 5ALKA 5A2QA 4BFZA 1RHJA 1HE1C 1C7FA 3WL3A 3ELUA 1ECLA 5IW8A 2NIPA 4F3RA 5DO9A 4RD2A 4M8KA 1J9GA 1UJ4A 1FFCA 1T9HA 2HLNA 2OCBA 3HL4A 1ZGJA 621PA 2OLEA 3C14C 4HQ6A 1QRDA 4IYRA 4ETMA 5KJ1A 3PRHA 4C2TA 1CEYA 1LJ8A 2VHWA 5DNVA 5CAEA 2DBQA 1GG5A 2AXPA 2OVBA 1DEAA 1V1RA 1CQXA 3BWMA 2E82A 1NXOA 3OZDA 1BKYA 4H9GA 4KQ2A 1EFDN 1V8PA 3PI6A 1P6XA 4RANA 4J43A 1KR5A 3G2NA 4U2KA 3TNFA 5BXQC 1E20A 3NBXX 5CU7A 5C2JB 1KZ6A 2JW5A 3IAM6 4IDQA 3RARA 3BD6A 3T9AA 1AN9A 4O1IA 2JAXA 2QR5A 2NOAA 4EFLA 5A4MS 5COAA 3OLVA 4RE5A 2C7PA 3OMWA 2ZJ1A 3H8VA 1SQGA 5HQ3B 3E35A 4C4ZA 4S1PA 2EU8A 5F76A 4AXBA 1JJAA 4M1MA 3UCXA 2IPLA 2E4AA 1NGSA 2J5QA 1XYYA 3AIKA 3R75A 1ZVVA 3LUBA 1T29A 3QOXA 4FZRA 1UDXA 3TOXA 1ZJJA 2C7VA 2QB5A 3QLJA 2GJSA 4TLLB 4BBJA 1RLMA 4AJ9A 1DC4A 4U00A 4UM9B 1N9GB 2IPXA 1PP4A 2JHAA 3L43A 4ZDWA 4ZEVA 1YI0A 3U3ZA 3MUOA 1W34A 4KO8A 3TR5A 2B35A 5T4FA 3HP4A 2BEWB 2W6PA 3ZJ4A 3TUJC 3QVUA 4JQCA 1UH5A 5DMHA 5KOJB 4PQGA 1FJGB 1QAOA 3BUSA 1Z5OA 1JNXX 1NBAA 1XZAA 4DXAA 4OXYA 1AKTA 3V4OA 4E07A 1CY0A 1FNMA 2X8BA 3DFZA 1MENA 3EG9B 4MKIA 5JZ9A 5KC8A 2WG2A 1H2AS 3MYRA 3K72B 4OF4A 3VOBA 4WJZA 3PGA1 3UO8B 1VECA 4A5SA 1KIMA 3OZIA 1P62B 5JCPA 3WL4A 3BWXA 5TQ0A 5EP4A 3TW8B 2ESRA 3GPBA 1Z35A 4Y2SA 2B20A 5HXAA 4JHLA 2GDJA 3AUYA 4KI0A 2IV3A 3UYLA 3K0SA 3MWGA 3C4QA 2P41A 2PZAA 4ZQEA 4KQ9A 2ZW9A 1GGEA 3M2TA 1BS9A 2D13A 3ULKA 1BU8A 2A1TR 4I4NA 3ZIAA 4MV5A 5H4HA 4H60A 3ADCA 1NSTA 3BJRA 4AB1A 3T35A 3I5XA 4CU5A 3HBAA 2ERXA 4KPUB 4RM2A 3WIEA 4E03A 4V1CB 2ZB7A 3AXSA 4AY2A 5CG1A 4YI3A 3HTXA 1UOQA 2RK4A 3V1NA 3RK0A 4IJ6A 4C0WA 1Y5RA 4RX1A 4ZXPA 1PHPA 4HQKA 3RYTC 2H4HA 2YJ6A 4EZEA 5JPDA 2L2QA 1YZFA 1I1OA 2G1KA 1C30B 4ENSA 4I08A 5KJCA 4DVJA 6AT1A 5FI5A 3W7BA 1ZGAA 4BL5A 3AFGA 4CL0A 2VA8A 4QDTA 3N2GA 3TAUA 3ZDAA 4F45A 1QX4A 3DV9A 2QE6A 3QELA 3V7NA 5LMZA 3AF0A 4MB6A 2H00A 1PU2A 3FJYA 3FPAA 3RW9A 3TS1A 1REQA 4JBGA 3Q1KA 1RWQA 2PX4A 1Q7EA 5FI0B 1ULBA 3DPUA 3W9YA 3VZRA 1QH1B 2OHIA 1A7AA 4NENB 1A96A 4DB4A 3AFHA 2DEUA 2HMWA 4IWXA 2QP9X 3TMYA 1W2GA 4TX1A 3FDXA 2NACA 3LQ4A 2A5GA 1E99A 4IR7A 5EE1A 4JMPA 3GMSA 3PWKA 2P27A 1TAUA 3OFVA 1XCJA 4FNOA 2Q0HA 2YWFA 1AZLA 3EB9A 2XB9A 3L8EA 4HBGA 1I36A 4KE8A 1L7VC 1LK5A 5DGIA 1F4PA 1GSIA 2Q4RA 1BCRA 4L4UA 5DLQC 2ONJA 1A95A 3ESZA 4NARA 3ECAA 1JDBC 5KQPA 1JEYB 1OV6A 2OYCA 2PH3A 1MCZA 4AMVA 3H5IA 4BX3A 1XMSA 3AI2A 4FDUA 1DCMA 4E3WA 1IOLA 3PSHA 1U9JA 2OBNA 1IWOA 1AMOA 1RQXA 4RKFA 5CNKA 3ITNA 4EF6A 1XLTA 5AM1A 1XVLA 4CMBA 2KHZA 1W7AA 1CF2O 1QKIA 4M6WA 1PEYA 1OBFO 1T26A 3D3EA 1SURA 3NDIA 1KYWA 4LHEA 3T9CA 2X1HA 5AJTA 3R9IA 4Z1MD 3ZIAD 1R1DA 4GLFA 5KNDD 2O0LA 2VP6A 1SPBS 2CC2A 2DT5A 3RBZA 4JJZA 5AWFC 1I5OA 2HDNB 4N9WA 3K71B 4Z0NA 4IW3B 4P93A 3ZGXA 4GI3A 3IVAA 1K5DA 3E8MA 3ESYA 5D1HA 1GRCA 1SFRA 2H7YA 3S68A 1KFKB 4CTOA 5A1TA 5HIJA 3UTDA 1OYOA 3AGQA 1XU9A 4RV9A 4V2UA 1VRVA 4K46A 2PUAA 3VHLB 4IVPA 2IEGA 3ZKAA 1OXKB 3OZFA 2C2XA 3K0KA 3D6UA 4GX0A 2LVBA 3ZCXA 5GGYA 1Q0UA 4U8HA 3IQWA 1QP0A 4Z4CA 4DDTA 3BPSA 1GKYA 2J33A 1XQ1A 2VP3A 4BNIA 2BR3A 3I8SA 4LFBB 4XSGA 4JI3B 4Q1EA 1E2BA 4TL7A 4EEZA 1PJBA 2FR8A 3O93A 5A6SA 3GT3A 4C7VA 1FNSA 1ZM7A 3DEYX 3AKDA 3T7AA 1KH2A 1UT8A 1WB4A 3A9VA 4Y9DA 5ALLA 1XXHE 1ESMA 3GYGA 4TOIA 3WP0A 1UXKA 3ZJ5A 4AZVA 1T3HA 3NT5A 5IFLA 2GT1A 2FG7C 1NQOA 1MGOA 4FEYA 3G6KA 4DLWA 4B3SB 3MTIA 1EBBA 5GIPE 1G20B 2GWHA 3SX2A 1QBKC 3DZCA 3MGAA 3VC1A 5LDHA 1R3UA 4YMWA 1DDGA 3C87A 3OLZA 2QTTA 5JAZA 5F1YA 5E95A 4DCGA 4J9UE 3TSOA 1GT6A 2Q6IA 3FUWA 4DCMA 2CXHA 4IIHA 3OOEA 4KHZA 2B8TA 4NE2A 1KI9A 1ISRA 2PRIA 3B7GA 3JS5A 1XOIA 3NKVA 3KOMA 1DQZA 4LNHA 3ZQ4A 1MGPA 1VJRA 2X9LA 1CE8B 2C98A 5NULA 1KDPA 3G2IA 2R79A 2YDXA 1NNLA 4GYYA 5FHQA 1KIAA 3T8YA 1OI3A 2CLSA 1K4YA 1X74A 1DKNA 3C3JA 3HKEB 2E9SA 4X7RA 3DL0A 1ISSA 3MT8A 4UUMA 2CLEB 2QL9A 3EY9A 4NATA 5HIIA 1DEHA 5LYJA 4NBLA 4OI0A 3OSUA 1B41A 1BW9A 3TSYA 4GSKA 4M9UA 1LTKA 1PW5A 1NI4A 2D1TA 3F1KA 4MWCA 5IDXA 3A6FA 1E2PA 2H85A 2HWKA 3GVPA 3JD1A 4K9NA 4F9EA 2ZYWX 4EKEA 4L5BA 1RPZA 4EX6A 2IS1A 1R18A 4EPRA 2A5LA 2RAVA 1ANKA 2HBQA 2J9GA 4N3CA 4DZZA 3RSSA 4IWYA 5ITZA 3PGXA 2WJ6A 4HGOA 4FHDA 3LLVA 2IS6A 3O21A 2WJYA 3DTVD 3I2JA 3ORSA 3EW7A 4RGQA 3MWKA 5FLKA 3THRA 4HNUA 4AZ0B 4RKRA 4J91A 4MINA 5EI5A 3CO5A 3ME5A 2BFNA 1DCFA 1J97A 4IKOA 4ZT4A 5SZKB 4PAMA 4WDRA 2FOIA 1Z33A 4D41A 4H1VA 4IZ6A 2PKYX 2VUHB 3DVRX 4EQ6B 5IAEA 1T1SA 5CB4B 4CQNA 4EJSA 1UQRA 3BL8A 5T8KA 2QTBA 4MS4B 1KO5A 2J9ZB 3I9FA 4IIJB 4CR7A 1U1FA 1J07A 3EAGA 3GI1A 3MGKA 3DBIA 3LBIA 3G1UA 2HNBA 3GPDG 1HLGA 3FZNA 3RVRA 4UDXX 5CLJA 3IH5A 2X4DA 2G76A 5J47A 5JAPA 4FGZA 4BP8A 1FC0A 4LJLA 1QZUA 4BN0A 2BHSA 1P4RA 2B9VA 3VPAA 1P8JA 1AUXA 2ZDHA 3BK1A 4M1YA 2OV3A 4CRWB 4RMHA 3UXMA 2OQIA 1DJQA 1THMA 2XGMA 3M1YA 1C9KA 2ACWA 2LNDA 3BGIA 2RB4A 5LZ9A 2M6SA 5C35A 3ZCQA 3DCNA 4YAGA 2D0DA 4TQAA 3C5CA 3IPRA 1J0AA 4YR9A 5L7WA 3E7XA 1LVHA 2AN5A 1E6EA 3J80A 2A0YA 1YVDA 4Q37A 4BMDA 5K0TA 4NFSA 4GM4A 2X8JA 3FDZB 2ZXUA 3MG9A 1DKLA 1FFBA 1JN0A 1MQ9A 2BTQB 3KEGA 2C92A 2NTVA 3DMFA 1DFIA 5ENDA 2EX0A 2RC6A 2CK3D 1G6OA 2GM3A 2Y4OA 3A9TA 4RTNA 1V1MA 1EQAA 2C9MA 3C3CA 4PPFA 2FZGA 2BDEA 2QSUA 5E2IA 4KHPB 3VKWA 3CLSD 5K9ZA 3K30A 2QXTA 4KQMA 4C6TA 3PR2B 1ULUA 4QAJA 2PGOA 4ZZIA 5F3WB 1HMYA 3NUZA 5COQA 3T5MA 5I7FA 3DMTC 2WPDD 5DM1A 1UZMA 2P1ZA 3NH9A 3OCXA 4Y8VA 5ENZA 4FWIB 1L5NA 4PWYA 2WU3A 1SRQA 2JEZA 1U9ZA 2PUWA 1AKNA 1DIOB 4FK8A 3WRVA 3ZBTA 2PL5A 4YAKA 4LXGA 1A7UA 1WE2A 3I1FA 4H2DA 1ADFA 3I5YA 1NN0A 4GR4A 5HYVA 2ASEA 3ONFA 2OCAA 4BO7A 3GEIA 3HR8A 1EUDB 3R3SA 3W5VA 5GADl 2FHSA 4NYIR 5GM2A 3W1EA 3WOHA 1DPGA 2Y1WA 1WP9A 4LC0A 3ZOKA 5KYXB 3ZD7A 3OQMA 4I1RA 3MD0A 4WBNF 4KN8A 4LZZA 5K0EA 2BJHA 2A8YA 2G71A 1E1RA 2N9UA 3I01M 4XX1A 5DOZA 5EUCA 4XVCA 1AM4D 4CG2A 3W2HA 1K7CA 1PZEA 2VZLA 3D4BA 3VTZA 5CT4A 1PCXA 3R0JA 2Z9CA 2RGXA 3Q0TA 3BD8A 2VPTA 1S1MA 3HR7A 3TGLA 1A4XA 1GAJA 4AJNA 2CVHA 3HJRA 3TG8A 1QIEA 3MT0A 3CC8A 1UJMA 4L6CA 5ALVA 3F6YA 3I04M 3BE5A 2M2IA 4JXZA 5JH7B 3H4MA 3WQBA 3DMYA 4AQYB 1PR2A 5JO9A 3HVHA 1RZ3A 4UTVA 1D6MA 2PLFA 4KQKA 1VE3A 5A3VA 3D5EA 1JTEA 1XD2B 2FMUA 2VPPA 3FLMA 2MSDB 3L0ZA 1CZUA 4JLPA 1A69A 3C3MA 3QUAA 2R6JA 4KPFC 2E5LB 2B2NA 3B1YA 3FNBA 3FYUA 2GN0A 2DZDA 4ZA2A 3A7EA 2FUNB 3K9LA 5EHIA 1PWHA 2NTEA 4FBGA 4BNXA 3C8MA 4HFJA 5TV2A 4S04A 1ECBA 4E5VA 1EXMA 5DNUA 1BROA 2JANA 2VNIA 2XYGA 3K2IA 3M6XA 3UOWA 1UR5A 2ZJBA 1ZMXA 3CNHA 3VTAA 4HDKB 4K9RA 1QIHA 4R8KA 3IEVA 2WF7A 2X0DA 4F3NA 4MJLA 3ER8A 1DFGA 1JYEA 4IX9A 2OQRA 3D9QX 2QJOA 2WYHA 1H6BA 4ZKEA 1V8BA 4JZKA 4JQZA 3TR6A 1FFHA 1JU4A 2BGRA 3F6CA 1AY0A 2VRCA 3RC1A 1KBOA 3F96A 2GEUA 4D3YA 1U6KA 2WTEA 3L1UA 1U0OC 3M83A 1FMCA 4RY9A 5K51A 3B2EA 3LP5A 4IG4A 5GV7A 2Q5QA 3F6SA 4J6EA 3NALA 2CCKA 1HORA 4MV9A 5KHLB 1DP4A 1E2IA 1ZQ1A 4X54A 2RKBA 1HSZA 5ILGA 4XE5A 4GRDA 4HEQA 4TQGA 3VNQA 3ZVMA 3KSZO 3GC6A 3CVUA 3NGXA 5KBYA 3C16C 3EPLA 3PX2A 1N8KA 4FQ8A 4CDRA 4PZ9A 3QPUA 1XJWA 1XHFA 3LPNA 5B1YA 4G5HA 2C5FA 4X1KA 3UK2A 3KB1A 3ROEA 1V43A 2VPIA 3AVOA 5HCIA 4G0VA 5EMLA 3DLCA 4M2LA 2DX7A 3IKMB 5F12A 3T1YB 3QW4B 5IC6A 1N7HA 3KQWA 1O7JA 1DDOA 2X5KO 1DC7A 1GAQA 3R23A 4NZZA 1GAWA 4BZWA 3EBLA 4JB2A 5M2QA 3OQNA 2PUCA 3ZNPA 4JLKA 1THZA 4QATA 1EFKA 4YRSA 2W71A 4MROA 4QZVA 3KSDO 1AUPA 1PT5A 1UADA 3OJ0A 3UANA 4PYKA 1ISFA 3COVA 4NS1A 4EWLA 1R4AA 3V1UA 3H6HA 5CH3A 4RVOA 1R12A 2QU8A 3IDFA 3CZMA 2AXEA 3V3KA 3AUJB 3L7DA 1SKYB 3KQTA 2G72A 4NXMB 3I4LA 1E2NA 1R74A 3TH5A 1X94A 1F5NA 3MWEA 4NG4A 4E15A 1YIOA 3CX7A 3JQQA 2RGRA 1ULTA 3I9MA 1M8JA 1PL6A 3CURA 3R6DA 4MWSA 3NXKA 3T3EA 3PJRA 5EERA 1ZW1A 3KFLA 3HWX1 3CIOA 4F9TA 2FF7A 3WSTA 2BCJQ 4EUHA 3VYSB 3HDGA 1KFEB 2XBUA 3ODPA 1LI5A 2PSFA 3ISVA 4Z7JA 1LVUA 5LQCA 2JFWA 3H2IA 2A30A 2BWJA 3R8XA 2UDPA 3D3WB 3KQLA 5EIBD 4B17A 2ORVA 2H7CA 2WMDA 3HYSA 2GZDA 4DUZB 3NWPA 1KZHA 1D1PA 4QUJA 1V8DA 4PTLA 3ROKA 1JPVA 4KPEC 1GKIA 2AKAB 2WIFA 3HB5X 2F48A 1KO1A 3B8EA 4GGMX 2VRCD 5LZ5A 1OROA 2AKEA 2GEJA 2GTHA 4JT2A 1OWPA 4V0QA 2R8OA 1KKLA 2FRDA 5FPPA 2ATCA 1W46A 3CEHA 3DAOA 5EE3A 2FUCA 1YRQA 4D8YA 4ZDJA 4P6VF 5KJ6A 1KP2A 1OE0A 3I1YA 4FP9A 9GPBA 1IN8A 2OV8A 2FU5C 4IIXA 4JGBA 3U3MA 5KWEA 1J00A 3CB2A 2OQ2A 2YHSA 4O4HB 2B61A 3TSWA 3W6UA 4P86A 3OKAA 5C31A 3LL7A 4MLCA 1YBVA 3E48A 4W9RA 1H5QA 4JA0A 2G40A 1SM4A 4I7EA 1KSGA 5JLJA 3MOGA 5DASA 5EZ5A 3TUIC 4WGGA 2OO5A 3ZU2A 3GJ7A 5F2KA 4GMFA 3AHFA 5G3ZA 2BFDB 3DLBA 1YVEI 2NZVG 1KK1A 1PSZA 4NY1A 3IBYA 1YQGA 3SXJA 3FTCA 3E4DA 3COZA 4ZK2A 5EJAA 3D6NB 3UGTA 3P9XA 1LNQA 3GVHA 4HFNA 4Q1DA 4AJ2A 2QM0A 5GZ1A 2P9QA 4QUHA 1Z7BA 3NVKI 4B9AA 2IWRA 4TTQA 5KTRA 2B36A 3T3NA 2H4XA 2E89A 1SOAA 2CDBA 3FOAA 4G1UC 1XA3A 5AKYA 5F5LA 3RVSA 4BTVA 4CEHA 2IZ5A 4QIHA 2E0IA 4RL6A 2ON6A 3F7TA 2B4RO 1UPTA 2PQ0A 1TE2A 2NU9B 3VVMA 4XIIA 3JYNA 3AJDA 3K1AB 4JVMA 1VHLA 1K5HA 2OFOA 1PL8A 3D2AA 3CVXA 2IW1A 3KUXA 2J9RA 2A3NA 1QOZA 1FRFS 1UMBB 2O7QA 3WWEA 3E27A 3TKYA 2J3HA 3ZYZA 1E0KA 5DI3B 2B6NA 5B7QA 2EJVA 4LWPA 2QR2A 2JRCA 4NBVA 3IQIX 3LPDA 4EI7A 1KJZA 2X5NA 4YMSA 4C4PA 1IDOA 1MR3F 2VT2A 3FNRA 5FORA 3WL7A 4EB3A 4DQ0A 1N3IA 1BCSA 3UF0A 3UK7A 4B2IA 3E7DA 1OT5A 1FMTA 1O95C 5K8CA 1A9QA 4BWYA 2QRZA 3KALA 4LJKA 4Z4HA 5DMXA 3R5KA 4ZXFA 3VPFA 3AF5A 1RE0A 2QTVB 5CVJA 4JVOA 2OILA 4RDIA 1NJSA 4IJ5A 2K7FA 1JSRA 4GVXA 3UCEA 5CK5A 2DLCX 5H3HA 1CQZA 1X7ZA 1ZM9A 2OD7A 3QUQA 3H16A 4OREX 4TXNA 4ZN6A 4KU4A 2C9BA 1JLLB 2VP5A 3R7WB 3N2NA 1XNJA 2GD6A 3LCMA 5FBHA 1TMOA 5GJCA 3WBBA 2Q5HA 5JXWA 5AJWA 3OZUA 3LLSA 2JA2A 3RAPR 4I4LA 2E37A 3RVJA 3JSAA 2AJTA 3HCWA 4NNJA 1X1BA 1ULSA 4LF6B 5AI6A 1OZFA 3AHEA 1CYEA 1CNFA 3NVMB 1EM8B 5EUMA 1EU1A 1QQTA 1U2GA 1WZNA 1U0BB 4LJYA 4L28A 4WDQA 1Q0ZA 2BTEA 2UYOA 3OIUA 4RORA 3QWAA 4HGZA 4G0UA 1UWVA 3RF6A 3HFSA 2P90A 3CUVA 3RJ5A 5L4NA 2QX7A 4MA4A 2BFEB 4XW2A 1NE7A 3C6YA 1OX5A 4HTAA 4L3VA 1YKSA 4YK7A 5FPQA 3BOSA 4URFA 3FJ1A 1HXHA 4Y1RA 5DCYA 4BU1A 4CV0A 2C8KA 3D7NA 3EBPA 3KUUA 4EGFA 2XA1A 1VSQA 1P9OA 3CF4G 3OLXA 1BDBA 3EVGA 2JGAA 3WMRA 2XOXA 1SUEA 4M46A 5A0TA 4CG1A 2ZR9A 4IXDA 3K1YA 4RCZA 1CR2A 3LQRA 1N77A 2J7PA 2X77A 1A3CA 4AECA 1C9YA 1FSFA 1J9EA 1HTBA 3B78A 5C8VA 3FYTA 3GLQA 1YZYA 2OGTA 1Z3IX 4PANA 5LYJF 1P31A 3ROGA 1VCOA 2F3RA 1DUIA 1Y3AA 3IB6A 3K8OE 4MS3B 3GT7A 1TT5A 2FFRA 5KPDA 2VT7A 4NCBA 3R40A 3CZCA 1DTWA 3D1JA 1T9CA 4WBSA 1A9OA 1XRMA 3D4NA 4ETIA 4F8JA 4QTZA 4I1PA 2JZCA 3PEFA 5K5EA 4NBWA 1YHYA 1C8KA 1HFKA 1L1EA 1XNHA 2ZTMA 4I5IA 4OJTA 1NA5A 2ZU0C 1D6JA 1YXMA 1KY2A 2W6MA 2WAXA 3ESDA 3EODA 1JGTA 1K63A 4UUPA 2YNMA 2IDJA 4BGDA 1P2SA 2F4NA 2O4UX 2QJTA 2BEKA 4JKYA 1N2ZA 9LDBA 1WHSB 2JIBA 3DLTA 4H3SA 1W73A 2CXNA 3B36A 3NNSA 5HKLA 3ORQA 1G8KA 2IOHA 3RIHA 4YMGA 2ZM5A 1FX0A 3IBCA 3F6BX 4CF3A 5TB5A 4M9RA 2GHTA 2PMWB 3COSA 5T7BA 3R5TA 1XTTA 1ZK3A 1EG2A 5IM4A 1YVPA 1WW2A 1IUOA 1QM5A 4JU9A 3RRMA 4LTDA 4P7JA 2C7RA 1JMVA 1HE5A 4WIAA 3IUQA 1DG1G 3JWIA 1SKMA 1LF5A 4X97A 4OA5A 2AW3A 5GONA 3TL6A 3UW3A 5TPZA 4HADA 1X9HA 1EZ1A 2QQGA 3EXIA 4MQMA 3E5NA 4ZCRA 3WLNA 5H8WA 1YE8A 2EKLA 3H0EA 3RIYA 3LAWA 1Z6PA 3VOAA 1GGKA 3EASA 4EY6A 3HJHA 2L0XA 4PXYA 1C80A 5HKKA 4OGWA 1TTHA 2HDOA 3DDCA 3KB2A 4YV7A 1AKRA 1BGXT 1MX9A 3CSSA 4IJVA 2XA9A 1Q92A 3DE4X 4II2A 1N2JA 5HF8A 4DT1A 2EBHX 1E5XA 4F6RB 5KQLA 1H93A 2BW0A 2MIIA 3DOEA 4N1AA 2M1ZA 4ZEXA 3QU5A 5IK2A 3RC9A 5CA0A 3SICE 3L4KA 3WQRA 1BA3A 4QSMA 3HCCA 3MTAA 1NMSA 5JZBA 3JAWB 4C2UA 3DOOA 3PC3A 2VF4X 5L9AA 2AOXA 3KD2A 4H3HB 1HH4A 2EW8A 4LHYA 1D2AA 3CF0A 5AHXA 1JQLB 1RCTE 2CVZA 2ZYSA 4OHZA 3SLKA 3N59A 3IOCA 4JOCA 4QODA 4U7JA 3VX4A 3A6DA 3DKKA 1YT5A 1VG1A 4X8OA 1ST3A 3NKFA 3K16A 4PLWA 4J4BA 4QQFA 3VJLA 1DO2A 4O29A 4BP1A 2GK7A 3C7TA 2IHBA 2C88A 3H0KA 3QUCA 1YIDA 1UINA 4XM2A 4CV2A 3O3MB 4DIOA 3S8EA 1C7EA 1AT1A 2KI5A 1ECPA 1YB1A 4ZVLA 3WFJA 2J85A 1J0BA 2X9VA 3NRCA 2VYQA 4DSNA 3PC2A 5GJVC 1CF9A 2GEKA 2QTNA 4FR0A 4P3OA 4BQNA 5I45A 1NW3A 2F1OA 2UUBB 1N2BA 2R2AA 3G7SA 4C0XA 4C7XA 5C4MA 5KHOC 4AKIA 1X1SA 1PTJA 3R4CA 3O4HA 1G8SA 3RYIB 1ENPA 5FBWB 2Z08A 1TLFA 4HQNA 3A9RA 3HBMA 4PZYA 1JWLA 3IEMA 2O8DB 1M8GA 3AEQA 3HEAA 5TQVA 4JX9A 4KXVA 3W7VA 3I6QA 3I23A 5TMBA 1IIRA 2VNJA 2ZTVA 3CO0S 1LFAA 2RH8A 3GN2A 5F78A 5IYZA 1THTA 1YR2A 2I6SA 4WL0A 2PRKA 1T2VA 3G2PA 3GRKA 3CV3A 4AXXA 3EA5A 1JXOA 1CDOA 2N75A 5G02A 4EHLA 1Y8QB 4PW0A 4D6XA 2CSUA 2UUPA 3LTEA 3PFIA 5TPZD 1IPEA 3F78A 2A9PA 4N3NA 2BPOA 3P9ZA 4K6FA 4RXMA 5E6RA 1VPWA 3PDUA 2DHDA 3LWZA 1K2VN 2REQB 1Z2NX 2VPXA 2W22A 1VDMA 4LGMA 4YREA 1Y9ZA 4DLXA 1BWPA 4NMXB 2WKWA 3ZTYA 1KXJA 2RHRA 3KEOA 3FNEA 3X1DA 4Y9UA 1QDEA 3ZHCA 2Y1KA 3LXRA 5BSVA 3I2YX 4PLYA 3HACA 4ZI7A 2I6FA 4YP7A 1M1YB 4B9EA 5IZCC 5TRTA 3S2FA 5FTMA 3L7CA 3SSOA 1UDCA 4INOA 1JRLA 1NP6A 5JDIA 3VNUA 3B51X 2O6LA 1RHMA 3ZIDA 4K0KB 1KJWA 1Z8HA 1Q1NA 1MBZA 4JLAA 3O8QA 4ZQHA 2JCSA 2GXUA 4WNCA 3V34A 1WEHA 1G16A 2JDID 5FBKA 1CUYA 2LP4Y 4ZVKA 5KQRA 2AFIE 4GQIA 3PHHA 2PT6A 3WWZA 2PZ8A 4WCFC 5AI8A 5CYPA 4OIFA 3ZHVA 3OJOA 5CBPB 3W78A 4W9MC 1Q5PA 5EVJA 1FZQA 1VL5A 4AZWA 3DKIA 4OB8A 4Q3NA 1C5KA 1OBOA 3GAZA 4MVJH 1SUBA 3BX1A 5FOTA 4PQEA 2XBMA 5L3RA 4DQKA 3L5KA 1X19A 1GGMA 1CP3A 3RROA 1KKMA 2CVPA 1U3DA 1UC9A 4JKIA 4KXUA 3NLLA 3FX2A 1GQFA 1UJ5A 2VL7A 4HGPA 4HDRB 3BWBA 2HRRA 2VJQA 2JL1A 4NR0A 3AUSA 2IZ7A 3K5HA 3Q72A 5B1HA 5F98A 1GTVA 3IEUA 5F5NA 2ZOSA 3AL0C 1FDRA 1G63A 2WD8A 1NF8A 4Q4HB 3TQOA 1SQ5A 5AW6A 2A9OA 1V11B