1P5ZB

Structure of human dck complexed with cytarabine and adp-mg
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Deoxycytidine kinase
publication title Structure of human dCK suggests strategies to improve anticancer and antiviral therapy
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p5zB00
4TTRA 1DAFA 4QBIA 1G20E 4PZYA 3MWKA 2A3RA 2QT0A 3EZ9A 2BWJA 2ODWA 4HZUA 4TYWA 4A8JC 2F9LA 4QBFA 1ZUHA 3CRQA 3AB3A 2B8TA 2WMOB 4DEYA 5CLLA 2J0SA 1LS6A 2V8OA 3GJ5A 2OSBA 2JLUA 4GRAA 1S96A 4LDJA 5DYGA 1NJFA 4LBZA 3D6TB 1KOFA 1PUJA 4EPWA 2RB4A 3BB3A 3MG9A 2WVJA 3DDCA 1KNXA 5B57C 4KSBA 3ZD6A 5AWFC 2WKQA 1R5OA 2OCYC 121PA 4W7SA 2C98A 4DCSA 1G8FA 2ZJ2A 4D0GA 1VYUA 4CF7A 3MJHA 4Q7LA 2FMXA 3FFAA 1BS1A 3IBGA 1W4CA 5TMPA 2KE5A 4GDFA 4IFBA 2NO9A 4XJXA 2ZJYA 4L8GA 4LI0A 1KO5A 4B3BA 4C0SA 3QPUA 5AUOB 4OHYA 3QKRB 1LF0A 1EX6A 1E2IA 4LC0A 4MUAA 3GEEA 3TW4A 3TW8B 4RFSB 4TYPA 3BBPA 1YR7A 4OK3A 3KQLA 1KK2A 1XTJA 2FZ4A 1P73A 4TQAA 5LB2A 1YJ5A 1U90A 5J5CA 1CEEA 2GXQA 1XEXB 4I81A 1E9DA 2QPTA 1KI6B 1S3GA 2VHJA 5FBVB 3RWOA 4Q1CA 5FPTA 1A7JA 2JLRA 2PZEA 1U8YA 3EZ7A 1TQ6A 4QNMA 4XVUA 1Z06A 2WAXA 4MRRA 2GBLA 1G8HA 2IL1A 4RCZA 3PUYA 3IEUA 4PZZA 4V0LA 1HA3A 4OYHA 3O8RA 1JQJC 3B9QA 4JLOA 4JKIA 4WAUA 4A2WA 5JEEA 1EFRD 1DARA 2GILA 4EPXA 3B85A 1VYTA 1EFRA 4G01B 3FPAA 3BFVA 4IOMA 1II8B 4B2IA 3ZVNA 4TMWA 2C5LA 4QHTA 3G82C 5EZ6B 2FPMA 2XX3A 3EZ6A 4KO8A 1TAGA 2WTUA 2A5YB 2H1LA 3RABA 2C2HA 4M1YA 1CR1A 1KI8A 1U8AA 3K09A 5H70A 1N3BA 2NOAA 3AVXA 3BC1A 3EAQA 4RD3A 1M7BA 1XD8A 4C2TA 4WZAE 2ZR0A 3NEYA 2CK3D 3FYHA 4AKHA 2CK3A 5DI9A 3R8FA 1EK0A 1WCV1 4URZR 1SVSA 5GJWC 4UNPA 3MWYW 5EE3A 1XEFA 3HU1A 3VFDA 4CT4B 1NLZA 1XJCA 4TMKA 2JIZD 3Q72A 3ICEA 1VYVA 2JIZA 3BH6A 5JJLA 5L3VA 1I4LD 3KKPA 3NDBB 4KAXA 5KSYA 3HP1A 2F3RA 2WSSA 4I1VA 4R9UC 4DDTA 5JSZA 1JALA 1HT1E 2ATVA 4IDPA 1NMZA 1EFUA 2CLSA 3L8ZA 3REGA 2BMJA 1VMAA 4URVR 2CMKA 1UEJA 4WZ6A 1UAAA 1F60A 2IW3A 2FV8A 1OB2A 2X19A 1KDTA 2IXEA 2O8BB 1ZD8A 4LJYA 3SJBA 3HPQA 3IO3A 2OM2A 5HR5A 2XXAB 3FFBA 2AK3A 1KKLA 1G3MA 1XJ0A 2H57A 2QP4A 2V4ZA 3NIBA 3TIFA 4BE7B 5CDFE 5M04A 4I1UA 4AKEA 3THWB 2P6RA 1F3OA 2WKRA 2Q0HA 3QEOA 4TLAA 4ERNA 1KMHA 1KSHA 4JVNA 5FUVA 1FZQA 4TTPA 2IYRA 2Q3MA 1XJQA 1XEWY 3GJ0A 3ZVLA 5HKKD 4IVQA 2PMDA 3LAWA 4HAWA 1S3SA 3SC3A 4N0EA 2AL7A 2YOGA 3NC0C 3RAPR 5HKKA 4KJZA 4UXJA 3F8TA 1A2KC 2ZYTX 4LX0A 4OI0A 3VKHA 2GAAA 1W0JD 4K46A 2HYDA 1AZSC 4A0RA 3JZAA 2GK6A 1OT3A 4B74A 2Z5FA 2O8CB 1ZU4A 5DE3A 3KXIA 4V0MA 1SQ5A 3DEFA 3EA5A 2Z0MA 1MR3F 4HB2A 5UKDA 3SS8A 4BZXA 1VCNA 3U3KA 3U7HB 2W0SA 5EP3A 2DR3A 2IWHA 3HJNA 1NMYA 1XD2A 1A5TA 3WYFA 4B44A 2BV3A 3W3AA 4KYUA 4URWR 1XCPA 1G6OA 1U98A 2ZVPX 4RFVA 5EJEA 1N5KA 4CZ2A 4LUCA 3CX8A 2P6NA 2QQEA 4FCWA 4M1TA 4L4UA 5JCPA 2WPDA 3P27A 3RVBA 1R8QA 1CS4C 3SR0A 5L8VA 4KVAA 2UKDA 2D74A 4NCKA 3N5CA 3NC1C 2GJ9A 3OE7A 4P4SA 1F48A 4V0OA 4HYYA 1N0WA 3BH0A 1JR3D 2BCGY 4FD2A 4U7DA 3I92A 2XB4A 2WJHA 1E6CA 4ZIRA 3L0OA 2F43B 2Q3FA 2PJZA 1YZTA 5FL7D 3QEJA 5L3QA 3QF4B 5FL7A 3LVRE 2HT6A 1KDPA 1CKEA 1U81A 2FZLA 1EFTA 1GL6A 3RWMB 4IDNA 4LJ7A 4RD0A 1IN8A 4OL0A 3BFKA 1YZUA 1Z47A 5BYKA 1XTQA 4D0NA 5FUXA 3RS5A 2EFGA 1JAHA 1KI2A 3FHOA 3JVUA 3AV0B 1BOFA 2OUKA 4M1WA 3O8DA 1Q1QA 3AVTA 1DG3A 1JPNA 1W46A 3KJIA 3Q7PA 2PL3A 2QRNA 5A4JA 3B1VA 4IW3B 2V1UA 1K6MA 1W48A 3EG5A 3QOFA 1SXJC 3CH4B 3MFYA 3OESA 4L16A 4PR0A 3RHFA 4HATA 2WJIA 1XXHA 2OAP1 1GL9B 1QRAA 1W47A 5DIFA 1OXVA 8OHMA 4O2RA 2VSOA 1TF2A 4JKYA 1ZM4A 2GXAA 4DIDA 1FUKA 3K70C 1DAMA 3PUZA 1JR6A 3I8XA 2IEZA 3GLGB 4CEIA 1HYQA 1BH2A 4OJQA 3TQFA 1S8FA 2GJAA 5CIWA 2SHKA 1DE0A 1P62B 2G0TA 1YZKA 2NIPA 3JZMA 3X1XA 3KJEA 4FCVA 5BQ5A 3HYRA 3THXA 2IS2A 1ZYUA 4LY6A 4XSGA 2QAJA 2XJ4A 4L5BA 4R98A 3DZ8A 2R6AA 2FG5A 4ARZB 4ABYA 2ZI9A 2GCPA 2O5VA 1UJ2A 2I3BA 1ZCBA 4QOSA 4LV8B 3THOA 2C9OA 2ZRKA 1K5DA 4P32A 5DGXA 1XNJA 5TV2A 1CBUA 1YVDA 4GNKA 4W5WA 2GKSA 4M22A 1K5GA 2ZQ5A 3W6PA 1GWNA 2NPFA 5JLJA 2LKCA 3TR0A 1N2CE 2OAQ1 4NYIQ 2ZPTX 1PLJA 4OQLA 3U61B 3CR7A 4GZMA 3Q5DA 1XTIA 2REOA 3HWSA 4B3GA 1GSIA 1VTKA 1RPZA 1JB1A 1LV7A 4XSHA 5CK5A 2QE7D 2XOKD 4W5HA 3PUVA 4Q9JA 5CB8A 2HT1A 1DAHA 1GDDA 3NTUA 1MABA 4IOKA 3RNLA 2J1LA 4OHVA 4KI0A 4NYJQ 1NL3A 3CONA 3DMDA 4RZ2A 2FSGA 5C4GB 3SE0A 3VHLB 2YZ2A 4BEBA 2ZAMA 4D4KA 5HPYB 3K9HA 3LNCA 1W0KD 2FGKA 3PXGA 2QAGB 3SJAA 1W0KA 3EWSA 3B9PA 1L2TA 1Q44A 4IKEA 3T61A 4DB2A 1N6OA 1YRAA 1ZM9A 2YC4C 5H1YA 2O8FB 1ZNWA 2HEIA 4M1KA 3AKEA 4DLTA 4IOJA 2ZE5A 1J90A 1U9IA 3DL0A 4OK6A 2BBWA 2X8AA 4YXWD 1Z6TA 4BLTA 5HE9A 2J46A 2V6JA 2VF8A 3HR7A 4YXWA 2X1VA 3UMSA 2WM9B 2H5EA 1E1RD 2WZQA 1KDOA 3WMGA 4Q1BA 4UNQA 1E1RA 3THYA 3CRRA 3EXAA 1X6VA 1C4OA 3E5HA 3QI2A 4Q4JB 2YWGA 1E2HA 2BKUA 4WXRA 1G8PA 4KBFA 4PC6A 5FOXA 3KQHA 1RYHA 1CR0A 4AYXA 1RRCA 2IWRA 1W49A 2YWHA 5CIQA 1W36B 1BO6A 2QA5A 4LBVA 1WBDA 2CL6X 1VG1A 1QHGA 3S1AA 4HLDA 2D7CA 2ZJ8A 5BYJA 1Z22A 4ASUA 4DUGD 721PA 3SYLA 3NKVA 5JBQA 1IONA 4ZI3A 1DAKA 3T35A 4DSTA 4RD6A 3LFUA 4Q00A 4XWKA 1OXTA 5J47A 3KKOA 1KKMA 4NKRA 3I1FA 3IIMA 2HCJB 4KLNA 1Z0AA 4V02A 1AKEA 1QG4A 2G1JA 4XVRA 3Q8XB 2VLIA 3GLFA 3ZQ6A 2ONJA 4JVMA 4LYHA 4ESHA 2D06A 2ZJOA 1FNNA 4QNRA 3A1WA 3KB1A 2BBSA 1XU4A 2X2EA 5LBIA 4ZDJA 2PBRA 3BD9A 1NLYA 3QKSA 4L9SA 3AF4A 1LFDB 4D25A 4ZCLA 1JPJA 2O0KA 5EP1A 4TLBA 4FI3C 5BWMA 1PJRA 4LYAA 1G19A 4NTZA 2VIIA 5TARA 4NYIR 2IS1A 4AURA 4JT4A 4TSFD 4QM6A 1YE8A 2Q9CA 3K0EA 3AKCA 1CXZA 4HB0A 5KPDA 1UBEA 4U02A 4ZDWA 3GJXC 2MSEB 2WWXA 2ERYA 3DM5A 1AKYA 3HYTA 2QMUA 1W2HA 1TQ2A 2E87A 3MAAC 4NYJR 1CJUC 4EQ6A 3N70A 2OEPA 5EE1A 1G4AE 1R7RA 4OK5A 2XNDA 1AQYA 1E32A 5JWRA 2H8KA 2GZAA 3CRW1 4Q4AB 3L2OB 4MYHA 1S2MA 2WV9A 2O52A 3LV8A 4S35A 2IBMA 3CX6A 1KO8A 3PEUA 4YMSA 1U2RA 2EQBA 2ZYWX 3JVVA 5KSZA 1MO4A 3GJ4A 5F98A 1UBCA 3L43A 1X8KA 2OFOA 3UKDA 4BRUA 1FTSA 2ZUCA 3MUFA 1OKKD 3U3OA 5JFGA 4QG7A 1QHNA 1OKKA 2WAYA 2H16A 4Q4LA 4D82A 4FMCB 1KSJA 4UJ5A 4ZV4A 3T1TA 2EFDB 1UADA 2F7SA 2VP2A 1E0SA 2Z43A 5IHPA 1SVLA 1P60A 2VSXA 3NEJA 4EJSC 4NCJA 4C0HA 4MRPA 2QT1A 3GPLA 1LNZA 3LBNA 1LS1A 5KUTA 5KOYA 3U6KA 1G3QA 3QPWA 4BQSA 3PITA 3DO6A 1W4BA 3DVLA 4DEXA 1AQUA 3GJ7A 1C9KA 2CHQA 4JLDA 3NH6A 4OQFA 2WWIA 1JBKA 3SFZA 2PX0A 3PENA 4OQMA 2FDCA 2IEYA 3HU2A 4GOJA 3C41J 3FMPB 4BPBA 3SDZA 5EUQB 4C0AC 1W5TA 2ZR7A 4YMWA 3KKMA 4F4IA 4TMVA 4O25A 4Q7JB 1E0JA 2C99A 2JLZA 4DT1B 5IDVA 1G17A 1VHTA 3NBYC 5TY0A 1WA5A 1KJWA 2VHQA 5H68A 5TDHA 3W8RA 3UMRA 5K8IA 2NO6A 3FTQA 5AJVB 4HI0E 4P4UA 3SN6A 3TJZA 4GOXA 3ICQB 4EKDA 3SOPA 3VR1A 3GLIB 2W6ID 4G1UC 2IUUA 3I62A 4FMDF 2O8EA 4JBXA 5JHGB 1HURA 2XSZD 4MKHA 4NZYA 3VKGA 1R0ZA 2V7QD 1ZM3A 2ZRHA 3CR8A 4LJ8A 1RW4A 2CVFA 3A4NA 1YR6A 5KNDA 1W2GA 4MITA 4MKGA 4N1AA 4LOAA 2WHXA 4Q1FA 2UZ3A 4F38A 1IY0A 2JLVA 1G7CA 2IYYA 5P21A 4D4JA 4CW7A 2XZLA 3OEHD 1R5NA 1XEWX 3AM1A 1N5JA 1WE2A 2ODNA 2B8WA 1M8PA 2ZRLA 3KXLA 221PA 5C46F 2OBNA 1Z6YA 3Q7QA 1P9RA 3R7WB 2ZVQX 5CYPA 4C2UA 1GITA 4LJ9A 4KCGA 2G88A 3GFTA 3LX5A 1R0XA 4HLUC 3NDPA 4G5RA 4M9ZA 1XPRA 2B6HA 2NO1A 1J99A 3IPYA 2WJJA 4JZKA 5CK4A 3B1WA 5D3MB 3WNCA 1KDRA 1WRBA 1DO2A 2ZU6A 3K9NA 4DKXA 3EIQA 5DN6D 5C2JB 2A30A 2IT1A 4Q48A 4JVSB 1Y3AA 3U3RA 1Z08A 4P4SB 2KB0A 3EPLA 1SVIA 2OESA 3BXZA 4B47A 4DSNA 4LSGA 2HXYA 2XTNA 3HR8A 2PLFA 4FINA 2FF7A 2GCOB 2ZJBA 4B3DA 5JRJA 2IYVA 4U5XA 3IUYA 4IOLA 2F55A 3R9WA 5EE0A 4N3NA 4F92B 5B58C 2J41A 1NKSA 2BJVA 2HLDD 2GA8A 3BS4A 3LBIA 4JS0A 4PTLA 4KFRA 1SXJD 3BJIC 2BDTA 3QPVA 2GESA 1SXJA 1Z28A 4ACBA 3K0FB 2BVNA 4BASA 1N0UA 4P4TA 3WMFA 2VA8A 4WA7A 1IXRC 3OEED 5SZHB 4A4DA 4LC1A 1YZQA 1UM8A 1E2NA 2ZI6A 4HUTA 5C18A 1N5LA 2YYZA 1DAEA 4GI7A 1KK3A 1M1YE 1HEIA 4OHWA 4OQNA 1AS3A 1US8A 3DZDA 1ZUIA 2K5UA 3C15C 4DLYA 4QBHA 2IHYA 2BCJQ 2QRZA 1QBKC 2ZSAA 4YDHB 1FL9A 3U7FB 2DB3A 3SNHA 1GL7A 1J2JA 3ZDQA 4Q47A 4AD8A 2BJWA 1YKSA 2L0XA 1Z6AA 2VRWA 4C7OA 2YJTD 3I8SA 3P4XA 2C77A 1N6PA 1O3YA 4H1VA 4DIEA 4EFNA 3U44A 1NN1A 3AP1A 4GT1A 5FTLA 1U9IC 5B2ZA 1E0AA 1RJ9B 2OFWA 2GJ8A 1GTVA 4C9BA 1FQKA 5L3SB 3AVWA 4BFSA 4YONB 1ELOA 1XRJA 2OBLA 1UDXA 1GRNA 3U3JA 1VG8A 2YHSA 2FFHA 2ZYUX 5BN4A 1AJEA 3AF2A 2ODEA 5G40A 3BFXA 3U4QA 4POAA 1VCIA 2VHCA 1ZAKA 3U2QA 3A8TA 1Q1EA 1KGDA 3BGWA 1ZD1A 1G16A 1PUIA 1ETUA 3PG5A 3T06B 2UZIR 4YMTA 3T34A 3I73A 1PV4A 1HTWA 1NNEA 2WMNB 2OCPA 3WYAA 1KI9A 4TL8A 4FCTA 1P2SA 3FHTA 3O47A 4E03A 1Q1ZA 4CEJB 4MA4A 1A82A 2WOOA 3B5JA 2OFXA 2QUZA 3T1VA 1NSTA 3Q5EA 4IEEA 5CJPA 4KU4A 4MYTA 3QE0A 4Q9KA 4EUNA 1PVOA 2W2TA 3LA6A 3OHMA 1NI3A 1NBMD 2IXFA 5LDDC 2IXGA 1I4DD 1NBMA 1QVRA 5F9HA 2R8RA 4LHVA 2O0JA 3KB2A 3GQBA 3SBDA 3V00A 2GNOA 1RFLA 3CRVA 2FEMA 4P31A 5E7MA 1E2JA 1EGAA 1N6RA 1VDZA 4RD4A 1L7VC 2OZEA 3TR5A 3FOZA 1FX0B 1IY1A 1ZJ6A 2Z83A 4RVCA 3KDSE 1GRRA 1SVMA 4UJ3A 3WP1B 1UPTA 4V0KA 2CHVA 4E07A 3EIHA 3VU9B 1G3UA 1G5PA 2FPKA 1Z2CA 4HUQB 4A8JB 2IK8A 2ZANA 1AZTA 3FDIA 2DHRA 3QKUA 2XEXA 3TSOA 1TNDA 4WXPA 5AJXA 4IXMA 1HQYE 1P3JA 1NVXQ 1I2DA 1NN0A 3OF5A 4KSCA 3LLUA 1LTQA 3RYTC 2QTVB 3K0CA 4HAVA 3MGCA 2YWFA 2CJWA 1OIWA 3EPHA 1S9HA 4OKSA 1H8ED 1QHHB 1CR2A 3KQUA 2JA1A 1E2FA 2VHTA 4TZ0A 1XTSA 3UXMA 2OBMA 1SVWA 3ADKA 2CBZA 1ZBDA 3KX2A 4JSTA 5DO9A 4ZDKA 1X8JA 2BMFA 2BC9A 2NO7A 4FWTA 4JLNA 5FOVA 3W6NA 2C8VA 1GOTA 1KNQA 4G5OA 3I5YA 1IXZA 4ESVA 4PPFA 1GP2A 2V6IA 3RRMA 4A9AA 2AFHE 2FEOA 1GKIA 3CPHA 5IK2D 5AR1A 5IK2A 1DAGA 3VNUA 4Y0AA 1VHLA 2FSIA 2RGCA 1FOEB 2G77B 3IQWA 1Z8FA 4KXFB 2KBEA 3ZZTA 4DXAA 5FBLB 2YV5A 2ZM5A 2WIAA 4QGHA 4W5JA 3J81k 4XH9B 3CIOA 3GLHA 1F2TA 3B1YA 3PFIA 2QSZA 3B6EA 4MGYR 3GLFB 2MMGA 1OH7A 1F2UA 1FPMA 3T5GA 4ITRC 2WWWA 3RRNA 1VCMA 5J40A 2CCGA 1DOAA 2W58A 4MDFA 1N6HA 3RC3A 1KMQA 2GF0A 1EX7A 3CF0A 4HDCA 4R7ZA 5FOTA 1FP6A 2ZRCA 5K8LA 2CVHA 3ZYCA 1TEXA 3NBXX 2P67A 3NHAA 3H1TA 4A0GA 2VH5R 1W4AA 4WIAA 1W0JA 2H92A 4MDEA 1SHKA 1ZC3A 4BFVA 1IBRA 4FW9A 1G64A 4XOIA 3AVYA 3TMKA 4YC7A 2CEAA 4GPTA 1CRQA 4QL3A 2CL7X 2GEVA 3A36A 3VTKA 4TN1A 3PCRB 4JYCA 3AVVA 2VQSA 1WQ1R 2VP5A 2GZDA 3VX3A 3GP8A 2QMHA 3NBFA 5DI3B 2JJ1D 4EQ6B 2EYQA 2JJ1A 1Q3TA 2OV2A 1G7TA 2OLJA 1FMJA 2JEOA 4A0HA 3QXXA 4X8OA 3QBTA 2RGGA 1IN5A 1KI3A 4EJSA 4M1SA 3PEYA 1H8HD 3KJGA 3MJRA 4CRWB 4ZPXA 4O0MA 1XX6A 4MYCA 2ZRDA 2VF7A 1YU9A 1NVWQ 1FW6A 3CF6R 4BECA 4MGIR 1KY2A 4PC3A 4D2IA 1JR3A 1DPFA 3A1TA 4BFUA 2D7DA 4B3XA 4Q5IA 4IXNA 1GIAA 4LJ6A 4PHHA 4C3ZA 4W9MC 3LXXA 4HAUA 2C04A 5KSOA 2FH5B 3ND9A 3PV0A 2X2FA 3H2YA 4L9WA 4E09A 1P72A 1WXQA 4G0NA 2JATA 1OH5A 1D9ZA 1RKBA 4JL8A 3ZVMA 3D31A 1ZCAA 2F1JA 3DKPA 1DBSA 3W9YA 3WNDA 3B82A 1IJFA 5EP2A 2OCAA 5CM8B 3VNVA 3EW9A 4QJ4A 2QBYB 2C9CA 2ZRBA 4Q1DA 1ZIPA 4PPQA 2FE4A 1P2VA 3IEVA 3EPKA 4LPSA 1HUQA 3G0HA 3U5ZB 2QU8A 1RIFA 3SFVA 1P4SA 5BN3A 4TZ6A 4V0NA 1NG1A 3EASA 4A6PA 1VIYA 1UDWA 1ZW6A 3A1UA 2CXXA 3HU3A 3L0SA 2ZJAA 4CEHB 4NMMA 1BIFA 3KZ1E 4XD7D 1D2MA 2J0UB 2GK7A 3LW7A 4MRVA 2KI5A 4XD7A 1XB2A 1XMIA 2GZHA 1D8TA 1H65A 1GKYA 1R6BX 4M9QA 1NG9A 4I1OA 4HDOB 4US1R 3SEAA 1OFHA 5HZKA 3GLGE 1E69A 4BUJA 1Q12A 4PC1A 2A78A 3TBKA 4EIWA 5JCZA 4HLUA 4B3CA 2ZETA 3WMEA 1XCGB 3QXHA 3NBZC 4LJAA 1E9AA 4IJMA 1Z0IA 1JEEA 3OFND 4C0KA 4KODA 2BOVA 3P20A 3OFNA 2JJ8A 3KUDA 4IDQA 2WIBA 1WBBA 4D81A 3KFVA 4URXR 2HV8A 3WRYC 4FN5A 5JS8A 2JAQA 4LV5B 2LCFA 3N2EA 1KSGA 3E2IA 5FUWA 1G7SA 3RS4A 1E2PA 1CF4A 2O8DB 3C14C 4PZLA 3VR6A 1MT0A 3LO5A 2GJSA 1RZ3A 3AVPA 3H86A 1YR8A 2AX4A 3LY5A 4G3XA 2KSQA 3OIUA 1Z63A 1S1MA 5SZKB 3RS3A 2HDNB 3IPXA 4TMXA 1MKYA 1W5SA 4BLOA 4LPKA 3K0AB 3L0IB 2VP9A 2J0QA 2ZRPA 1II9A 1UKEA 2X77A 3WP0A 3MRSA 1GUAA 1NLFA 3ZD7A 4BFZA 5D3QA 4PHFA 1U0HC 1G6HA 1ONBA 4GP6A 1R5BA 1XBTA 2KBFA 4DCTA 2GWHA 3IGFA 4WW0A 5JHHB 1W36C 3QKRA 1EESA 1WDTA 1DG1G 1TQDA 3K9LA 4RFSA 2HCBA 2QE7A 2XOKA 3LX8A 1AGPA 1IY2A 4FIDA 4IVRA 1T0HB 2NZ8A 1XEXA 1ESMA 3I4LA 4LHWA 2ZE7A 2ZI7A 4EPRA 3B1XA 3X2SA 1KI6A 4RCYA 1ZC4A 2J3EA 3CH5A 4DRZA 3H84A 4OHXA 4YDSA 2GEDA 2JASA 3LRPA 3C7KA 1G3RA 5JS7A 2AHOA 2ZIAA 1GZSA 3FKSD 3QF7A 5GVRA 1E2KA 2V55B 1RRGA 1ZD9A 3BOSA 3QG1A 4KHZA 5TB5A 4D4LA 3K70B 1IN4A 4NU0A 2OXRA 4Q21A 5FI1B 1T3HA 2GVDC 3RS7A 2BIFA 4NHOA 2VP4A 1JEDA 4P0TA 5DISB 1Z2AA 1Z6XA 4ZO4A 3W3ZB 4JJZA 4P33A 4TMTA 2I1VB 3BB1A 3CUEF 1II8A 5J4LA 5KYKA 4A82A 2IYTA 4BLPA 4Q03A 1KSFX 2DFKB 4MQBA 4DBLC 5EUMA 4Q4HB 3W8NA 5FUYA 4US2R 4PSAA 1L4UA 2FFQA 4HZUB 1R8SA 621PA 2PH1A 5KO2A 3UIEA 4QM7A 3CX7A 2ZE8A 1C1YA 3WNBA 4D4MA 2IYUA 2JCSA 2PCLA 4YQFA 1G291 3TVTA 1D9XA 4JJKA 4DUGA 2FFBA 1P61B 4B34A 2FSFA 2XB2A 3LQQA 5E95A 5DHAA 3K0CC 1KZ7B 4Q7MB 1ZRHA 2FGJA 2GXSA 5EXXA 3B2EA 3M1IA 4PFSA 1TUIA 2YWEA 5KHOC 4NCNA 4ZDIA 4AC9A 1BKDR 4WOPA 5DYIA 2N46A 3RSOA 4CYMA 4F7WA 1TPZA 2EWVA 4A36A 1JQLB 5JRZA 1U94A 1KZGB 1IOZA 1S4QA 1GVNB 1G5TA 1CJVC 1NVVQ 2G83A 4JSYA 4AY2A 2OT3B 3SU8A 2XAUA 4JBYA 4C0LA 5IT5A 1Q1BA 1KAGA 3RRYA 2O8BA 2A5JA 4MH0R 1E2DA 4QGAA 4P3YA 5DLQC 4EPYA 4DWJA 4WVFA 2XXAA 1ZP6A 1MO3A 2YKGA 3RDPA 4D0LB 2HUPA 1Z83A 4A2PA 3GJ6A 2CL0X 4DVGA 3THWA 4KBGA 4LHXA 4BEJA 5JJKA 3MCAA 4DSOA 4XWOA 1JXOA 5FH9A 1CIPA 1CJMA 1FUUA 3DKVA 3VR4A 1KI4A 5CDFA 2ODBA 4TSFA 1GKUB 2EFHB 3D8BA 4LYFA 1X1SA 5F2EA 1TUEA 4LWZA 3HPRA 2AN9A 3FVQA 1GRQA 3ZZUA 2OHFA 3LBHA 4RD1A 2PMKA 5FBRB 3OIVA 4PO9A 4BLSA 4TLCA 2OCBA 3K0SA 2O8CA 1LF5A 5LD2B 4QRHA 4BLQA 3E1SA 1A4RA 3QBVA 4PQRA 5LB4A 421PA 5BN5A 3PJRA 2P5SA 2AXNA 2R65A 5K8UA 3RS2A 2DYKA 2DFTA 2ZSBA 2VO1A 2AWOA 2W6JD 2BM0A 3LQRA 1E79D 2W0MA 2Z4RA 3PEWA 2ZRJA 2RHMA 5F9FA 2ZUDA 2HF8A 3C16C 4PO8A 1E0KA 4JMPA 4TTQA 3ZIAD 1TMKA 1NKTA 4M8NE 4YLGA 2ZS9A 5A0FA 1G3IA 1NJGA 2ZEJA 3AP2A 1W1WA 3MWJA 4AYWA 4QBGB 1XWIA 2D2FA 5TXGA 3TNFA 2XZOA 2YINC 2ECKA 1UFQA 5JSZB 4BLRA 1GNPA 3BK7A 1OH6A 2IA5A 2ZR9A 1G9XA 3I3SR 3CWZA 2Z6VA 1NRJB 3SHWA 3QSYA 1T91A 2QTHA 4TL7A 1W4RA 4RJLA 1P9WA 3OIWA 1OFTA 2F43A 4B71A 1TEVA 1KK1A 4QJ3A 3VAAA 3MD0A 1R10A 3A1SA 1EG7A 3IO5A 3AF1A 3QF4A 4FMCF 1A2BA 3U60B 4WBSA 3OZXA 3QXCA 1T5IA 3EARA 1SHZA 5J4YA 3GLIE 2A5FA 2DFNA 521PA 2AD5A 1KMHB 2RH5A 4D80A 4HB4A 4TQUS 4OQXA 1EFHA 1NVVR 1ODFA 2CCKA 2R62A 2AR7A 2WJVA 3PUXA 2TMKA 1HE1C 5CLQA 1QG2A 2W6IA 3A4MA 4MRNA 1O87A 2FX3A 4LZZA 2IX3A 1XPUA 1IXSB 2XSZA 4R2IA 2RHDA 2RKOA 2CLDX 2OXCA 2V7QA 2D2EA 3ZS9A 4OHZA 4F4CA 1NIJA 5FPSA 5JZVA 3BH7A 1OLOA 2PT5A 3CZQA 1N25A 4Z1MD 1D2NA 4Z1MA 3CPEA 3CWQA 2ZSFA 1KI7A 3P32A 3QY0A 5J4VA 4AWXA 4PC7A 3V9PA 3FMFA 3OEHA 3BWDD 1J8YF 1XZQA 3BE4A 2BMDA 4A6XA 3GFPA 1XD2B 1M2OB 4Q9LA 1FMLA 3QUSA 4PAMA 4NL4H 2NO0A 2B21A 4QGGA 3IIKA 5FOUA 1CTQA 1Z0KA 3UMFA 4TMZA 2YOFA 3SHFA 3NH9A 3LLMA 2DFLA 1OJLA 4D26A 2WWFA 3W90A 4EJSB 4PHTA 2Q9AA 1GFIA 2ZE6A 4TLEA 5GJCA 4Q9IA 3SYNA 1MOZA 2R9VA 3OAAD 3O8BA 5DN6A 5EXTA 3FGNA 4LCBA 4MUBA 3GFOA 3OAAA 3V4RA 4ARZA 4LBYA 2H7VA 2IUSA 4A1FA 1D5CA 1MRNA 1QHSA 2QL6A 4NCHA 5J4HA 2O0HA 3CKLA 5JMTA 4JLPA 4LV6A 1G21E 1IHUA 3X1DA 3I32A 2BHRA 2KJQA 4UNRA 4CDGA 2QMEA 4Z54A 3WRXC 1PLLA 4ZIRB 1MRSA 3AP3A 3VX4A 3LXRA 3AVUA 3KQNA 2HLDA 3A4LA 2Q3HA 2F9MA 4B6FA 3VMFA 3WY9A 5L3QB 1NF3A 1JECA 4MGZR 1CJTC 1AA9A 1F6BA 3GEIA 2BEKA 2ZUBA 3UK6A 4DLSA 4G5SA 1Z6GA 3EC1A 3F3YA 2FJUA 3OEEA 5CM9C 4C30A 1WMSA 1OPXA 2QM7A 3SQXA 1XZPA 1P2TA 2P2LA 1ZMXA 2PX3A 4JLJA 4QC2A 3KKQA 3U3MA 2REBA 3W5JA 1U99A 3TSZA 4TL6A 4B75A 4UXIA 1OB5A 4RKEA 2WWGA 3M4YA 4DLRA 2DWPA 4N0DA 2YOHA 1NMXA 1X8LA 3QXSA 1TQ4A 2QAGA 1JAIA 2VSFA 4PXAA 2A5DA 3M6AA 1KJYA 4M9XA 1RE0A 2ZXUA 2NGRA 1N5IA 1WP9A 1YZLA 2QGNA 3KFXA 3TAUA 3ZH9B 1XXHB 3DMNA 2O8FA 2G1KA 3WBKA 2ZRGA 4TLDA 2F3TA 3H4MA 4HEJA 1SGWA 5AUNB 1W7AA 2IS4A 5DHFA 1VG9B 5EP4A 1UF9A 1ANKA 5FOSA 5CITA 4CEIB 4B35A 4Q01A 1V43A 4Q7KA 2ZI3A 4Q1AA 3K1JA 4FXPA 5C4MA 2Z4SA 2JLQA 4NYMQ 5GJBA 3FE2A 3WYGA 2JLXA 3SJCA 1BMFD 2KWIA 1UKVY 3THXB 2ORWA 1BMFA 1N6NA 2XTZA 3BAFA 3ADDA 1OSNA 2EU8A 4PPNA 1W36D 1TX4B 5TVKA 1E99A 2IC5A 3Q85A 3QVVA 3VR3A 1T3LA 4IRUB 2GAOA 1CJKC 3B7GA 5JI2E 2EW1A 4IEIA 2J59A 2FOLA 1DEKA 5B64A 4IFEA 4PSVA 2VYFA 4XTCS 4CGZA 2MSCB 5FR1A 2ONKA 1DTSA 3ZZ0A 1LY1A 3UWKA 1FQJA 5HCIA 1RYFA 1E2LA 2GF9A 3ASZA 3AUXA 3TSWA 4E5UA 2A5GA 1CULC 2IYQA 4IHQA 1RVDA 1UKYA 1GNQA 2UVQA 1TU4A 1J7KA 1FNMA 3F5FA 4C4PA 4PQYA 1XMSA 3T15A 3A37A 3R9XA 4QFMA 4AG5A 1MABB 4M1OA 3QVUA 4DDUA 2FFAA 2JJ2D 3TK1A 3TQCA 1FP7A 4TQ9A 3U7EB 1GM5A 2JJ2A 2F1HA 3V4FA 2NZJA 3PR1A 4RZUA 4Z8XA 5KU1A 2CE2X 4UQOA 2J45A 5H8WA 3RLFA 2DWOA 5E7IA 2ZYVX 3TE6A 3VR2A 4L15A 5G3YA 1KO1A 1LVGA 3VKWA 4YMVA 3UG7A 2VEDA 3C5CA 2IYWA 3IIJA 4EPTA 2DBYA 3GJ3A 2Q21A 2CLCX 1T8UA 1R0YA 2BBOA 4V03A 1R2QA 2WWYA 2DCUA 1KI1A 2QP9X 2R2AA 1Q22A 4M1MA 4RZ3A 3TUIC 4A0FA 1Z5ZA 1G8YA 2OG2A 3THYB 1J8MF 4ZCIA 4ZKEA 4IDOA 1H8EA 3FMOB 2G9NA 4Q4AA 2AKAB 4X8MA 4B48A 2ZU0C 2W00A 4DHEA 2J0VA 1II0A 2RCNA 4OI2A 3NHBA 4AG6A 2NQ2C 2QEQA 1Q21A 1SULA 2A2ZA 3WXMA 3PUWA 4H1UA 5FOWA 1T0JB 4Q19A 3S1AB 2PLRA 2W83A 3L0PA 2GCNA 4OI4A 2R6DA 4JL5A 2E1RA 2QQ0A 4PX9A 4KFUA 3ZQJA 1TADA 2J87A 3DHWC 1N6IA 2J7KA 2ZSEA 3QKTA 4NYMR 1PLKA 3GLFE 5FPKA 1K8RA 2WSSD 2QZ4A 4ON9A 4A2QA 4QGFA 2REXB 1QHXA 2JLSA 1EXMA 2PZFA 2GXUA 2AD1A 1NIPA 1XD9A 3EZ2A 3GCGA 1KO7A 2EFEB 3B78A 3IBYA 4QKQA 3CNLA 4CIDA 2FPLA 2N42A 5DH9A 3K9GA 3ASYA 3LD9A 1KO4A 3LDAA 2IF2A 4LK2A 3FKQA 3QKSB 4PPGA 4Q66C 2QTFA 5JWHA 3EX7C 5CYOA 1Z29A 2ZREA 3CM0A 1XTKA 5IRCD 2CE7A 1KAOA 5ELXA 3B60A 1W44A 1G4UR 1UBFA 1SZPA 3LVQE 4DT1A 4GSYA 2LKDA 3A1VA 1YRBA 1ZNXA 3I61A 3R9IA 2ZS8A 2QN6A 3KTAA 4MRSA 2AK2A 2EWWA 1WF3A 3GLIA 4HDQB 1DADA 2AWNA 2C95A 3DM9B 4XVQA 5AJWA 1MO5A 4G5QA 1X86B 2WKPA 4LHZA 2G3YA 4X8HA 2QI9C 5SZIA 4DCUA 1J70A 2C9YA 4O3MA 3MLEA 3MSXA 1YQTA 5FTJA 4II7A 2P3SA 2GEUA 2ZITA 1KJZA 2V9PA 2DPXA 2I4IA 3VHXA 4D6PA 4MKFA 2RGEA 2HF9A 4MKIA 1TL7C 4QJ5A 1H8HA 1Q0UA 1SKQA 1PZNA 3OIYA 4Q9HA 3BORA 3R7WA 4F91B 1XTRA 2RGAA 3KL4A 2V54A 4GMDA 3UPUA 4GOKA 4NDZA 1P2UA 4X8LA 1JI0A 1KK0A 4M4SA 1T9HA 1COWD 3DOEA 4DLWA 2R6CA 1MH1A 1COWA 4AI6A 3PEVA 1ZU5A 3A6PC 2WPDD 2ZSDA 4GMXA 4Q18A 5D3MA 3QJYA 3BERA 2RGNC 4U00A 2ZRNA 2IUTA 3B8HA 3OE7D 1DELA 1M74A 1DVRA 1NP6A 4DJTA 2H17A 2JLYA 2IYXA 5ANRB 3ND8A 3EPJA 1OFIA 2BM1A 3HDTA 2GCOA 1NY5A 4K81B 5AJYA 2HYIC 3CRMA 1G18A 3ZS8A 2EVWX 4Q1EA 3IQXA 1KHTA 1DAIA 2YC2C 4BRWA 5KTYA 4EPVA 2FSHA 4MGKR 4HZIA 1E4VA 3ONWA 4B2LA 4AYTA 4RKFA 4JT2A 2VPPA 1AM4D 4HAXA 4B2PA 1OYWA 3K0FA 4M9SA 5FPHA 3ZLJA 3QXJA 4XWAA 4JIMA 4F4JA 1TF7A 1GG2A 5CJ2A 4GFDA 3I5XA 5KSPA 1E9RA 2P0EA 3EWAA 1G8GA 5SZJA 2D62A 4DZZA 1E2EA 5A5GA 2O8EB 3D7MA 3SYKA 1TTTA 5KDDA 4EFMA 5EE9A 4QXAA 3D3QA 4LBWA 2FNAA 5KNBA 1ZINA 5FTKA 1E2GA 2XITA 2ZJ5A 4ZKDA 3QENA 5HE8A 4PAQA 1QHIA 1M7HA 4NBSA 1P7CA 4R2HA 4BZQA 2QAGC 5AK0A 2BBTA 4UNNA 3UG6A 3H0KA 1OIXA 4C0JA 2AKYA 1Q20A 3ADCA 3SZRA 3W34A 2R6GA 2QSYA 3O8CA 2BEJA 3A58B 3CB4A 4IVPA 2QPOA 1VG0B 1IN6A 5DNYB 5G41A 1RJ9A 3TRFA 1B23P 4QHYA 4KITB 5L3SA 5GADl 2BMEA 3IHWA 2R6FA 3T5DA 1L8QA 1HQCA 1S0UA 5CB6A 1JJ7A 2ZRFA 4TYNA 5JWOA 3CZPA 4HSEA 2ANCA 1DS6A 4NONA 3Q9LA 4KVGA 4Q02A 2FU5C 3TKLA 1R0WA 3GJ8A 1DO0A 4GL2A 3IKJA 4LYJA 5FBWB 1E9EA 2WICA 3U6BA 3QG5A 5G53C 3T12A 2V3CC 1G41A 3KQKA 1ZNYA 3EC2A 3RS0A 1HV8A 1E4YA 1SXJE 1ZM7A 1F5NA 4M21A 4JYBA 4US0R 5C1BA 5LPNA 3TGPA 5JJIA 3P26A 2ASEA 2XJ9A 4K8OA 1Y63A 1YZNA 1E2MA 4TYYA 1SXJB 1T5LA 2GHIA 4E22A 1AS2A 1YR9A 2OO7A 1E1QD 5BW8A 4CEJA 1E1QA 2ZI5A 1LW7A 1Z0FA 2ORVA 3CPJB 3IDQA 3K8YA 1VKJA 3PVSA 3CO5A 2W2XA 3IILA 4NH0A 3LWNA 1P75A 3UATA 2AXPA 2MSDB 3FKSA 2VP0A 3LW8A 1EWQA 2VTKA 4ILEA 1AGRA 4RSGA 3CNOA 1IJEA 1UKZA 1Z0JA 3TUZC 1M7GA 1US8B 1OXSC 3TVDA 1ZVQA 3AUYA 2CCJA 5B30A 2IYLD 5KDOA 1BYUA 1FX0A 1P9NA 2BKEA 4PQFA 1ESNA 4CT5A 1OXXK 3K53A 3VU9A 4AIIA 1WB9A 1SVOA 2WWHA 4HUQA 4A8JA 3B13B 4C7OB 4UXHA 4B43A 3FB4A 4JLAA 1OHHD 1NVUQ 4PHGA 4C0BA 1CP2A 1N6LA 1OHHA 3FHCB 3EA0A 2GBLC 3U44B 1OW3B 4I4LA 2A7QA 3AVOA 4JLVA 6Q21A 2C96A 1I2MA 5FPYA 1CR4A 2MMCA 3UANA 3CNNA 4TWZA 2HJGA 1XDBA 2B92A 3EIEA 1QHHA 5AJZA 3GEHA 4DSUA 1HE8B 3KKNA 4CVNA 1E94E 1QZXA 2DY1A 5E7JA 4B76A 4HAZA 5FBQB 4EFLA 3M0EA 1AS0A 3U4QB 4HLCA 4KFTA 5LD2C 1CRPA 1A1VA 5JECA 3SQWA 4GP7A 3K09C 2XTMA 2QMOA 1VECA 2J7PD 4ASUD 1D2EA 2J7PA 3L8YA 1TU3A 1NY6A 2P65A 3NWJA 5FI0B 4DLVA 1VIAA 3KJHA 2NMVA 5G3ZA 4IDHA 4NE2A 3BB4A 5EXSA 2D3WA 3T1QA 1AN0A 5FR2A 3QQ5A 4LGMA 4GZLA 1CU1A 4Z51A 1VCOA 4AK9A 3TLXA 5DSZA 2QORA 2ZRIA 821PA 4A15A 1ZNZA 3CW2A 3QIAA 3PIRA 2JGNA 3CF2A 2EFCB 1NBME 2I1QA 2F1IA 4WZBE 1JNYA 1GNRA 2Y8EA 2GVZC 4LJ5A 3ZVRA 1GAJA 3B1ZA 3LH5A 4NCIA 3AQ4A 2N1BA 4DCVA 4G5GA 3NVAA 1JXMA 1MV5A 3AKDA 4J0QA 5EQTA 1KYIA 5JI3E 5FFMA 3R8CA 4DC9A 1I4TD 2ZROA 1EWRA 2NTYC 1KIMA 2H18A 1CLUA 3L82B 4KYIB 2QP3A 5HTKA 1JJVA 1IN7A 4HB3A 1N6KA 2FN4A 1M34E 2EYUA 2RGXA 2WBLC 4R71A 4UNSA 3PQCA 2LWIA 5KDLA 5F3WB 2WJYA 4EDHA 2CDNA 1P5ZB 2PZGA 3AH8A 2C03A 4TYQA 1G1MA 3W6OA 1BYIA 5GJVC 3T1OA 1Q3HA 2IF0A 2GJKA 5J4KA 2JDID 1E9SA 1Z07A 2ERXA 1XMJA 1OIVA 2A9KA 2FWRA 2IYZA 3FWYA 2JDIA 3ZJYA 5KPJA 1OV4A 2PJRA 2W6JA 1HY3A 3GMTA 4URYR 5DI3A 4HAYA 4B32A 1E79A 2CJWB 1D6JA 3ECCA 2XNDD 2B7CA 4LJ4A 1E3MA 4KFSA 4GBMA 3ZIAA 3WBJA 1RC8A 4HLQB 4O2LA 4BFWA 2ZAOA 1G7RA 2YNMA 2PEYA 2F6RA 3KXKA 1SVKA 5E4FA 1LB1B 1E98A 4JLMA 3SBEA 2PEZA 4I99A 3TUJC 2FA9A 4MYUA 5GVSA 1KTVA 1QDEA 1Z3IX 2QNRA 2CNWD 1UEIA 2E9SA 2V1XA 2CNWA 3AEZA 3MWLA 2F1RA 1FFHA 1QF9A 4B33A 1QHYA 1L4YA 3GLHE 4LRWA 1XF9A 3DOFA 4YMUA 3P4YA 3G5UA 1EFCA 2RGBA 1VPLA 1U8ZA 2ZTSA 4XTRA 4Y0VA 2ZRAA 2OE2A 2VBCA 3F0TA 2PCJA 3GLHB 1F2TB 3I72A 3AKYA 2HJVA 3RSLA 3SI7A 1F2UB 1U0JA 2P5TB 4LHYA 2VL7A 4BWYA 2QBYA 3UWOA 3IHLA 1OXUA 1S9DA 3W5IA 2W2VA 1KY3A 2ZRMA 3QNUA 4FMDB 4JBWA 1AIPA 4I1SA 2ZI4A 1X1RA 3U7GA 2B7BA 4V0ME 4DCNA 2QM8A 5EZ5A 1YHNA 2NG1A 2NPIA 2OLKA 4M53A 4ZI2A 2G0NA 2G6BA 4CEHA 1E2QA 3E70C 1XPOA 2J0UA 4URUR 5KNCA 2XGJA 1TF5A 2R44A 2ORIA 3AGPA 1NN5A 1N0VC 2JLWA 3KTAB 1NSFA 2Q9BA 2ATXA 4QHSA 4DB4A 1E96A 2AFIE 1XMVA 3VR5A 1RRFA 4OJKA 5L3RA 4ACAA 1S1CA 2C78A 2WOJA 4KLZA 2PT7A 3WHLA 2IHBA 1E9CA 4JL6A 1XFAA 4PAOA 1U0LA 3ADBA 3GLGA 2YVUA 2GETA 3NG1A 1QVAA 5FTMA 2GDJA 2RGNA 2WSMA 4ZCMA 1MO6A 2HXSA 3C5HA 4H9GA 3TH5A 4BFTA 1IM2A 5FL3A 2QGZA 2GRJA 4TL9A 3ETLA 1XP8A 5FTNA 2P6UA 4JLBA 1JR3E 3AVQA 4PO1A 5HZHA 5AUPB 1P6XA 2DWQA 2QPAA 2O8DA 1XCMA 4B3FX 3P1JA 4DDVA 3AGQA 1ZUNB 4AKIA 3REFA 3X1ZA 3RC8A 1Z0DA 3CBQA 4PSKA 4C0QC 3FMIA 5K8TA 4PANA 1T4GA 3NXSA 1ZM2A 4M0LA 3RRZA 4DDWA 3K0AA 2CHGA 3C8UA 1GILA 2ANBA 1R4AA 1SKYE 3BIFA 1OF1A 5JEDA 2D4HA 4OBEA 1T3SA 5EE5B 4KV9A 2VP6A 4B6EA 4Z8YA 4A92A 1G5RA 4F93B 3ZGXA 2QY9A 3N2IA 4EAQA 4RZXA 4JVLA 4DLXA 1SKYB 1UBGA 1YZGA 5IF9A 3SJZA 2WJGA 5BXQC 1T8TA 1ZIOA 2QROA 1B0UA 3DPUA 3EZFA 4NPHA 1M6NA 1HH4A 1HT2E 3C4JA 2QENA 1IQPA 4M2LA 3AF3A 4XIGS 5E3HA 4BFXA 1E9FA 2IYSA 1XXHE 4OI1A 1OFUX 4NP6A 2XZPA 1OH8A 2IS6A 4AKGA 4JLKA 4UKDA 3AF0A 3MMPA 1T6NA 2J9RA 1NN3A 1OYYA 3WHKA 4RD2A 5AUQA 1AK2A 3K70D 3CLVA 2QG6A 2VHUA 2ZS7A 4BFYA 2OILA 3KUCA 1X3SA 2ZJZA 3VQTA 2J5XA 3RANA 2RGDA 2GTPA 2RAPA 2Q6TA 4BGDA 4DLZA 1E9BA 4DLUA 1Q57A 1V5WA 3BRWD 5HCNA 1FTNA 4RY2A 4B73A 1RRPA 4S2EA 4BZPA 1IAQA 3Q3JB 3R20A 3TAHA 4Q4JA 1OE0A 5EXPA 4TT3D 3X1WA 4PC2A 4TT3A 4FMBB 4Q4HA 2XNSA 2RMKA 3X1YA 4FWIB 3GD7A
chains in the Genus database with same CATH superfamily
4GM1A 1BKSB 4YT2A 1N9GB 2WYUA 4PZYA 2A3RA 2QT0A 2PYDA 3EZ9A 1SQGA 4GZ5A 4TYWA 3MTQA 4A8JC 4PX2A 2HPHA 3LY7A 1VE5A 5CH5A 3KCNA 1N5DA 2X40A 3CYFA 3AB3A 2WMOB 4GDMA 4L95C 4CT0A 4DEYA 5CCBA 4O8CA 2V8OA 2V9ZA 2O5RA 3BL5A 4J49A 1S96A 4LDJA 2P9YA 4QO8A 1Z25A 3D6TB 4EM6A 1E0DA 3JQ8B 4YUAA 1GZUA 2P30A 2PRKA 3C1UA 3FUXA 4JUCA 4PTZA 4IILA 3U16A 2R6JA 1HG0A 2VP3A 3O90A 4TSKA 1UXJA 5DLEA 5BRJA 2YCLA 3QVJA 2C98A 2CLKB 4PIVA 2Y6UA 1G8FA 3RC7A 3RIGA 4DCSA 5ITVA 1FLVA 3UAGA 5IXSA 3AF6A 1BS1A 2X9LA 1F2DA 1W4CA 3TZEA 4UTNA 4GDFA 2NO9A 2R7KA 1OUMA 4K9QA 4CTOA 1KO5A 1P5JA 5AUOB 1ZUWA 3QKRB 1LF0A 2QRKA 1E2IA 1JMYA 4BX9A 3FDXA 3FGPA 5DDIP 5I4IA 3B53X 2POQX 2X0NA 3Q8KA 4DNOA 2COKA 1KYWA 2O05A 1LU9A 1XTJA 2FSVC 2OVFA 4FGUA 1P73A 1CEEA 1IXKA 2OD7A 4Q05A 4BX3A 1LUAA 1KL7A 2HHJA 3CCCA 1VLQA 1I3MA 1S3GA 1O5IA 2IX9A 4P5EA 3TTWA 4CKYA 1P77A 5LUAA 3BWCA 5FPTA 1A7JA 4TKVB 3W3AH 3IJEB 2ZYSA 1EDDA 1U8YA 1TQ6A 3DMPA 3I0ZA 4QNMA 1X7WB 4EY6A 3L0CA 1Z06A 2WAXA 2YS6A 2IPLA 3O2JA 2FP3A 1JB9A 4MRRA 2GBLA 3RBXA 1MHPA 4CODB 2VK8A 1K63A 3KD2A 5CJJA 1OY1A 2B35A 4RTJA 3PHBE 2PX4A 3IDFA 1BNCA 4DILA 3N86A 1R0KA 2YICA 1JQJC 2WU0A 4JKIA 4ZVRA 3UWPA 1V35A 3CH7A 3ZPXA 3B85A 1TGYA 4KN8A 4ZCLA 5COBA 1XCBA 4RLSA 1Y4UA 3CLUC 2WU1A 3TOXA 3Q15C 1Z12A 2HQRA 3CA8A 3LF2A 4TMWA 3GRKA 3U31A 5KNLA 4BU1A 3JZDA 2ZSKA 1TAGA 2P78A 3ICPA 4LSWA 5DHTA 3RABA 1QE0A 4BMYA 2C2HA 5H70A 2COUA 3B52X 3SZ3A 3T9CA 2IHNA 1OXMA 3M6XA 1XD8A 2WG0A 5JSHA 3NEYA 1MNAA 2C8JA 4N5NA 4KLCA 4AKHA 2CK3A 2MWMA 5DI9A 5HZGA 4GR9A 2EL7A 2DH6A 4MQFB 1B8OA 1EZZA 4MYDA 1XEFA 8ATCA 4A6EA 1RQLA 1CUSA 3NANA 5AVQA 1NXPA 1B42A 2O59A 4BB5A 4I4NA 16PKA 1EK6A 4TMKA 4X7BA 1IBCA 5JALA 3ICEA 5A0TA 4DSAA 1E3QA 2JIZA 5IAAA 3IP9A 3BH6A 4KHPB 1I4LD 1PFGA 3KKPA 4F6LA 4LW8A 1CDOA 5KWSA 3HP1A 5H3LA 3PC4A 2D00A 1SUCA 2Q5HA 1E66A 1Y48E 2NQ8A 2ATVA 1H4QA 1IVSA 2CLSA 2CXHA 2JEZA 3I53A 2RKBA 3WK4A 4NJEA 2YV3A 5JD3A 4URVR 3OD5A 1UEJA 4F1WA 4C6SA 1XQWA 2FV8A 5CEFA 1OB2A 2HMSA 2P6PA 3NW9A 3EYWA 3T52A 3KTDA 2YN0A 3NWEA 2V7PA 2ZOSA 4FHCA 3T7RA 4L74A 1SNYA 4FN4A 5DT2A 3SJBA 3WIEA 3HPQA 7REQB 1JQAA 1WQ3A 3ZW9A 3FFBA 2AK3A 1SD5A 3PNVA 4H1TA 3Q3CA 3S5JA 3JPWA 4O63O 1XJ0A 5G1PA 3CHYA 3MNFA 3U7GA 4BE7B 2FW0A 2GSDA 4QGSA 4AKEA 2WE8A 1P1RA 4IYJA 4CF3A 5BVHB 4FS8A 2EIXA 5JO0A 4GXQA 1V1JA 3GGCA 1CIJA 1DUVG 4TLAA 1KMHA 4OYLA 1YXMA 2VZ9A 3S2IA 3INYA 2BGTA 5FUVA 4YAJA 2QL5A 4O2AB 4DEVA 4EG6A 2Q3MA 4I8XA 3DZIA 1DBQA 5DGIA 3RV4A 3ZEIA 5A02A 4DKJA 4M38A 1EUDA 4EMUA 4H08A 3DCJA 3NWPA 4RZSA 3AHHA 3PK0A 2GYVA 1JLLA 1TKBA 5JR3A 1N3IA 1ZITA 3IAUA 1SCNE 4A0RA 2JI9A 1VGRA 4WGGA 6CHYA 1Y42X 4MUJA 4IDGA 2ECOA 2Z5FA 1BD3A 4JENA 1IU9A 2WW8A 1HNWB 2O8CB 1ZU4A 1VSTA 1H93A 2ZQZA 1WY5A 4KXUA 3RSCA 3KXIA 1QIHA 2FUCA 3EA5A 4K0RA 2Z0MA 2D5BA 4BZZA 4CCYB 2GO1A 4RC9A 5HOQA 2W0SA 4X1IB 2ZCVA 2DR3A 1HTBA 3A27A 3PGJA 4NFHA 3TW0A 3NU1A 3WZLA 3NATA 2LXNA 2IIBA 4LWOA 3WWEA 5KYYA 4ZYUA 4B9AA 2R5NA 3IBTA 2VUIB 4ZALA 3FFTA 1TFUA 4LZWA 3WDMA 4C4RA 4OX9B 3PGMA 3Q3VA 1K75A 1UANA 4HVAA 5DSXA 3W3AA 4URWR 4EUKA 1XCPA 3NM4A 4HV4A 4RQUA 4CG0A 1O95D 2XUZA 1JXQA 1NI4A 1R6DA 3JX9A 3CX8A 4NZPA 4QU8A 1AHIA 1XK6A 1N92A 3D4BA 1U1CA 3ZE8A 1GG9A 3E05A 4HPWA 3RVBA 1R8QA 1TCCA 3SR0A 5L8VA 5DNUA 3WYEA 3EG9A 1J21A 2D74A 1V2GA 1WF6A 2DJ5A 3N5CA 1FSGA 1G5QA 2GJ9A 5C0OE 3L92A 1YIAA 4LJRA 1CYEA 1QG6A 4S05A 3KYBA 2AZXA 5I9TA 2ZP1A 2NSDA 4RTOA 2QNBA 3ZHXA 1ZGHA 3I92A 4EMTA 3KQYA 1ZCFA 4FR0A 2WJHA 2Y27A 4MI6A 1EFVA 4JP1A 1EJ6A 1GADO 2F43B 2Q29A 2Q3FA 2R2GA 3X1KA 1U6JA 1XMOB 3QEJA 5ED0A 1G21A 1QGED 1TC1A 1PJ2A 1TVCA 1V9LA 3DO5A 3R6DA 3V7UA 1CKEA 2B4RO 1F8UA 2FZLA 5HUQA 4HHEA 4YV1A 3ORYA 1K88A 3OCCA 3V8MA 3KPWA 4R41A 2ZKIA 4RD0A 1IN8A 2VCYA 3FUTA 1RI3A 4K6KA 5T3YA 5FO0A 3IR6A 2IEIA 5E0KB 4IIXA 2EFGA 4KQ9A 4PIMA 3T5PA 1KI2A 1KZ1A 2YQ4A 3M8KA 2AYZA 2VJLA 2OQRA 2XXJA 3NGLA 1E6UA 1NBEA 1W35A 2G28A 1ENOA 5MFZA 4XWWA 1GPNA 1DG3A 1PV1A 1E1CA 3R8XA 4EHBA 1RE1A 2OR3A 1JVBA 1FYVA 1L9XA 3DLIA 3E9EA 3V32A 4PLWA 4LVCA 4BNJA 4BN5A 2V1UA 1TOAA 1W48A 5EUCA 3AESB 3QOFA 2F62A 3OESA 3UGQA 4EGJA 3RHFA 1I14A 3GGDA 1DGQA 2QM3A 1OCEA 3LT1A 2J67A 1OROA 2IUEA 5D5PA 2PUBA 3KT3A 1W47A 2YFHA 2V98A 1JFLA 3PCXA 1OXVA 4MS3A 2VSOA 3BTOA 3KZXA 3LYLA 4I55B 1EUZA 5HBGA 1GGFA 3W1EA 3HA5A 2OGTA 4XM0A 4D99A 5ITZB 2JFOA 4R1NA 4Y7CA 1C3XA 2EGUA 2V97A 3P0JA 1SUAA 3WA7A 3HCWA 1Z5OA 4OJQA 2PH5A 1RLOA 1CQIB 3TQFA 4BNIA 1D2CA 2JH9A 1P62B 1Z88A 2G0TA 2XCQA 3EDQA 5TC4A 3UGKA 1WETA 1EDEA 1VE6A 3TLBA 4B17A 3OZ7A 3PPVA 3EMBA 2C9MA 4MB2A 1ZYUA 3AEYA 1GARA 5H3HA 4XSGA 4OF4A 4HUJA 4AJLA 4L5BA 4R98A 4D44A 4J94A 3MJFA 3HJRA 2R6AA 1L5OA 3CNBA 5CHYA 4ABYA 2ZI9A 4GEKA 5BQOA 1XJ5A 4MX8A 4EEZA 1G20A 4XDHA 3JRXA 3TSYA 1ZCBA 1CRWG 2L69A 4LV8B 2E0IA 4UE6A 1PR4A 4FZ3A 1LA2A 1RD4A 1MTZA 3OM0A 4RH3A 2OQ2A 2Y6VA 3VVMA 4RM2A 2CT8A 1CF2O 1CBUA 1GEGA 4GNKA 2GKSA 4W5WA 5ALUA 4BJ5A 1K5GA 5ALGA 4FE7A 3EQ8A 2NPFA 2WDPA 4C4SA 4EP1A 4UTZA 2FMUA 4CMIA 2LKCA 4BS9A 5ED4A 2ZPTX 1PLJA 4WY5A 1ZDMA 1HR0B 3CR7A 4GZMA 1MFPA 4U6NA 3AERA 3C4QA 2OV4A 1WLYA 5F1YA 1NT2A 1YS6A 5IBQA 3ZKWA 3HWSA 1GSIA 3DTVB 4XSHA 3L7BA 1CWUA 3VOAA 5CK5A 2XOKD 1PJ3A 5C5IA 3IBFA 1VE1A 2VA9A 3RFCA 3ZHCA 5LZ7A 3PJGA 1MABA 3HSKA 4IOKA 4OHVA 4F4FA 1IZ9A 4Z7OB 3R9KA 10MHA 1NUSA 3SE0A 1JKMA 3K72B 1P45A 2QQGA 2YZ2A 5HPYB 1VPTA 3KQTA 5JS8A 2HPZA 1FEZA 2ZQYA 3SIXA 3PXGA 1Y9AA 2HK6A 1H05A 4HNGA 4MP3A 2C0QA 3EULA 3B9PA 1UJMA 2BHSA 1Q44A 5AVOA 1M5RA 1UDCA 2GM5A 5KCZA 3FTCA 3F6RA 3SM9A 1YRAA 3CEJA 2JIQA 1X0VA 3Q2OA 4JJIA 5TQ0B 5KU7A 4RTNA 1T4CA 3AKEA 4EB8A 3LT5A 1V37A 1Z5NA 1E62A 2P8SA 3DAYA 4X0EA 5FNVB 2YUTA 2X8AA 3DVAB 4EENA 1GKKA 4N18A 4TV8B 2V6JA 2WYVA 4ZVVA 5HE9A 1ZN9A 3Q3HA 3HCAA 4YXWA 5IKOA 3R7LA 4EHJA 1OH8A 1JSLA 2WZQA 1E7QA 4BB0A 4YJFA 4Q1BA 5IFKA 5MF6A 5AW2A 3R0QA 5ILGA 5HW0A 1NM5C 2X7JA 4G1VA 3U4AA 1C4OA 2RGUA 3B89A 3QI2A 2VOEA 1EE9A 2Q1YA 2YWGA 3I52A 3QJ5A 1Y8RB 1E9VA 1XFDA 3Q87B 2IPMA 3V8RA 2WUEA 4KBFA 1CDEA 4P93A 1DSSG 1H1DA 4H35A 2Y0EA 1CEYA 1RYHA 2ZR8A 3ZEAA 4C2BA 1CR0A 1NULA 5D8DA 5B2EA 2IWRA 1NNSA 3VU1A 1W36B 4KRFA 4LBVA 1U0NA 1GCUA 3A9CA 3EOAI 5F73A 3V46A 1QHGA 4DUGD 1Z22A 5JXJA 2A9RA 4BRSA 4ZAGA 1GXSA 2CNKA 4ZI3A 3EMVA 2X1MA 1YFJA 1M72A 1UKCA 3GEGA 3JAWA 4I46A 1DIBA 2BDEA 2V45A 3CGGA 3LP6A 4W1SA 5J47A 3PRKE 1IWPB 1Y1TA 5LQJA 4C0WA 3NT2A 1M5UA 3GCXA 3S0JA 5G0WA 1D7AA 3SHTA 4UEOA 2HRRA 1P0MA 2NTNA 4V02A 2G1JA 4R7GA 4XVRA 3WFIA 2HV9A 1M8JA 4TM8A 1KE2A 5CFPA 5F2OA 3GLFA 2QRJA 2CFOA 1NTOA 4EQZA 5AVUA 2XUGA 3W78A 1LI5A 2VXBA 5DLDA 4B4WA 1MJ5A 3E8SA 2R8YA 1XRLA 3HKBA 1MXFA 4A0QA 3ZCQA 2EKLA 1EPUA 1WG8A 2Q6KA 3R9XB 5FD8A 1TRHA 1XU4A 2X2EA 1G2PA 2ZUSA 1TJ4A 1MVNA 4YRFA 2JGLA 3QKSA 2I4RA 2PGXA 4KN6A 3B5IA 3MINA 1FSFA 1GLGA 3BA6A 1PQYA 3BJMA 1QWOA 3HLKA 2B9EA 3PHJA 4WY2A 3VPFA 4B7XA 1ECJA 2NZYA 2Q3DA 2W98A 4MQLA 2Q8PA 3VR4D 4A8HA 2VTBA 2AYYA 4JT4A 5D5HA 2OHJA 2CNLA 1N0IA 1BEZA 1WKBA 1T36B 1ZH4A 1P0QA 3IAFA 5TQJA 3ZUGA 4DZTA 4U2FA 3IT0A 3K0EA 4IJ6A 3G9XA 3AKCA 1CXZA 1Y3FE 2H31A 1D4ZA 2PX5A 3A31A 4O02B 1QM5A 4BLWA 2G4CA 1Y3BE 4YAWA 3E81A 4LSZA 4ZDWA 1TB4A 1AKYA 2V7TA 3UHPA 2QMUA 2O3QA 3R7AA 4ZMRA 4Q3DA 4TV9A 1CJUC 1Y34E 1LFAA 2A3NA 1G4AE 2NYVA 4YO8A 4EUEA 4JT8A 1U3TA 3M5CA 4MYHA 1S2MA 3HCPA 1MAHA 2O52A 5CXUA 2PFGA 2M6RA 1TXGA 1MB2A 4Z9BA 3SD7A 4QYSA 3CX6A 4KQFA 4LKOA 2PN1A 3PEUA 3ZCTA 5DGDA 1DFIA 5TRTA 3U60B 2VTEA 4HZGA 4BMVA 5KSZA 1NR5A 1MO4A 3GJ4A 3N53A 4X63A 2GYWA 3SBXA 4PHCA 5F98A 1V8ZA 2R8OA 3A4VA 2N75A 2E55A 5ENVA 4LRYA 4KB5A 5AM3A 4KAJA 4BRUA 3WTCA 4WK4B 1DKUA 4ZK6A 1SKMA 4L85A 3GGJA 3ILYA 1U3CA 3EWIA 4P22A 3T38A 4HWPA 4EO9A 2HPVA 1Q6ZA 5AKXA 3C98A 4FMCB 3WL4A 2VP2A 1E0SA 4GICA 1P60A 3G8CA 5I7SA 2VXCA 2GNAA 1VSUA 1MQ9A 4KQCA 1F0YA 2JK0A 4NCJA 4C0HA 3CWCA 4MRPA 5EWLA 3GPLA 4IXDA 1JLHA 1HMPA 1LS1A 4QQNA 1UXOA 1YC5A 2AMFA 4H6VA 4I3GA 4BQSA 3DVLA 1PFQA 2DAPA 4HNUA 5JVDA 4GZ3A 3T1YB 1SWWA 3NH6A 4KNWA 4AF6A 1GPLA 3NHKA 2IYNA 4PRKA 4FX5A 4WKNA 3ZNNA 2HA0A 4GOJA 4H1WA 3FMPB 5LQRA 4BPBA 4HNVA 1PU2A 3DZCA 3KOXA 1G4HA 2ZR7A 3Q9UA 1F7UA 4EI2A 4O25A 1U5BB 1E0JA 1XP5A 4HBGA 2JLZA 3EUFA 1GJRA 1SVNA 1JFRA 5T41A 1W0CA 3I9OA 3RU3A 1PP4A 2XMGA 3LL7A 1U7OA 2H2FA 2NO4A 2HA5A 4P4UA 5KWEA 5BR8B 3TJZA 4Q12A 3ICQB 2XMZA 3QNWA 4RKRA 4NENB 3LCMA 4KQ2A 4XEHA 3RC9A 2O50A 2QDXA 4G1UC 3UJ7A 2IUUA 2GUWA 3G5MA 2C8LA 4I2NA 4I9FA 4KDEA 4KGXA 3I62A 2ODAA 2O8EA 5JHGB 4FFVA 3MMZA 4MKHA 4AJNA 1DKQA 1R0ZA 1K6JA 1MT3A 2J5BA 3T6KA 1G38A 1EDZA 5BSUA 2B1GA 2I6GA 2Q6LA 2ZDGA 4MLPA 4YDRA 1YCHA 5KNDA 3ED1A 4CM3A 2GLXA 2OC9A 4MKGA 4BX2A 2P8JA 1IY0A 2YYAA 4ZEOA 4AMZA 2VXOA 1JHUA 1C0LA 4CW7A 2Y1KA 5FX2A 4BJ6A 5FUQA 4B3MB 2LPMA 1H9BA 1M8PA 3GDFA 221PA 3KXLA 3QFTA 4MQEA 4YP0A 5E4TA 2KYRA 3UUEA 3G7NA 4CQMA 4F3NA 1SCAA 1YDEA 2ZVQX 3KNZA 1CUZA 4BO4A 4KPYA 2GPTA 4LJ9A 4KCGA 4DV3B 3CX4A 4B8WA 3VVCA 4FFBA 3C3JA 2WEKA 1R0XA 2C4HA 4K9RA 4B79A 4B6JA 4LF6B 3ACCA 2K7ZA 1MC4A 1UOEA 1T4BA 4ZT5A 1J06A 3H11B 1XTVA 2PWZA 3OZWA 1PKEA 1ZSYA 1U1FA 3AWIA 5DYTA 2ZB7A 5D2CA 3EGDB 3WNCA 4H6XA 1PTKA 3HYNA 1EHYA 3K9NA 4D3ZA 4DKXA 3EIFA 5E2BA 3OKAA 4HWGA 3M6WA 3OPXA 4X97A 3H16A 5K0GA 2NSLA 4JXZA 3U3RA 3QUQA 1EWVA 3KQPA 1SVIA 3BXZA 3FCSB 4L75A 1H5NA 2HXYA 4C3VA 1T9GS 3UMJA 1EQ2A 4MP6A 1LDNA 1SOVA 4IOLA 3WLQA 1VMDA 1EFVB 1NXVA 3NIWA 1HXHA 4ZU1X 5B58C 2J41A 3CMMA 1PKXA 2BJVA 2HSDA 4XGNA 1MB9A 5JAHA 4DLBA 5ICGA 4TWBA 4PTLA 3BJIC 5F1OA 2BDTA 3WFZA 1YE5A 3QPVA 2UUCB 1Z28A 4H60A 4ACBA 3BVPA 5A62A 2K2QB 1RM4A 1UP4A 1BG6A 3VOBA 3OFVA 2BVNA 1MLDA 4MR8B 4AY3A 2VRCA 3EF0A 3QFHA 2O2DA 2VA8A 4QREA 3K3PA 4WA7A 3EVAA 3WMFA 2HQOA 2V8BA 4A4DA 4LC1A 1T8YA 1ZZGA 1Y37A 1DBWA 1YSCA 5AKJA 2YXNA 2E1PA 4U7FA 2YYZA 5ARDA 4DTCA 2QY6A 2FCAA 1RLIA 2WM2A 3GNQA 3HB1A 3OTHA 2IY7A 1VL0A 3W5HA 1NF8A 3ZDFA 1HZZC 2J30A 1ZUIA 2K5UA 4TKMA 1LWOA 4FILA 3OSUA 4DLYA 8LDHA 4F8JA 5CNIA 3VU8A 1QBKC 2AE2A 4MW9A 3SNHA 1GL7A 3A3YA 3OT4A 3TLGB 4JX9A 4COOA 1RAEA 2BJWA 2I4LA 2VRWA 3O4RA 3O31A 4O1HA 1UWLA 2YJTD 2ZPAA 2QN9A 4K2HA 2Q2NA 4KZKA 4MS3B 3VDRA 2XT6A 2QN8A 3FPEA 5BSFA 2C77A 2V6BA 1AH2A 1N6PA 2M2IA 4NDAA 1O3YA 2BMWA 3BWVA 4WV3A 4OJNA 4YV0A 2JGIA 4GT1A 4CG3A 4OAOA 3PGA1 3ZHSA 4IV0A 4QOEA 2VDOB 3EXG2 4GXTA 1CDZA 3PDCA 5ALFA 3UV6A 4MCAA 4K0KB 4N9QA 4U7GA 4ID9A 5AKYA 1GRNA 1DXHA 1G9TA 1HNXB 3W8FA 4CKEA 2ZAIA 3ID6C 5LC1A 3DO8A 4MB6A 4ZK2A 4W5NA 2B8NA 2FFHA 3FYCA 2YJNA 1X7ZA 2GN0A 3AF2A 3IV7A 4R6XA 5BN4A 5A1TA 1PNTA 3VNAA 1MFZA 2VPIA 3H9QA 1CFJA 3STWA 2I55A 3D5EA 2YL2A 3KVVA 4PAGA 4B8ZA 2FZ5A 4Z86A 4JJGA 5TT0A 3TRKA 3PI6A 4DR2B 1WW2A 3VPCA 3ED5A 1ZAKA 1IZ0A 5EL0A 3RVQA 1KGDA 3BGWA 1L7EA 1G16A 1PUIA 2E5WA 1ETUA 3PJDA 5K05A 5F64A 2Q4DA 3Q9SA 2H4YA 3CEPB 3U40A 3BQ9A 2HU7A 2RAUA 2VZLA 1WPXA 5GGXA 2X9NA 4EB0A 4XB6B 2YN4A 1X8XA 2OCPA 3D2CA 1EHIA 1P2SA 2BELA 3FHTA 1UC8A 2XMPA 4UEKA 4ZHQA 3DFKA 1G5HA 2IFTA 4IWNA 3S7TA 2HO4A 4ILKA 5IAGA 3WYNA 1A82A 3NYRA 5JQGA 2DXIA 2CXPA 1PZFA 2QTLA 1PR1A 3FWNA 4CKWB 2CWDA 1T15A 3N87A 3A32A 5ELMA 3T1VA 3BUSA 2BZGA 3U5TA 4KU4A 4MYTA 4GMGA 3A6EA 1L7BA 4FYHA 1EWKA 1PL7A 1WDKA 1ZJJA 1N1MA 2GEKA 3R0XA 5K3BA 5CH3A 5SICE 2IXGA 1NBMA 1CVRA 1K5PA 4DDKA 3A04A 4O29A 5I4CA 4WZBA 2BGLA 4C88A 3EXEA 4YEDA 2DHEA 4OFXA 4QX6A 3SBDA 1EVKA 1AB6A 3IVRA 2GNOA 1RYMA 3NHYA 4RSRA 5DX0A 2FEMA 3E8MA 4ZAWA 4AN0A 1KR5A 4P31A 3R7BA 5E7MA 2F4NA 2RC6A 4RD4A 1VDZA 3PZBA 1L7VC 1D1TA 1SJ9A 1SG9A 3C5VA 1IY1A 4RVCA 4NIMA 3AHGA 4BQRA 2IXTA 3IP8A 2QD1A 2CHVA 1F7VA 4OXXA 3VU9B 3A3OA 4HUQB 2FPKA 2INGX 3FUCA 4B6OA 3SC4A 4DRYA 1VHJA 5CT9A 3BJEA 3UICA 3FDIA 1Q2XA 2DHRA 3PF9A 1J0XO 4C3UA 1Q0TA 1TNDA 3KB8A 4JOBA 4WXPA 5AJXA 5LBUA 4IXMA 1WZIA 4JDPA 4PYRA 4BUZA 2FZCA 1I2DA 4KSCA 5AD1A 1V26A 1L7PA 1LBEA 5JPDA 2FLKA 2A0FA 2QTVB 3WMXA 4HAVA 1GTMA 3MGCA 5C3MA 3EFOB 4UE2A 4CQNA 1OIWA 3IULA 2R25B 3D9QX 2PJDA 4IEFB 3OOEA 4OKSA 3KQUA 1QOPB 2CSUA 3UAWA 2OBMA 3KX2A 1KEVA 2CBZA 2DPHA 2JJQA 4GWLA 4R5HA 1H2AS 2ASVA 1C9NA 5B3AA 2CLEB 4MVJF 3SQMA 3SZMA 1XNGA 5FOVA 1T6ZA 2ZWPA 1S01A 1I2CA 2X7XA 2D54A 2R85A 2RGYA 1WWKA 1WV1A 3W6NA 3MJTA 3RRBA 3WHIA 5A7GA 1O96A 4WH0A 3UT5B 3HXOA 2WVHA 1C30A 4WNAA 3I5YA 4HQ6A 1KIAA 1E20A 2VYVA 4ZVSA 4IMRA 2V6IA 2VJMA 2FR0A 3FROA 3A70A 3MBOA 3R3WA 5IK2D 1TO2E 2I4MA 2QUIA 3LUJA 3QVMA 1DAGA 4WL0A 4O0LA 3FY4A 4IY1A 2FSIA 2RGCA 1FOEB 3IQWA 3PGLA 5DM1A 5EWJA 4BAGA 4D8VA 1LBIA 4KXFB 4QOGA 3ZCRA 1ISRA 4RF2A 2BFDA 4C20A 4DXAA 5K0ZA 1A9OA 3PC3A 4W5JA 3J81k 2OP1A 3GLHA 4XQGA 3RUPA 1N7GA 3GLFB 3TSAA 1X39A 3HO8A 3FUVA 2NXJA 5J59A 4Q16A 4CV3A 3V1LA 4ZCTA 1Z7YA 1OH7A 3QU5A 3ZX4A 1H9CA 2WWWA 3RRNA 1DOAA 2R4TA 3ZE7A 1N6HA 1SQ0A 3FIUA 1K27A 4HDKB 3RC3A 4EJMA 2JFNA 1KMQA 3R6WA 1YHYA 1EX7A 3P96A 1ORWA 1D4OA 3C4VA 1FRVA 3LKBA 3OO0A 3MZ0A 5HGJA 2CVHA 1TEXA 2DM6A 4IKOA 4MAMA 3VR6H 4DIBA 1EWYA 1GZHB 1XWWA 4V0SA 3PX2A 4RETA 1O94C 1PR6A 3KQSA 2ZSJA 3O9VA 4CMEC 4B7ZA 5HS4A 5GIPE 3SY8A 1WO8A 3S2SA 4BFVA 2PVPA 1QPZA 1TO6A 3LSYA 3FPBA 1GQ2A 3G5LA 1G64A 4XOIA 3L77A 3TQIA 2C54A 2ZKLA 3K7EA 1KQ3A 1HOXA 4GPTA 1CRQA 4QL3A 2CD7A 1EYZA 3D6MA 1MZPA 2JAXA 1EVJA 3UV3A 5I7VA 1M1UA 4UUMA 2VP5A 5CFQA 4TXNA 1E7MA 2HK9A 2FQWA 1QUFA 1IHYA 2QVBA 1Q95A 1D4FA 1KC3A 3BREA 3CJRA 3MQ4A 2JJ1D 4TV9B 1PEYA 4BL5A 3CVUA 1Q3TA 1O95A 2AOTB 4MAAA 1KF0A 4A0HA 3AUTA 4X8OA 3QBTA 3HGMA 1PWXA 3EBPA 3ZV3A 2ACKA 4EJSA 4E31A 2C94A 1H8HD 3IBCA 5J5VA 3MJRA 3ZI4A 3ADOA 4ZPXA 2CKDA 3T3PB 3AZPA 3TFQA 3LKZA 4BECA 3I6QA 2CYAA 1RTTA 1U8FO 4M89A 1GCGA 2P3LA 1DPFA 5G0VA 4TVOA 2NVOA 3P19A 2ZUVA 1SUFA 4IXNA 1GIAA 4LJ6A 3MS2A 3IA2A 4K6FA 3FNRA 3I2GA 4R8LA 4C3ZA 1C9MA 1YQQA 2DFPA 3ESZA 5KSOA 2PRSA 2FH5B 2VG8A 3E82A 4EG5A 2JGEA 3H2YA 4L9WA 4AJEA 2X5XA 4ML3A 2I3ZA 3F74A 3VDXA 2VDWA 5E9JA 1SBIA 1W88A 3E3AA 2O5CA 1DBSA 5EP2A 5B1IA 4KEAA 2XQKA 5K3CA 3OFSA 3T7CA 4UM9B 3LT4A 3EW9A 4B5LA 4FJ0A 4QJ4A 1VHWA 1LDMA 5JVDB 1KJIA 2XMDA 1DRVA 2V6MA 5DTMA 2BISA 1P2VA 2WQ6A 4L0DA 3EPKA 4AN1A 3IOCA 1U80A 3FA2A 4LPSA 4D45A 3IEVA 1HUQA 4GLOA 5HUHA 1AXGA 4DLAA 3U5ZB 1C9JA 4RHCA 1XF1A 2Q41A 2QX6A 3K31A 3JYLA 3QHAA 5BN3A 5IDQA 4TZ6A 1R4ZA 2ZJ0A 3ZDYB 1O58A 2Q3BA 4CG1A 3HU3A 1WBJB 2DLCX 2GYYA 3P2MA 4R1UA 4AJ4A 5L7YA 5DM70 1Z62A 1MRZA 4XQ0A 2XVAA 1BIFA 3KZ1E 1T1GA 4CM7A 1D2MA 2J0UB 1KHHA 2KI5A 2XWJI 1XB2A 2GZHA 2V5UA 3VHQA 1HRKA 2GBCA 3SZUA 2HMYB 2QMQA 3WIVA 1WOYA 3RH0A 1GKYA 3KQQA 3DT6A 4MW7A 5D51S 1ZFNA 3ZWBA 3DE7X 4BBZA 3OI7A 1PGOA 3GBVA 5LZ2A 4BUJA 1Q12A 4R51A 1PWZA 5DW0A 3GIDA 3N6RA 1OC4A 3WMEA 4NATA 4ARAA 1F8XA 1R88A 4K9DA 4IJMA 3OFND 3A06A 2BOVA 1SHJA 2RIPA 2PFKA 1E59A 5L45A 2JJ8A 1HZJA 3EQ7A 3KUDA 3LA8A 5FP0A 1ZJ5A 1I2BA 4D81A 3S1SA 4BXOA 4AF7A 1XWFA 1R6UA 3C8HA 3UYLA 4EG0A 2CV0A 5CDHA 4LV5B 1CR6A 1P2FA 2A8YA 2YHUA 3NGXA 3O03A 1KSGA 1PX0A 3RAJA 2FEXA 1V3QE 4ZVKA 3ZC3A 4YAUA 3LF1A 5J9FA 1V6SA 3DE2X 3C2QA 4UTOA 4CV0A 2YXPX 1E2PA 4ZA2A 3UT6A 1NAIA 4E70A 2O8DB 4R1TA 4G26A 4PZLA 4XA8A 4XX0A 3VR6A 4R8KA 4YRBA 2GJSA 4LZLA 3AVPA 2AX3A 2BI7A 4KKVA 1E4EA 1L5WA 1B4DA 1OBVA 1OAOC 3H13A 3VR4H 3FGZA 1NLMA 2OKCA 5BR4A 3JRWA 4ISBA 1J2UA 2GPAA 1C7QA 5FBHA 4FYVA 2HFKA 1JHXA 3IEKA 3AI1A 4TMXA 3GO4A 3RHTA 3HB0A 1SOMA 2G5PA 5JNRA 3EPRA 2ZRPA 3LGAA 1UKEA 5AW6A 2HU2A 4CHGA 3ZD7A 5D3QA 2QMZA 3LGXA 6REQA 2WP8J 4PHFA 2RH8A 2E48A 3AHCA 3ZHTA 2LW7A 2HRQA 5F1KA 3VZDA 4OUDB 3B8EA 4BFLA 2KBFA 4DCTA 2QN2A 2XBLA 3C48A 1VM6A 3DFMA 2BONA 3HY6A 4A7PA 1S2GA 2EHJA 1D2GA 3BMNA 1DG1G 4CV2A 4UDNA 4LDRA 5E6UB 5KAMA 2NXWA 3O3MB 2HCBA 4RFSA 4CQMD 2D3TA 2AC4A 2O1XA 2XOKA 1IY2A 5H83A 3Q4GA 2ZVDA 4BX8A 2CUTA 1P1HA 1T0HB 1UR5A 2NZ8A 2REQA 3DHYA 1XEXA 1ESMA 4MVYA 5CFNA 2ZE7A 2ZI7A 5ESDA 1XU9A 1BX3A 1KI6A 3DE0X 3KZMA 1TDJA 1DV2A 1M5TA 5ENDA 5FA5A 4DRZA 4OHXA 4YDSA 5A0VA 1RWVA 4ZYZA 4KWHA 3LRPA 2GBFA 2ODPA 3C7KA 4PLCA 3ZBPA 4CLOB 2ZUTA 3QVGB 3QG1A 1MENA 3BOSA 4XLLA 4AZWA 3K70B 1TE2A 3FI0A 3VNSA 1OU4A 3FDJA 3BIOA 4Q21A 3EDRA 1NUTA 3ZGNA 3KTFA 1H6AA 4WNCA 3O6VA 4P0TA 5F78A 4KTTE 4NMLA 3S4YA 1PR3A 2FEWB 4ZO4A 3W3ZB 2HSJA 4P33A 4TMTA 2I1VB 3FVWA 3BB1A 3CUEF 3ZV6A 4AS1A 1EEXB 2QIOA 3KRTA 4EHLA 1RRKA 1RYBA 3EJ6A 2X15A 4BLPA 1QIMA 4KQMA 2L18A 3F2VA 3RNOA 2V96A 2DFKB 4DBLC 3GVXA 4N9WA 5FUYA 3FOBA 3DE5X 1FSSA 4PSAA 1UBHS 1L4UA 3JQAD 4EB6A 1ONNA 2FFQA 1WXGA 3IKTA 4HZUB 3ZHBA 3PFGA 5ADVA 5JD4A 621PA 4W8OA 3CLKA 4J9VA 4XZ3A 4BP1A 5D00A 1T8PA 1K8YB 2ZE8A 1C1YA 3FG9A 4RVFA 5FNVF 3WNBA 2JCSA 4HNAA 4JQCA 3V42A 4QLBA 1QAQA 4P0QB 1JIXA 1D9XA 4B6GA 2F3PA 2H5LA 3BEDA 4DUGA 4EHKA 2QWXA 4EMSA 2FFBA 4TUYA 5EWMA 2FSFA 3GIWA 3LQQA 2XCSB 3AB8A 4AMGA 1QCCA 2TMYA 1KZ7B 3OU7A 3PNQA 4BTEA 1YQUA 1X7ZB 2GXSA 3GP5A 4KG7A 4V2IA 3NVMB 3JQCA 1WW8A 5BN4B 5BQXA 4Y2XA 1XNHA 1GG5A 1ULHA 1IWBB 4AC9A 4G63A 3DBVO 3PGKA 5HGXA 3OQ1A 3M6LA 4F7WA 3L7MA 5KQRA 2JAHA 4HCJA 3KYCA 3AW9A 1IOZA 2NPOA 4GX2A 4M37A 4WFKA 1FBNA 4V0RA 3SVZA 4BKUA 1G5TA 2O2XA 2Y9MB 3QWIA 1CJVC 1LI7A 2QX9A 4AY2A 1C8VB 1Z9BA 1X1DA 3NAMA 1BHJA 4E5VA 4PSUA 4TKLA 3TR6A 4N6GA 4WERA 4KJXA 3M6UA 2YVAA 5DLQC 4EPYA 3J80A 4EZEA 2XXAA 2AZ4A 1ZLXA 2EP7A 1MO3A 3GQVA 4ZHQB 5I9IA 4D0LB 4WDRA 1BA3A 5EIHA 1DO8A 3MHPA 2OORA 1OC2A 4IO0A 5EJ8A 2CXNA 2CL0X 1NMSA 1JA9A 2I8CA 4RMIA 4YGYA 4E13A 5BSHA 1IBSA 3MCAA 2BEUB 2AV6A 2OAEA 2P2NA 3K6SB 2HO5A 3VR4A 1FUUA 2WVAA 4C05A 3EVBA 5A5FA 1K0FA 4M60A 1UC5B 4AJ2A 3D8BA 2Q2VA 3KTOA 5F2EA 1TUEA 2X86A 4G8JA 1QZTA 1DC3A 1SB9A 2O6HA 3C8MA 5EYPB 4CL8A 2OHFA 1B23P 4N4AA 1QZ3A 2FFRA 3JARA 1RWQA 3N8KA 1U7UA 1Z5WA 3KEFA 3OIVA 4PQEA 2APJA 1GGHA 4BLSA 4S1PA 4KV7A 4PLPA 4P82A 3QW2A 4YJGA 1MAAA 2B98A 4KXQA 4D8UA 5L4LA 4RTSA 3WIOA 5FULA 3GELA 3M4JA 3VYUB 5LD2B 1JH9A 2FQXA 1B6SA 421PA 1UPUA 2I9KA 3T7SA 2RBEA 2C4VA 4DJDC 3RS2A 2F00A 4XRGA 2DFTA 4U4AA 2XI4A 2FDXA 4JJFA 1Y6JA 2PWBA 1DJNA 1GCIA 2NZXA 1PHRA 2EKDA 2X9GA 4P7JA 4N5DA 3LQRA 4OQ4A 1C3EA 3L1VA 2W0MA 4FNOA 3UOAB 4CXMA 2RHMA 2J9YB 3T94A 3C16C 2YWCA 4PRYA 4ZMSA 1CY4A 1NKTA 4M8NE 5G4KB 1XDUA 5H7XA 1QTQA 1CNMA 2B3TA 1HWYA 2DUNA 4QLOA 1W1WA 1XWIA 1U7TA 4G0QA 1TT7A 2YINC 3AILA 3TNFA 5LIPA 2VBGA 5JSZB 4YYEA 2CSXA 1NFQA 2NV2B 3OTOB 1O96B