4LOAA

X-ray structure of the de-novo design amidase at the resolution 1.8a, northeast structural genomics consortium (nesg) target or398
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
158
Chain Sequence
SLAKNIVFIGESGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKASEIWEQYGWNFALEQEQKMADFFSSCEKACIATSGSFVNVSNLEKAGFCIYLKADFEYLKKRLFPLFSDEIKWKKHYNETLSKYEQKANFILNIENKNIDELLSEIKKVIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De-novo design amidase
publication title Northeast Structural Genomics Consortium Target OR398
rcsb
molecule tags De novo protein
total genus 59
structure length 158
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4loaA00
2ZSFA 4M1WA 4C0SA 4URWR 1GRQA 1P9WA 2GAOA 4LV5B 1E2KA 1GM5A 3C41J 4LBYA 4PAOA 1IXSB 1Z6TA 1Q0UA 3T5GA 2ZRHA 1Q1QA 2W0MA 2BWJA 1T3SA 2F43B 5AJWA 1XEFA 3O47A 2GHIA 1JNYA 3I1FA 1G5PA 3DM5A 4G5GA 1KKLA 3R8CA 4BLTA 3VAAA 5GVSA 2R6AA 4C7OA 4WZBE 2V1XA 1E9CA 4L4UA 1NIJA 4TN1A 4UXJA 3ZVRA 4HLQB 1OFHA 3IIMA 1LFDB 3CRVA 3WY9A 1XEXA 1FL9A 3KQUA 4ZDWA 1VKJA 3ND9A 2VSXA 5IK2A 4DDWA 1W0KA 4IEIA 5DIFA 5FBVB 3A1SA 2C9OA 3AP3A 4BFUA 4D80A 2XB2A 1E94E 4LHZA 2QSZA 1CLUA 3B2EA 1NBMA 3FKSA 4ITRC 2JJ8A 1W2HA 2JA1A 5L8VA 4YXWA 3K09A 1Z06A 4LJ9A 5TXGA 3W5JA 2WVJA 5BYJA 3ZZUA 3SDZA 1CR1A 2GNOA 4GT1A 2GXSA 2HYIC 2F7SA 4EFLA 1P9NA 4M22A 2CLDX 4OQMA 1JXOA 2JCSA 4PAQA 2JEOA 3L82B 2NPFA 3SYNA 1P4SA 2ZVPX 2IYXA 4EAQA 2C96A 2O8DB 2KBFA 2ZUDA 4IXMA 3QKRA 3GJ5A 2Z4RA 1CJKC 1G16A 4HAZA 4A0GA 4TYWA 5IF9A 2OBLA 3EW9A 3O8RA 1ZIOA 1G7RA 1TQDA 3HPRA 2IWHA 4FMCB 4NCIA 1D2NA 4IXNA 3N2EA 3OZXA 2X77A 3X1DA 2HYDA 4POAA 3H86A 3QF4A 1U99A 1G3RA 2HF8A 1KO8A 3LRPA 1H8ED 3SYKA 2C5LA 2LWIA 4PO1A 2W2VA 5CDFA 4QOSA 3SJZA 1A2KC 3WP1B 2E87A 5KNDA 3GJ4A 1XD9A 4DHEA 1O87A 1W0JD 2DR3A 3P4XA 3VNVA 4Q4JA 4Q9KA 3WHLA 1KZGB 3QQ5A 4GSYA 2XNSA 4MUBA 1AM4D 1XMIA 1LV7A 1QF9A 3E2IA 3HDTA 2Q0HA 5FPYA 5EUQB 4DCTA 4TYQA 4P4UA 4V0OA 4OI0A 3LBHA 3FHOA 2VBCA 4DDTA 4V0KA 2A9KA 5H8WA 3OHMA 1F2TA 3AP1A 3CX7A 3TK1A 2ERYA 2BKUA 1XPUA 4P4TA 1NKSA 3IIKA 4CT5A 1N6NA 4FN5A 1LF5A 3V4FA 1OH7A 3EPLA 2CMKA 2WHXA 4LI0A 1SHKA 4YMWA 3MJRA 1W47A 4LDJA 5BN5A 3LQQA 1ZYUA 1VTKA 1II9A 3LLUA 4PR0A 4Q1BA 4ZCLA 1GDDA 3TSOA 4P3YA 3WBJA 1S3SA 2R6FA 2GK7A 2W6ID 3ECCA 4BFVA 3GLFE 2PX3A 4LY6A 2QGZA 3CRW1 4LYFA 1RJ9B 2ZI6A 4FD2A 4ZIRB 2B8WA 1CJMA 1JJ7A 1H8EA 1G6OA 1VDZA 2ZYWX 2SHKA 1E9EA 4OL0A 1KI6A 1OHHD 1XXHE 4GMDA 4Q1FA 4QGGA 1IJEA 3I8SA 3AVTA 1W0JA 5DH9A 3FVQA 1WRBA 2OAP1 5GVRA 1FFHA 1X8JA 1XCPA 1BH2A 1YRBA 3PCRB 1NL3A 3AKEA 1DAMA 1E2QA 2D06A 1XZPA 3MJHA 3K0AA 821PA 5E7JA 3C5HA 1R8QA 1M7GA 3U4QB 3Q72A 5JS8A 1GL7A 3L8YA 3Q7QA 3Q5DA 1Q22A 3E1SA 4ACBA 3B1XA 1II8B 2IS6A 1LS1A 4BPBA 1OXUA 4ZI3A 1H8HD 5J4LA 4WXPA 1X3SA 1R7RA 2ONKA 4HEJA 1GITA 2ASEA 1RFLA 3RVBA 3PUYA 2OILA 4BZQA 2YC2C 1T0JB 1M7HA 2FFHA 2D62A 3GLIE 4B3BA 2AK3A 4B3XA 1R5NA 4M2LA 2VF8A 1T5LA 2JIZD 1L8QA 2ZSDA 2V55B 1SXJB 5DHFA 1OHHA 3M6AA 2WOJA 5F9HA 2HJVA 1D6JA 2QPOA 4U00A 3SR0A 4OHVA 1JI0A 3PG5A 3AVPA 4JYCA 5E3HA 4JLNA 3FMIA 4TMXA 2A30A 3NC0C 3GP8A 1PUIA 3IGFA 3HR8A 2FSFA 3A4MA 3PEYA 1H8HA 4CT4B 4PPGA 2NTYC 2QTVB 3V00A 3UMRA 2GVDC 4Z51A 2R65A 3K9HA 4RKEA 2ZRIA 4DLRA 4UNNA 4FWTA 2QE7D 2YOGA 2VIIA 4B35A 4ZDIA 2OCAA 4DCVA 1G7CA 2D7DA 4IVRA 3SS8A 2GCOB 3CH5A 3LH5A 4DSTA 3RS5A 3L0SA 2J7KA 2IS1A 3OEHD 4DXAA 3HP1A 2J45A 2P3SA 2JIZA 1CKEA 3L0IB 4H1UA 3ZS8A 1NG9A 2O8FA 3SFVA 1RRFA 4G0NA 3T1VA 3K0SA 2IYVA 2XJ9A 4EUNA 1R5BA 1DG3A 4OK6A 1CBUA 2XJ4A 1ZRHA 3U2QA 2FF7A 5KDDA 1ZAKA 2B21A 2IHBA 3U6BA 1VYVA 2N1BA 4L9SA 2OXRA 3FDIA 3QKUA 3CNOA 5KYKA 1KSJA 3EZ7A 421PA 2PEZA 4IDHA 2XSZD 1SZPA 1E2MA 1P3JA 1T6NA 3GCGA 2GESA 1RE0A 1Z22A 2CE7A 3NBZC 3A1TA 3FFBA 4KCGA 1DE0A 3CZQA 2DPXA 4LHYA 4Q4AA 1AN0A 5EJEA 4P31A 3PENA 4RFVA 2H7VA 2JASA 3WNCA 2JLSA 2GA8A 3FMOB 2VSFA 2UKDA 5AUNB 4EPRA 3EZ2A 4E03A 3X2SA 3OIYA 2OCYC 5B58C 1DS6A 4Q21A 3UPUA 4GNKA 4CGZA 1PLKA 4KFUA 3OEHA 2XGJA 4EQ6A 3CX6A 4Q01A 4Q18A 1IXZA 2ZJZA 4FCTA 3SJCA 3QKSB 5C46F 3THYB 1J8YF 4DWJA 2RCNA 2QP9X 2FG5A 4HLDA 4Y0VA 4NPHA 3DHWC 5HCIA 4CEHB 4NZYA 5EZ5A 5KSZA 2WJVA 1ZNZA 4JL5A 1E2PA 3DDCA 4TMWA 3OFND 2VF7A 3GLFA 3NTUA 2PLRA 1CTQA 1R2QA 1UKZA 2XSZA 3SJBA 4DC9A 2NIPA 3S1AB 3K09C 1W4RA 3F3YA 4JLBA 3A58B 2F1IA 4A9AA 1SKQA 1ZM2A 3LWNA 5DO9A 1XF9A 3P20A 4DLYA 3TGPA 1KSHA 4O3MA 4L9WA 4B3GA 4B75A 2C8VA 4PC2A 4AKIA 4QBGB 4YLGA 2F9LA 1TF2A 3U3OA 1WA5A 5FI0B 5E95A 1Z5ZA 2OE2A 1HT1E 4NYJQ 4R2HA 4BQSA 1MKYA 1IM2A 4A82A 1R0ZA 3DKPA 3CIOA 4M8NE 1P60A 2ZRDA 3DZDA 4C3ZA 2IYQA 3R8FA 5DISB 1IY2A 3GLGB 2ZYUX 5EP1A 1A5TA 3EA0A 1U0JA 2BDTA 2WKRA 3GLIA 4PFSA 3ZH9B 3OFNA 4EPYA 3MWKA 2NQ2C 2VP2A 3QG5A 4B6EA 1EFHA 2AXPA 3NEJA 3EWAA 2V4ZA 2BJVA 3GJXC 3KJGA 1J90A 1UJ2A 4PHGA 2ZM5A 3IHWA 3R9XA 2GZDA 3LDAA 2XXAB 2C9CA 2J59A 1US8B 1XRJA 1OXTA 4CEJA 5B64A 3WHKA 3IILA 1IXRC 1W48A 2W6JD 3H1TA 4Q9JA 3U3RA 4LX0A 4A36A 2WBLC 1MABB 1R10A 4G1UC 2XTMA 2CCJA 3TAHA 1KO7A 2WMOB 3LW8A 3CNNA 4PPFA 5GJVC 5LBIA 5EXSA 4EPTA 1NLZA 2VP4A 3LO5A 2GJAA 2IYWA 4QGAA 4Q03A 4BGDA 3WYFA 4L5BA 1XTQA 3I5YA 5EE9A 4ASUD 3CF6R 1V5WA 1W4CA 2ZI3A 4DLZA 1AKYA 4DLXA 1G8PA 4M9QA 3PEUA 4HAUA 5G40A 1P75A 3CLVA 3WNBA 3OAAD 1OYYA 4LSGA 2W0SA 4V0NA 3TW8B 5FH9A 4DDUA 2HDNB 1KK0A 5HZKA 3IBYA 5JSZA 3D8BA 2KJQA 1L2TA 4BFZA 1N0UA 1RRPA 2G6BA 3SQXA 4BWYA 3GJ0A 3DM9B 2Z43A 3BJIC 1U8YA 4OBEA 1RYHA 1EXMA 1S9DA 3BFVA 4IHQA 2RGNA 1E98A 4BEJA 2W6JA 1FUUA 1ZM9A 2ZUBA 3ASYA 4BECA 4OI4A 521PA 2EFCB 2VSOA 1NVVR 4NCNA 2BM1A 4KODA 5LB2A 1E1QD 2FZ4A 1NKTA 3K9NA 1ZW6A 4MRSA 5DE3A 4ASUA 5TMPA 1TQ6A 3EWSA 3K9GA 2V7QD 4FINA 4NHOA 4BLSA 5EXPA 2EYQA 2B8TA 1IJFA 3OAAA 3EIHA 4Z54A 5F2EA 1U94A 4Q7JB 4BEBA 3FHTA 1QHIA 2L0XA 3NXSA 4RKFA 3G0HA 4D81A 3L2OB 2AKAB 2X2EA 4I4LA 5KDOA 4XVUA 2GEUA 3BC1A 4XSHA 4HUQB 2CHGA 1F6BA 1TAGA 2QM8A 1P9RA 2WKQA 3KXLA 3UKDA 1VCOA 4BFTA 1SVWA 4P4SB 2JAQA 4LC0A 4KYUA 1KNXA 3CRRA 4JVLA 4LOAA 5H1YA 4PZYA 3ADBA 5CK4A 3QEOA 5D3MA 1G3UA 1NN1A 1KK2A 1UFQA 1ZIPA 5FUVA 5FUXA 4JZKA 1E0AA 3F5FA 1GKYA 1E3MA 4QL3A 4EPVA 2W00A 4FCWA 1E1QA 3BH0A 2OSBA 4S2EA 1A1VA 1DAEA 3TMKA 2C98A 5FOUA 1IN7A 4F38A 5HKKD 4NKRA 3SE0A 4RSGA 2ZRNA 2V7QA 4MA4A 4V02A 3OIWA 2HT1A 4QJ3A 3U5ZB 1FMLA 1HV8A 3CBQA 1RYFA 5L3QA 4IDOA 4CVNA 3U7GA 2IF0A 1IONA 2ZI4A 4IDQA 4TLEA 1P73A 5JCPA 3MUFA 4PO9A 2G83A 4OI2A 4I99A 4UXIA 4NDZA 2VHQA 1XB2A 4M1MA 1DELA 1ZNWA 1XEWX 2DFKB 3K70B 1D2EA 2WWWA 4HB2A 3C15C 2JLQA 3VR6A 2FGJA 3AKYA 4RZUA 4N1AA 1RRGA 4YMSA 4TTRA 4I1OA 2PT7A 3EX7C 5FL7D 1FW6A 2H18A 3EIQA 1KI2A 1RW4A 2F1JA 3WMGA 5BW8A 1AZTA 1VHTA 4F93B 4JLVA 4U02A 4C0LA 5IT5A 1W2GA 3EARA 3WYAA 4A0FA 2H1LA 4HZIA 4LBWA 1E6CA 1U81A 3HWSA 1SHZA 5EP2A 1VG0B 4RJLA 4WZ6A 4HUTA 4QHSA 1ZJ6A 1EX6A 2VHUA 1YVDA 1E2JA 2P6NA 5HKKA 1G21E 4FMBB 3T12A 4AY2A 2FJUA 2BHRA 1T9HA 4E5UA 1QVRA 3FPAA 4XWAA 4G01B 4JLJA 2RKOA 4DIEA 3U3KA 5EUMA 5J4KA 4IVPA 2ATXA 3VU9A 2HXYA 2DB3A 4LJ8A 1LS6A 1P62B 1NJGA 4PO8A 2V1UA 1KO1A 3W6OA 3TR0A 2FSIA 2C99A 1N5IA 5DI3B 5EQTA 1IAQA 2JLXA 4CDGA 2YC4C 1EFRD 2ZXUA 3REGA 3MWYW 4AYXA 3EASA 4KFTA 3ZVLA 4OQFA 2KWIA 4OQNA 1E4YA 5G3ZA 4HAYA 3GD7A 1DG1G 5FL7A 1E96A 3BGWA 2FWRA 4FIDA 4CEIA 4Q02A 1N6PA 2F3RA 1TQ4A 4D25A 1YRAA 5FPKA 4W5JA 1GRNA 3IQWA 4GRAA 4OYHA 3TIFA 1YZQA 3R7WA 1ANKA 2ZSAA 4ZKDA 2D74A 4C7OB 3VR5A 4BZXA 2G0TA 4JVNA 1AA9A 4IDPA 2Y8EA 1IN4A 2C04A 2IL1A 5C18A 4BE7B 5KSPA 1GTVA 1YE8A 3KX2A 1KDOA 4DB2A 1HEIA 3I32A 2GF9A 3T34A 1ZNXA 5SZHB 1X8LA 3JVVA 4HAVA 2D7CA 3FTQA 3FHCB 1VG8A 2B6HA 4ILEA 4FI3C 4OQLA 3KJHA 4PANA 1EFCA 2JJ1D 4WAUA 4F91B 1EFRA 4RD3A 3TW4A 1C4OA 4ZPXA 2ZRLA 4A8JB 2BBWA 5FBRB 1HH4A 1Z83A 4ARZB 1JECA 3ETLA 4V0LA 2FSHA 3CRMA 4URUR 3CW2A 2DWPA 4W5HA 2YJTD 1D9XA 3A1WA 3KZ1E 3Q9LA 1CS4C 1KMQA 4Q00A 2VH5R 1KI9A 4OI1A 3WBKA 3IO3A 5GJCA 2RGAA 1VHLA 2AXNA 3FMPB 4OHWA 1P7CA 4LJ5A 3NBFA 4D6PA 3GLHB 4MYCA 2GZHA 2ANCA 5HPYB 1UKVY 2GF0A 3QF7A 1KMHB 3A4LA 2ONJA 2MMGA 3H0KA 4HYYA 1NP6A 5HZHA 2ZROA 3U44A 2E9SA 2DCUA 5KU1A 1OE0A 2VYFA 1OB2A 4IDNA 3ADDA 1BKDR 1IY0A 3TNFA 2O8CB 1IQPA 4DVGA 1CJUC 2K5UA 2ZJOA 3BD9A 5BQ5A 2YWFA 1NRJB 4G3XA 4P0TA 4ZCMA 2WAYA 3THXA 3TR5A 3B13B 1WBBA 5HE9A 2JJ1A 4BASA 3HU1A 5JEDA 4DCNA 1J70A 4UNRA 2GCPA 2OT3B 3UANA 2ECKA 2ZI7A 2HJGA 5FBLB 3AVOA 2IX3A 1ZCAA 2CCGA 3VNUA 5CLLA 1UDWA 2YWEA 1NLYA 4OK3A 2IW3A 1ZM4A 2NZJA 2XOKD 2IS2A 1VG1A 1VYTA 4MH0R 1YZLA 2ZU0C 4M1KA 5DGXA 4DB4A 3MGCA 4PC7A 2YHSA 1F2TB 4MRVA 3ZD7A 1T91A 2WPDD 3VKWA 2BM0A 1DBSA 5JMTA 1HT2E 5F9FA 3EZ6A 4HATA 3MD0A 2C77A 1XDBA 3HJNA 4WA7A 2C95A 3BBPA 4C0BA 2ORIA 3RSLA 2F55A 2ZR9A 3CR7A 3JZAA 2QRZA 1M34E 2RGNC 1L7VC 2QROA 4IW3B 4D26A 2NMVA 3OIVA 2QT1A 5KUTA 3KJIA 3FYHA 2D3WA 2OXCA 2O0JA 2QL6A 3K0FB 5FBQB 3IHLA 3KDSE 4AKGA 3DOFA 1TF7A 1FX0A 1NLFA 1VCNA 1ZVQA 5K8TA 4IOKA 2P5SA 1QHSA 5B30A 5AUQA 1QRAA 2AFHE 2QN6A 2ZJ8A 2XOKA 4FWIB 2IUTA 2REBA 3WNDA 1NY5A 5SZJA 1R5OA 1RZ3A 4ACAA 4FMDF 4B34A 4EKDA 4ESVA 3BWDD 3ZZTA 2PBRA 3MWJA 4JLMA 3J81k 4QGHA 3QEJA 4KU4A 4KV9A 4ON9A 2H57A 3U3JA 1Z0FA 2J7PD 2JDID 2R6GA 1FTNA 1QVAA 2WPDA 4NH0A 4QFMA 2VPPA 2RGCA 4OKSA 3VFDA 1ZCBA 2AWOA 5AR1A 1R8SA 1GOTA 1VECA 3B6EA 4URXR 2G0NA 2XNDD 6Q21A 4HB0A 4KSCA 2FV8A 2WTUA 1N2CE 1N6OA 2ZYVX 1KHTA 2BOVA 2WWFA 2QAGB 2FX3A 2ZR7A 2ZTSA 5TDHA 2AWNA 3DVLA 1RC8A 1ODFA 3PFIA 3CM0A 5FPTA 3QPUA 1RKBA 1DAKA 2ZE5A 2HLDD 1LNZA 2PZEA 4DT1B 4D2IA 3DO6A 1ZMXA 1GNQA 2QGNA 2F43A 4JL8A 4LPKA 3ASZA 1P2TA 3W3AA 4Z8XA 4B33A 3EC1A 3JVUA 5KSOA 4GZLA 4MYTA 4YONB 2FSGA 1XTRA 2JLVA 4TYNA 2ZVQX 4X8HA 4R98A 2GETA 1N6RA 1E9AA 1N3BA 2WJJA 2J7PA 1MO3A 2JDIA 1M1YE 2GBLA 3NHBA 4TTQA 4GDFA 1KJYA 3A36A 4TQUS 3W8RA 3CWZA 1JPNA 3QVUA 1OSNA 5DYIA 4EJSB 3B9PA 2R6CA 4HLCA 1HY3A 1FP7A 2QMUA 3TSWA 2XNDA 4PC3A 5IHPA 3P4YA 5C2JB 1QHXA 1Q3HA 2KBEA 3RDPA 1IN8A 3KQHA 4GFDA 5E7MA 3U61B 1DO2A 3TUIC 1TNDA 2OO7A 1Z2AA 2P2LA 5JCZA 4A0RA 2J9RA 2VP6A 2Q3FA 3AH8A 3A6PC 3PUWA 5LD2B 4LWZA 4MKFA 1T4GA 3E5HA 2HLDA 4JMPA 4NYMQ 4PHHA 1AZSC 3Q3JB 4Q47A 5LPNA 721PA 1OXXK 3LVQE 2FMXA 4DUGD 2CJWB 1XMJA 2CDNA 4LCBA 4PC6A 3SHFA 3TE6A 4TMKA 1G8FA 1A82A 5HTKA 3SEAA 2NOAA 1G17A 2O8DA 2XZPA 1JAHA 4JLAA 4M4SA 4B3DA 1D5CA 2QMOA 4US2R 5UKDA 2W6IA 4M1YA 3AEZA 1DAHA 5JWOA 3LBIA 3QNUA 2O5VA 2QMEA 2ZRMA 4HLUA 2O8BB 4HZUB 3P1JA 5FOXA 1N6HA 3U60B 2ZQ5A 1W5TA 2ZJBA 4LGMA 4US0R 2RAPA 4WZAE 4D4KA 1Z28A 3U6KA 5L3SB 1Q12A 2QENA 5KPDA 2BBTA 2OFWA 4B48A 3BK7A 1FNNA 1U2RA 3EPKA 3KXKA 4ZV4A 2HCJB 5JJKA 3B78A 1S1MA 2P0EA 1KI4A 2PT5A 3B60A 3QG1A 5ELXA 1XJCA 1PZNA 4MRNA 1YZKA 3GEHA 4V0ME 2WSMA 2XX3A 1T3HA 4WOPA 4BRUA 5C1BA 2GXAA 2YINC 1I4TD 2G3YA 4PSKA 4DUGA 1W36B 3A4NA 1GUAA 3PEVA 2IT1A 1G5TA 4QXAA 4UNSA 4D4JA 4QRHA 3WRXC 1EESA 5BWMA 3Q5EA 2WV9A 4C9BA 3L8ZA 3AVQA 1KTVA 4DLSA 4X8MA 3PXGA 4NONA 4TQ9A 4XIGS 3ZJYA 1VPLA 1XXHB 1U90A 2IF2A 1KOFA 4R2IA 4TL6A 1D9ZA 4M9XA 4ZI2A 1N5JA 2GJ8A 1FMJA 2P67A 2Z6VA 3NBYC 4MGZR 3UIEA 2QPTA 4MUAA 3ND8A 4M53A 1UAAA 5CB8A 4DCSA 3QXCA 2OBNA 1OFTA 2LKDA 1KDPA 4TSFD 4X8LA 1KDTA 1RJ9A 3OESA 3SC3A 4ZIRA 3SHWA 5KO2A 4IOJA 3AF0A 2FGKA 4JJKA 2ZAOA 3ICQB 1JAIA 1SXJD 4A1FA 2YNMA 2ZRFA 2PMKA 2RHMA 1OIVA 3QKTA 1FP6A 2Q9BA 4Q5IA 2O8EB 4DKXA 4AG6A 1DO0A 4LUCA 2ZS7A 1GP2A 2F1HA 3AV0B 2HCBA 5CB6A 5CITA 2ZE6A 3MLEA 1ESNA 3U4QA 4MYUA 1KIMA 1UBEA 4N0DA 2IC5A 1KK3A 5AJVB 2QMHA 2QE7A 4ZCIA 1II8A 3CO5A 4MQBA 4DRZA 3SZRA 1E99A 1GWNA 1EK0A 4NP6A 1UF9A 4L8GA 3W8NA 3B5JA 2GXUA 1MRNA 1P2SA 3T1QA 1RRCA 4B2PA 2JLWA 1HE8B 2O0KA 1UKYA 2YYZA 3LA6A 4IRUB 2WIBA 1WDTA 2BCGY 4O0MA 4UQOA 3IBGA 5CIWA 4GOKA 3V9PA 4DSUA 4TSFA 1E0JA 1S96A 4BLPA 4JKIA 4WIAA 3RHFA 1F2UB 2QRNA 4LV6A 1DADA 2F3TA 3TVTA 1E32A 3EPHA 1SXJA 4RCZA 1A4RA 3P32A 3RYTC 1FZQA 3RABA 2NZ8A 3RS4A 1G6HA 3U7EB 4URVR 4NYIR 1ZD9A 3VHLB 2REXB 1YZNA 2OFXA 4C0KA 1ZM7A 2J0UB 3AF2A 2GJSA 4D4MA 1K5GA 3P26A 3CH4B 3PV0A 1SVSA 2ATVA 2IYUA 1N5KA 1FOEB 4LYHA 4E22A 4Q48A 4AKHA 4KYIB 1X1SA 3WMEA 2NO0A 1AS3A 3PR1A 5DYGA 4C4PA 1FNMA 1VYUA 2Q9CA 1XCGB 1IHUA 2R6DA 1XNJA 2A5GA 3EZFA 3LVRE 4TTPA 3ZS9A 3T61A 1N0VC 4ZDJA 2CL7X 2LKCA 1W4AA 2GCOA 1TTTA 1WMSA 1KY2A 3H84A 2G1JA 2ZR0A 4TL9A 3AVUA 1G41A 1OIWA 2N46A 1LF0A 4EDHA 3U7HB 1DEKA 4Q1EA 2XEXA 3F0TA 5CJPA 2BVNA 4XJXA 1BMFD 1TU3A 1QG2A 5EP4A 2EQBA 3ZDQA 3N70A 4MGKR 4YMUA 5F3WB 1KGDA 2BJWA 3KKNA 4TYYA 1K6MA 4XWOA 3BE4A 2I1VB 1XD2B 1AIPA 1Z29A 2JJ2D 4QNRA 3T15A 2FPMA 2R9VA 2V6IA 4DBLC 1JR3E 2QP4A 3KB1A 2QUZA 3RRYA 2EFDB 1CP2A 4Q4HB 4XVRA 3FKQA 3KUCA 4V0MA 4DDVA 1UBGA 4MKIA 2QORA 4LZZA 1JR6A 4JL6A 3EC2A 5J4HA 2WM9B 1TUIA 4DLWA 1GKUB 1Z63A 4QM6A 4TMTA 3SU8A 4D0NA 2O8FB 1KJWA 2ZJYA 3OE7D 1G7SA 1G1MA 2P65A 3QKSA 3THYA 1BMFA 1GZSA 121PA 4E07A 1OJLA 1B23P 2GBLC 4CEHA 3I4LA 5DNYB 3NEYA 2QTFA 2UVQA 5TV2A 4B74A 1CR2A 4BLRA 3I62A 1NMXA 3L43A 4UXHA 3BFXA 4B2IA 1KO5A 3PEWA 1A2BA 3MMPA 2OCBA 2IXFA 4JLDA 4FW9A 2X1VA 3AVVA 4EFNA 1Z08A 3S1AA 1HQCA 1OYWA 2W58A 4LYJA 4NU0A 4Y0AA 3SN6A 1KAOA 4QBHA 1EWRA 2QBYB 5FTNA 1E2DA 5JI3E 4TT3D 2IWRA 4JBYA 4C0AC 2IUUA 4AI6A 1JJVA 1K8RA 1S8FA 1U0HC 2GEDA 2NO7A 4AYWA 1TEVA 3BFKA 3UWOA 5JS7A 5G3YA 3THWA 3QJYA 4MKHA 4NCJA 1UDXA 1NG1A 1JB1A 3QXJA 3PUVA 4XD7D 1X8KA 3AM1A 2W2TA 5DSZA 1Z6XA 1LY1A 3OE7A 4I81A 1MT0A 4RZ2A 2AX4A 3SI7A 4C0JA 2PH1A 3IUYA 1KO4A 2XZLA 2PCJA 4UKDA 3VR4A 5JJIA 4M1SA 1Q57A 3GEIA 3TSZA 4PX9A 2FE4A 2FH5B 3OIUA 2EW1A 2ZJAA 3LV8A 2RGGA 4II7A 4JKYA 4MKGA 5FOTA 1YZTA 2CL6X 2ZRPA 3F8TA 4KFRA 3TUJC 2QT0A 1EFTA 3GLGA 1YZUA 4KLNA 2OUKA 2AL7A 1IN6A 3NBXX 1GIAA 1G3QA 1BOFA 2A5DA 2VHCA 4GMXA 3ZGXA 4HLUC 1G9XA 3VU9B 1OFIA 1AGRA 4JVSB 2BMFA 1E4VA 4TLCA 2ZRAA 1PLLA 3CZPA 2ZANA 3K1JA 1E9BA 4TT3A 2FPLA 2GK6A 4RVCA 4JT2A 2PZGA 3W9YA 5K8LA 3DOEA 3MRSA 2XXAA 1N6IA 3PUXA 1QHHB 1US8A 1JXMA 1XJQA 4QHTA 5CK5A 4TMVA 5FUWA 3U7FB 1ONBA 3WMFA 2QAGC 3LY5A 5EE3A 2QSYA 2ZE8A 5EXXA 4XD7A 1MABA 5FBWB 3KQKA 3T35A 2CCKA 2QAJA 3CPHA 1JR3D 3I5XA 5TB5A 4XTRA 2ANBA 2C78A 2D2FA 4OHYA 5EE5B 4IJMA 5BN4A 1OLOA 2IUSA 3VR1A 2ORWA 2IBMA 1XD8A 3VR2A 1Z0AA 2ZE7A 3GFPA 3KJEA 1OW3B 2YOFA 4O2LA 1OFUX 5AWFC 3DMDA 1N6KA 4JT4A 4U5XA 3KTAB 2ZI5A 3C8UA 2DHRA 2FN4A 1Z8FA 1IOZA 2FFBA 4NCHA 2AR7A 2XAUA 1PJRA 3GJ7A 4D4LA 2IHYA 2Q3MA 4MGYR 2J0VA 4DZZA 3CNLA 3AF4A 1NN3A 1COWD 3GEEA 2DFLA 4TZ6A 4YMVA 3BERA 1P6XA 2GRJA 1MH1A 2NG1A 3KFXA 2WICA 4LYAA 3TJZA 3T1TA 2BBOA 2GJ9A 4Q1CA 2X2FA 1WXQA 2FU5C 2ZSBA 3R9WA 3HU2A 3UMFA 4AYTA 3QENA 4GOXA 1MO6A 4AURA 1JR3A 2IYYA 4WW0A 1CF4A 4QM7A 3NH9A 1XBTA 2ZRGA 3AGPA 5CIQA 2NO9A 4Q9LA 3UG6A 2Q9AA 2D2EA 2PMDA 4RFSB 2VRWA 3FFAA 4XVQA 4KBFA 2A5YB 1UPTA 2CBZA 5J4YA 4C0QC 2ZPTX 3LFUA 2OEPA 4B71A 4QNMA 1PV4A 1YQTA 3K70D 4RZXA 2ODWA 1G4AE 2O0HA 4HUQA 1XTIA 3FWYA 4LHWA 4TYPA 4GOJA 4TWZA 5ANRB 4LBZA 5A0FA 4DIDA 2YWGA 5LB4A 1SXJC 1NMYA 1OIXA 3QE0A 4P4SA 2CLSA 1CRQA 1E2GA 1COWA 3LAWA 3A37A 1M7BA 4RD0A 1TEXA 5DLQC 4DSNA 2HF9A 3ZVNA 1KKMA 1KY3A 4E09A 2I4IA 3KXIA 3LLMA 3P27A 1XEXB 2HEIA 2ZSEA 2BMJA 4R9UC 1FUKA 1XTJA 2R44A 2IYSA 2B92A 5CYOA 3SNHA 5L3VA 3M0EA 3O8CA 4A15A 1G4UR 4I1SA 4UNPA 3IKJA 1QHGA 2FOLA 1EX7A 1XCMA 2OCPA 3RC3A 3SBEA 4Q19A 1EGAA 3N5CA 3TBKA 4MDEA 4MITA 2J87A 2P5TB 2QEQA 5BYKA 3G5UA 1W5SA 3HYTA 1DAFA 1LTQA 1NSFA 3K8YA 1NF3A 4M1TA 1G8HA 5CM9C 2R62A 3PJRA 1Y63A 2XITA 4Q66C 5H70A 1TL7C 2EFHB 5J40A 3KUDA 3WP0A 1BIFA 1L4YA 4HAWA 4F4IA 4OJKA 2GXQA 1SULA 1SKYB 2VP9A 1E2IA 1MRSA 3LBNA 3QXSA 1XFAA 2REOA 4NL4H 1FX0B 3UATA 3MAAC 4TQAA 3Q85A 3IEUA 4K8OA 2OLKA 2GEVA 4W7SA 3QKRB 2EFGA 2YV5A 3MCAA 1E2EA 2NPIA 4M1OA 4TL8A 2W83A 3I72A 2HXSA 1JALA 4LK2A 2VP5A 1YR9A 2OBMA 1G8GA 1E9FA 1XU4A 1GG2A 2CE2X 4C2TA 3K0CA 1OB5A 3V4RA 2CXXA 2EU8A 2JGNA 1SVLA 2GTPA 3TUZC 4Z1MD 1WCV1 5JEEA 5JHGB 1JEDA 3QF4B 1HE1C 1N0WA 1GL9B 1ZC3A 3N2IA 1VMAA 5JRZA 3GJ8A 2BV3A 5FR2A 1Z47A 4Q1AA 4DEXA 4GI7A 3W5IA 1GKIA 1ZINA 3NH6A 5FPHA 3CPJB 4A6PA 3EA5A 4JLPA 4RD6A 5FI1B 4F7WA 4XH9B 5P21A 4NCKA 1I4LD 3CRQA 2IA5A 1VIAA 3NC1C 3QVVA 5DI3A 4Q4JB 4B2LA 1P61B 3KKQA 1TX4B 1W7AA 1YKSA 4UJ3A 221PA 4KLZA 4QG7A 3X1ZA 4ERNA 3NDBB 1EWQA 5JLJA 4B47A 1NN5A 2NGRA 2ODBA 1BO6A 2IEYA 2Z4SA 3EIEA 2BEJA 3AB3A 1TPZA 3GJ6A 1CU1A 4PPQA 1S4QA 4BLQA 1V43A 2FA9A 1HQYE 1YU9A 4F92B 3DL0A 1ZC4A 4ESHA 2QPAA 1AKEA 2WWXA 1KNQA 2PZFA 3UMSA 2IYTA 1N5LA 1M8PA 4HDOB 1Q1BA 4WXRA 1J7KA 1JQLB 4B32A 4Z1MA 1XMSA 2I3BA 1QBKC 8OHMA 1YHNA 2EFEB 2MSDB 3VKGA 2H92A 2ORVA 1Z6AA 2A7QA 5TY0A 3QPVA 3B8HA 3R9IA 1KI6B 2OM2A 1BYIA 2PEYA 4BZPA 1DARA 2F1RA 2JLYA 4QC2A 1U9IC 4A8JA 3FGNA 2VA8A 1U98A 4ARZA 3TAUA 3SOPA 3K0AB 5CYPA 1XZQA 5TVKA 2V9PA 4HSEA 4JVMA 4FMDB 3EZ9A 3ZZ0A 1DOAA 4J0QA 4C2UA 4JJZA 2AK2A 3LXXA 1W44A 4O25A 3DZ8A 1Q44A 1ZD8A 1TU4A 4BFYA 2IEZA 1OXVA 1E2HA 4M0LA 4NE2A 3AKDA 3GLHA 4KFSA 4NTZA 1G8YA 4YC7A 2WWIA 3CF0A 4A4DA 1KDRA 2QG6A 1TUEA 1BYUA 2O52A 1KMHA 3B82A 1EG7A 1UKEA 4FMCF 2G1KA 3AUXA 3QXXA 3GFOA 4RCYA 5KDLA 1T0HB 5FFMA 1ELOA 3KFVA 3TQCA 4Q1DA 2O8CA 5JWHA 4CRWB 1PVOA 1OF1A 2B7CA 2V3CC 2N42A 4KAXA 5FTMA 1Z0DA 4GL2A 1CRPA 3BIFA 4A2WA 1S1CA 3CUEF 3CX8A 4HB3A 1Z2CA 1ZUHA 3AGQA 1WB9A 2FDCA 3SBDA 4RD4A 3AF3A 1AS2A 3TRFA 2EVWX 1T5IA 2VHTA 1ZBDA 3FE2A 3VX3A 4TMZA 2PCLA 5A4JA 1BS1A 2FEOA 2YZ2A 3NG1A 1WQ1R 1E0SA 1VCMA 1KSGA 4B3FX 5BXQC 5JZVA 1R0YA 5KNBA 2FZLA 1UADA 4TLBA 4RZ3A 1SXJE 3M4YA 4MYHA 3W3ZB 3QI2A 1Q20A 1E2NA 1R6BX 3IDQA 2BMDA 4PAMA 5TARA 1GFIA 1NY6A 2J0QA 3KB2A 2GILA 3I61A 2IS4A 2QNRA 4MGIR 1QDEA 4IOMA 4KJZA 5JRJA 1A7JA 2BCJQ 1KI8A 5FUYA 4XWKA 2IK8A 4AWXA 4YQFA 3C16C 3GQBA 4AKEA 3B9QA 3M1IA 1YR6A 5AUPB 2QU8A 3BB3A 1J99A 2XZOA 2ZETA 2RGXA 4PXAA 2DWOA 3BH6A 2WWGA 5AJXA 4AK9A 4EPWA 1I2DA 1F48A 4R71A 1X1RA 2BMEA 3RWOA 2AKYA 1YR8A 1UEIA 3W6PA 4DSOA 1S3GA 2VHJA 2W2XA 2B7BA 3A1UA 1NN0A 4YDSA 4URZR 5FR1A 3K0FA 4LJ7A 2DFNA 1W46A 3D7MA 2X19A 2ZYTX 3G82C 1J8MF 4L15A 3EPJA 2QQEA 1MO4A 1PUJA 4XTCS 5BN3A 5J5CA 2J3EA 2WMNB 1NNEA 2R8RA 2V6JA 3IIJA 2A5JA 4M21A 1SVMA 1UBFA 1FQJA 3QPWA 4I1UA 1R4AA 2UZ3A 3AVXA 3RWMB 5KSYA 5SZIA 2H16A 2FPKA 2MSEB 1P5ZB 2IYRA 4Q4AB 1KK1A 3CB4A 3RS2A 2YKGA 1NVXQ 4QBFA 1S9HA 3B1ZA 5DI9A 1G3MA 3CF2A 3D3QA 3IPYA 4G5RA 4DLVA 4A2PA 4LJAA 4P33A 3VTKA 4DLTA 1EFUA 1U8ZA 1J2JA 4EQ6B 2CVFA 1KJZA 3KKOA 3BS4A 3WXMA 4DJTA 1GAJA 1XPRA 1S2MA 2QAGA 1SQ5A 2WAXA 2GCNA 4B76A 3CPEA 1ETUA 3VMFA 4IVQA 1MR3F 1GNPA 3B1YA 3BORA 5E7IA 3H4MA 1ZM3A 5HR5A 4DT1A 3GLFB 1AQUA 4OQXA 3TLXA 5M04A 3HYRA 4LC1A 4C30A 2OAQ1 1ZP6A 2RGEA 3RANA 3MSXA 4JSTA 4LJ4A 4Q7LA 1GSIA 4AIIA 4GP6A 3K53A 4NYIQ 2OFOA 4F4JA 1HA3A 2RB4A 3ZIAD 3RC8A 5EP3A 5FTLA 5LDDC 3K70C 1NMZA 2WWHA 3RSOA 3KQLA 1HURA 1GILA 4PQYA 4EJSA 1FTSA 2OLJA 1HUQA 3ZD6A 3TVDA 1Q21A 2JLRA 3BB1A 2WOOA 1FPMA 3T1OA 2WJIA 5JECA 4DLUA 2EWVA 5JFGA 1OPXA 3AF1A 4NYMR 1GRRA 4Q4LA 3RS3A 3RRZA 3PUZA 4PTLA 2ZS9A 3X1WA 2BKEA 2Q6TA 1YR7A 5K8UA 5CLQA 3K0CC 2QY9A 3GLIB 1OH6A 4TLDA 4B43A 4BFSA 3HU3A 1XMVA 1E2FA 1UM8A 2ERXA 3AUYA 2H5EA 4WVFA 1GNRA 1W36D 2V8OA 2CJWA 5GJWC 1NVUQ 1P2VA 1Z3IX 4G5QA 3NHAA 2CHVA 2RH5A 2VL7A 3L0PA 3ZIAA 4QHYA 1I4DD 3LW7A 4PSAA 4RD1A 5H68A 4PQRA 2G9NA 3ADCA 1JBKA 2AD5A 2DBYA 3GLGE 4CEJB 2QZ4A 2GJKA 3VQTA 3OEED 2FFQA 1CJTC 5AK0A 1XX6A 4PQFA 2R2AA 3REFA 2F6RA 4US1R 1S0UA 621PA 2O8BA 4HZUA 2ZIAA 4QKQA 1JQJC 1GL6A 4N0EA 4TZ0A 2HUPA 1KZ7B 1OV4A 1D2MA 3BOSA 4JBXA 3A8TA 1M6NA 1DPFA 4P32A 5L3SA 4V03A 1NVWQ 1G3IA 1DVRA 1OKKD 1QG4A 1P72A 2GWHA 4N3NA 3GJ3A 2OG2A 4Q9HA 2ZRBA 1X86B 4B6FA 2DYKA 4KI0A 3X1XA 1XEWY 5JSZB 1AK2A 2ZREA 5AJZA 2FNAA 1Q1EA 1G291 2KI5A 1OH8A 2LCFA 2Z83A 3BXZA 2PJRA 4KVAA 1G5RA 1KI1A 1R0XA 3HPQA 3LNCA 2Z5FA 1PLJA 3LXRA 1M74A 3PITA 3ZVMA 2FEMA 2JLUA 1XXHA 2CVHA 2RGBA 3OEEA 3ZLJA 2H17A 5B57C 5D3QA 4JYBA 1D8TA 2DY1A 4A8JC 1CR0A 4QBIA 1F3OA 1DTSA 1QHYA 1ZD1A 1CJVC 1KYIA 2OESA 3C7KA 3QXHA 3THWB 3SYLA 3U3MA 1Z0IA 2YWHA 3LD9A 4LJ6A 4A2QA 3AQ4A 3EAQA 3SFZA 3H2YA 1KSFX 1NVVQ 5FTKA 2H8KA 1Q3TA 4Q7MB 4KVGA 4FCVA 1HYQA 4HAXA 2VEDA 2AHOA 4KHZA 1OKKA 4OHZA 2ZAMA 1HTWA 4BFWA 2O8EA 1CULC 1F5NA 2QM7A 4ZO4A 4BLOA 5A5GA 5C4MA 3QIAA 3X1YA 4MRRA 4EPXA 2EYUA 3UG7A 1WBDA 3NVAA 1E2LA 1NSTA 4IFEA 4KBGA 2ZJ5A 5FL3A 2CK3D 1IN5A 1WP9A 1C9KA 1W1WA 1ZU4A 3K9LA 3ADKA 1CR4A 4EFMA 1DAIA 3BAFA 2CEAA 1E9RA 2ZITA 1Y3AA 3VR3A 3QUSA 5GJBA 5FOVA 5K8IA 2GDJA 4G5SA 1TF5A 5D3MB 1H65A 4ABYA 3BRWD 3IPXA 1Z6GA 2RHDA 3E70C 4F4CA 2KSQA 2VP0A 4IEEA 4OHXA 4OK5A 4A6XA 2YVUA 3B7GA 5B2ZA 3PIRA 2BEKA 4MRPA 3BH7A 2BC9A 3QBTA 3NDPA 2PL3A 5FPSA 1KAGA 4B44A 5DN6D 1F2UA 1W4BA 4HB4A 3W90A 1ZU5A 3RS7A 1MOZA 2P6UA 4YMTA 3KL4A 2A78A 4BRWA 1OT3A 3RRNA 4HDCA 5L3QB 4QGFA 2QTHA 1T8UA 4CF7A 2JJ2A 5EZ6B 3NKVA 2ZJ2A 3DEFA 3DKVA 1ZUIA 2J0UA 1G18A 2CK3A 3I73A 2IYZA 5HE8A 1K5DA 2CL0X 3FB4A 3BB4A 3GMTA 4XSGA 1E69A 2J5XA 3AKCA 4Z8YA 2C03A 2OHFA 4W5WA 2IXGA 5G53C 1G19A 1CEEA 2G88A 4NYJR 1FQKA 1II0A 4PC1A 4ZDKA 2J1LA 3GPLA 2VO1A 3CKLA 4HI0E 1U9IA 5JBQA 3FMFA 1MO5A 4JIMA 4WBSA 3PQCA 2QA5A 3EXAA 4IKEA 3LX8A 1B0UA 2DWQA 2I1QA 3ZQ6A 3R20A 1YZGA 2X8AA 1GVNB 3DMNA 5DN6A 3VKHA 1JEEA 1LW7A 4OJQA 2Q3HA 1IBRA 1F60A 4L16A 5JI2E 2HV8A 1Z07A 4JSYA 3MFYA 4G5OA 1XTKA 1TMKA 1Z6YA 2AD1A 2J46A 2QP3A 3JZMA 4IFBA 4TL7A 2WJYA 3CONA 1N25A 2GVZC 2WWYA 3SQWA 4HDQB 4QJ5A 4X8OA 4PSVA 5EE1A 4D0LB 4GPTA 2EWWA 3THOA 1XD2A 1XWIA 2RMKA 3PVSA 1E9SA 3IO5A 3KKPA 2V54A 4M9ZA 2C9YA 1L4UA 3OF5A 2QQ0A 4Q4HA 5E4FA 3UK6A 4CEIB 1T8TA 5F98A 3QBVA 2ZI9A 1MV5A 2YOHA 1KI3A 4B3CA 1AJEA 1E0KA 3R7WB 3AVYA 4KXFB 3SJAA 5KPJA 2WZQA 3W34A 4JS0A 4TLAA 2CHQA 1KI7A 4FXPA 5GADl 2RGDA 1ESMA 4CIDA 2ZEJA 2ZUCA 4AG5A 1XJ0A 1SGWA 2KB0A 2GKSA 2WSSD 1CXZA 4BUJA 5AUOB 1CIPA 4GZMA 2NO6A 3T06B 4PZLA 3ZQJA 3KKMA 2C2HA 2J0SA 3I92A 4EJSC 2ZRCA 1RIFA 2IYLD 1E79D 4AD8A 1UEJA 3ICEA 5FOSA 1VG9B 3RS0A 2FFAA 2BIFA 4B73A 1Z0JA 3EG5A 3W6NA 1T3LA 2A2ZA 2GAAA 3VX4A 4PHTA 5DHAA 2QBYA 5JWRA 1AGPA 1X6VA 3O8DA 5JJLA 2BBSA 3ONWA 3D31A 4LBVA 5HCNA 4LJYA 3CWQA 5IDVA 5LD2C 2VTKA 3Q7PA 1NBME 1TQ2A 1WF3A 4C0HA 3UXMA 1LVGA 2OZEA 5G41A 1UBCA 1LB1B 3MG9A 4GP7A 2GZAA 4LHXA 4D82A 1TADA 3TKLA 3FOZA 2AN9A 2ODEA 2WJHA 4EIWA 3U44B 1VIYA 2AFIE 4NMMA 2NO1A 2G77B 4W9MC 2WIAA 3Q8XB 2WSSA 3B1VA 1ZUNB 3I8XA 1SKYE 2KE5A 1QZXA 4MDFA 4UJ5A 3THXB 4UNQA 4YDHB 1E79A 1Q1ZA 3GLHE 4IOLA 3NWJA 3C14C 4Q9IA 5CJ2A 3A1VA 2PX0A 4JLKA 5AJYA 1C1YA 1P2UA 3AP2A 1SVOA 5EXTA 2P6RA 2VLIA 3WYGA 1AS0A 3DPUA 4PZZA 1G7TA 2XTNA 5SZKB 1XP8A 1G64A 4ZKEA 4K46A 1Z0KA 1OH5A 3C4JA 1U0LA 5JHHB 2ZRKA 2MSCB 1QHHA 1NJFA 1RVDA 1XPOA 4DEYA 3D6TB 1NIPA 3T5DA 2CNWD 2VQSA 3C5CA 1WE2A 2MMCA 2JLZA 3TH5A 3RLFA 2CLCX 1W49A 1SVKA 4JBWA 5CDFE 1IY1A 4KITB 1DAGA 1W36C 2JATA 3L0OA 3AVWA 3VHXA 3ZYCA 1E1RD 1RPZA 2OV2A 4PPNA 1NI3A 4KO8A 1G20E 5J47A 3GFTA 3NIBA 4RD2A 2F9MA 2DFTA 3QOFA 5L3RA 4A0HA 4AC9A 3IEVA 1SVIA 1N6LA 2XTZA 4R7ZA 4JLOA 5EE0A 5KOYA 2XB4A 3IQXA 4CZ2A 4Q7KA 2J41A 5IRCD 2UZIR 2ZU6A 4RY2A 4GBMA 4CW7A 2WKPA 1U8AA 1ZNYA 2ODNA 4XOIA 4CYMA 3QSYA 2HT6A 3KTAA 2IXEA 4M9SA 2Z0MA 4K81B 3LX5A 5FOWA 4LHVA 4LRWA 1I2MA 4A92A 3I3SR 2A5FA 3CR8A 3RNLA 3QY0A 3WRYC 4U7DA 5C4GB 2TMKA 4H9GA 2Q21A 4D0GA 2WJGA 1JPJA 5KHOC 1R0WA 1E9DA 1VCIA 2CNWA 3B1WA 2D4HA 4PHFA 5KNCA 3MWLA 4URYR 3UWKA 3B85A 4S35A 3TQFA 4LV8B 4LPSA 4I1VA 3RRMA 2QI9C 3HR7A 1M2OB 2E1RA 2PLFA 1E1RA 1OXSC 5KTYA 4O2RA 4QJ4A 3LQRA 5IK2D 2A3RA 5FTJA 1W0KD 4BFXA 4KSBA 5J4VA 1XTSA 3RAPR 1YJ5A 1AQYA 2PJZA 1NBMD 3FKSD 3O8BA 4H1VA 4RFSA 4DCUA 1QHNA 3KQNA 1O3YA 4NBSA 4YXWD 3K0EA 5CM8B 2ZRJA 2ZS8A
chains in the Genus database with same CATH superfamily
3UMMA 2ZSFA 5AVWA 2REQB 3ZGYA 1AD2A 5HRUA 4I1RA 1PKEA 1WZNA 3BXEA 2PRYA 1GPWB 1P9WA 3LPAA 3SXPA 2JEZA 4ZOCA 1GM5A 2JGRA 3C41J 1IZYA 5E1OA 2JFYA 5SYNA 1JQBA 2W0MA 1T3SA 1T5HX 1Y9ZA 2OHXA 4WKOA 4AU1A 2IYEA 3IA7A 4DLPA 1KZYC 2GHIA 4MI1A 5LKAA 3DM5A 2II6A 4EGQA 3JV7A 4EEXA 3PGA1 4KX3A 4BVHA 1EAMA 3FZYA 3H5TA 3OZWA 1NIJA 3W6UA 1P29A 3E7FA 2W9XA 4TN1A 3VO8A 3K6KA 1ARZA 1SEVA 4HLQB 2JAWA 4KDFA 2C7QA 2QZ9A 3WY9A 1FL9A 1FNCA 8MHTA 5I6DA 4ZDWA 4KUEA 1S2GA 3ND9A 2J9GA 3DR5A 2JIBA 1Z2PX 1CUZA 1DIGA 1PZHA 1W0KA 4H7DA 3VH4A 2NSHA 1X7DA 3H4TA 4C04A 4DDWA 1R8JA 5FBVB 3AP3A 2C9OA 2GKOA 4BFUA 2QR2A 3RTAA 5JTUA 1NVMB 3BFJA 1U3UA 2ZXEA 4BO6A 3UT0A 4C1BA 4YXWA 4C29A 1XZDA 3MPOA 4ZCQA 5TXGA 3W5JA 5TR9A 2C3OA 1ID1A 5DNDA 3IH5A 1KYZA 3MUEA 4DADA 3ZY6A 3OJFA 4MR7A 1OGJA 5HWSA 4WE3A 2D59A 1Z13A 1NJ8A 2HYIC 4UTXA 4LK3A 4WWHA 3JQRA 1Z8DA 4OQMA 2A9FA 1VL6A 4EVQA 3HB1A 1QV6A 4FZ5A 5J3JA 1L5QA 3L82B 3SYNA 5A9TA 1OWMA 5GQSA 3TQHA 1EM8A 2EIHA 2JGMA 1KVQA 1CFJA 1P4SA 5JH7A 2W6MA 4WX2B 1G6KA 1MDFA 1UIRA 3QKRA 3GJ5A 3S2UA 1GAXA 4I46A 3OZAA 4HAZA 2A92A 4JWTA 4TYWA 4QE3A 2OSVA 5JLAA 1U8CB 3OZEA 2EIXA 3T8YA 1CRLA 2YRWA 2F64A 1G7RA 5JC8A 1AA6A 4EG7A 4JUAA 1XRRA 2JBAB 3HPRA 3FOFC 4PYJA 1D2NA 5GZ6A 1MJNA 4MWOA 3X1DA 1L8LA 1KRXA 4OJNA 2QLNA 3GN1A 5K3SA 1JIKA 1PJCA 1P2BA 2Z5LA 2HYDA 3LKBA 2AS0A 2VAXA 5JOQA 1MTOA 3H86A 5JYBA 3R7LA 3QF4A 1U99A 3I2KA 2ZAGA 4N9WA 4R51A 1KO8A 2ZIZA 3OZ7A 1H8ED 1WY5A 2C5LA 4PO1A 1L5HB 2W2VA 3SJZA 4YK7A 5ALZA 1A2KC 1ATIA 2L2QA 1E6WA 3DF9A 3WP1B 4C4SA 2DSTA 1RXYA 2LW7A 2GD1O 2DR3A 3AR6A 4CLEA 1FFEA 3PFGA 4DR6B 1KZGB 1G20A 4FYIA 4R1OA 4MUBA 3N59A 3E2IA 5FPYA 2CT8A 4P5EA 1TC2A 1M2KA 2IY8A 3B3JA 4P4UA 4Q9AA 4XB6B 4RKQA 3S2IA 4PLGA 4V0KA 3EGXA 2A9KA 1KS2A 3A2NA 5H8WA 3WRWA 3ROFA 1FSPA 1W87A 5HZGA 1CUAA 4RUKA 1NKSA 3Q9SA 5U1PA 2F62A 5F7ZA 3OPYA 1DCMA 2BFBA 3DLIA 1SIUA 2FEPA 2ZB3A 3N8IA 4L0CA 3S2ZA 2GASA 3ODGA 1DMRA 5KTPA 1OH7A 2YHIA 3MTIA 4KQFA 2M98A 1UODA 2HWWA 4K1LA 4V0QA 3WGTA 3W5BA 1LVUA 3FPGA 4IH4A 1JXAA 2ZBVA 1OY1A 1QCCA 3LQQA 4OB6A 4FFPA 1AKWA 4QUGA 1VTKA 2ZYDA 3G0CA 3WB0A 1Q0ZA 1DIHA 1TFRA 4TV8F 4CG2A 5C8XA 3TSOA 1DOHA 1BTOA 1HDXA 2QXTA 3OJOA 4YJ3B 2R6FA 2YWJA 4MCHA 3NAZA 3OU7A 4P82A 4BFVA 1U7HA 1KZHA 3GLFE 2PX3A 1TAUA 1OWPA 1V1RA 2ZI6A 4FD2A 5AXAA 1CJMA 2ZTMA 1H8EA 2ZYWX 3OURA 1Q6YA 1GZ4A 1M54A 3AC0A 1X2BA 1YQUA 2UAGA 2ZK7A 4Q1FA 4QGGA 5JYEA 3Q3EA 4KMMA 3AVTA 1U3FA 1ESEA 2XUOA 2GHQA 1V8BA 4G8JA 4LDAA 5GVRA 4TV9A 1X8JA 3UJ7A 2NU9B 5J2UF 5MDHA 1NASA 3E81A 4EB3A 4JJAA 1SHTX 2FSSA 3E23A 3K0AA 2H1SA 5CAEB 3A1EA 3C5HA 1QP7A 1T35A 2B4YA 4HO1X 1M7GA 1I2BA 2AVDA 3CZAA 4N54A 3G0BA 3THSA 4YCDA 1XKLA 5JS8A 4MPTA 2Z3WA 3D8TA 1DIOB 3Q7QA 5LUBA 1GT91 3DOUA 1DFGA 1II8B 3E1SA 4H3KB 3SMVA 3T99A 4ACBA 5KX5A 5L9AA 4BPBA 4W9RA 4IILA 1DQPA 2HQSA 4QOGA 3R0XA 1X3SA 1R7RA 3QWBA 3L8DA 4IL5A 4LSMA 3VKUA 2IZ6A 3EQ9A 3FM9A 1HTTA 5GV7A 1GITA 1QYDA 2WNSA 1W581 2ASEA 3VSEA 4N7MA 2J3KA 4YTEA 3RVBA 5CA0F 1EJ0A 2P35A 1ULHA 2I29A 2YC2C 3NFYA 4IDCA 1JTVA 1NPTO 1T3ZA 1YCHA 2B4RO 2FFHA 5EQFA 2K2QB 1T0BA 1ZR2A 4X92A 4B3XA 4H0FA 1R5NA 2VF8A 2JIZD 2PRIA 3G2LA 1L8QA 3K9BA 4NAVA 4Y30A 3UJDA 2HR1A 2AJCA 1P2FA 2F1KA 2V55B 2XRFA 4IH9A 3FCUB 1HRDA 2WU8A 3LPMA 2WOJA 4PLVA 2WG2A 4XPIA 4U00A 1F0YA 3COVA 4MRMA 2Q2QA 4Y8VA 1OBCA 5GIPE 1KOLA 4YP0A 3AVPA 4H16A 1ACJA 2FW9A 3JYQA 4IHJB 4QEDA 3DE2X 1RM5A 3U7EB 4F2DA 3EVFA 1R0LA 3U4IA 3RJMA 3CA8A 1TJPB 1TKRA 2DUWA 2C7GA 1E3EA 4E13A 3L4JA 5JZMA 1SCUA 4R84A 1T26A 1CY6A 1VJ5A 3KDAA 1VL0A 3BGSA 4ND3A 1Z4PX 3PEYA 2FWJA 2EX0A 2FXIA 4FXOA 4CT4B 3E48A 3KZVA 4PPGA 1QQAA 3M3HA 1LLQA 3RW9A 1RD4A 2QZSA 3HUUA 3RIGA 5IABA 2R65A 5EZQA 4DLRA 2X8BA 1FE8A 2YOGA 1L7QA 3IKLA 4Z2AA 3F5DA 1C7FA 4LW8A 4F06A 4U2GA 3WTBA 4DCVA 3ZCQA 1G7CA 4ZDIA 2IV3A 3Q8WA 5FLYA 5AW0A 3W7AA 3LWZA 3PHCA 2JS7A 3WLJA 3MK31 3IB6A 4TKUA 4B7UA 4UTNA 5HDQA 4CKCA 2JIZA 3L0IB 3MIIA 1MNAA 2FY8A 4I8XA 4TROA 5D6NA 1ATZA 3TLZA 1RRFA 2NZUG 3UZUA 3HS3A 3V6MA 1XZNA 4AMZA 1IZ9A 3R3UA 3K4HA 2ZYRA 3GGCA 3JQ6A 5P8WA 2FJ0A 1AC5A 4J16A 4M0DA 4BNTA 3LQFA 1B0AA 3N6RA 4MQFA 4OOEA 2XCRB 1Y81A 3DZGA 1REQB 3PCTA 2EDAA 2OXRA 3LXUX 1KMIY 2A59A 2YICA 3FR8A 3CNOA 3EZ7A 2O4CA 5T64A 1OBOA 4MROA 421PA 2PEZA 2QYSA 4M54A 2I34A 1ZAYA 2DFPA 3VZBA 1MTZA 4C06A 4G41A 1RE0A 2CE7A 4FK8A 2R8EA 1KE2A 4LHYA 2DPXA 3IJ5A 5LJLA 4NJMB 2JLCA 5ECWA 3EA4A 4OM7A 2RIPA 1BXGB 3WKBA 5F1KA 3HJAA 3BEDA 3PENA 1BG6A 2R1TB 2CUZA 2W37A 5EIBC 3FMOB 1BX0A 4JN6B 4RDHA 4EPRA 2DKOA 1J8QA 1U2SA 1YB2A 3EZ2A 2Y1OA 2YJGA 3NBQA 2CHEA 4EL5A 8LDHA 3RT9A 1FC0A 3R3JA 3QFTA 4DANA 1PLKA 4W5OA 2XODA 2HK6A 1DC7A 4EQ6A 2XGJA 2X8WA 4FUTA 4XA8A 1IXZA 1GNTA 1KRHA 3HBMA 3DCNA 3LZ6A 2H0RA 1XZKA 4RHTA 4D3ZA 5C46F 1Z4OA 1J8YF 5ECDA 4BVAA 3FD8A 2PUBA 2HRCA 3TCKA 1KVTA 4H7FA 1PWXA 1U2TA 2FG5A 1PR0A 2ZTLA 1WULS 3DTNA 2WNIA 1ZH8A 5I51A 3I5UA 2ACEA 3V4ZA 1M1YA 1Y89A 3BA1A 5KSZA 4MB2A 4DLLA 1XZFA 4GMGA 4P36A 4EGCB 3RASA 1E2PA 3QEBZ 3DE7X 3DZBA 3OCWA 3ZKAA 3OFND 4NX2A 3H1BA 3V9AA 3GLFA 3NTUA 3Q6IA 2C57A 1W5EA 1CTQA 2OXFA 3H83A 4EKEA 5FXMA 3N6XA 5HQTA 4DV7B 1GU1A 2QW0X 1AK1A 3KSMA 4YIKA 5C31A 1C9DB 1C0PA 1J21A 1W4RA 1BQ4A 2CB0A 3MB8A 4WCFC 4A9AA 1SKQA 3FAZA 3FPJA 4KUHA 5HNKA 1O03A 3LWNA 1XF9A 3TZCA 4DLYA 3TGPA 2YCBA 1DB3A 1ZG3A 3K2IA 1CY7A 1KMCA 3JQAD 4L9WA 5A5VA 4H7EA 2R0QC 2BI4A 3D0RA 4BNYA 7YASA 1XHLA 3HB0A 1XPJA 3H65A 4EHLA 3NT4A 3DV0A 4RPGA 1ZXLA 3IJPA 2Q7OE 1QPZA 1JA9A 1WZUA 3LGXA 5FI0B 1O89A 1V3UA 4F71A 4S2UA 1W2WB 3TTXA 4R2HA 4BQSA 1MKYA 3F2IA 4ZA2A 4EHKA 2UZ0A 3AOGA 4NBKA 3DKPA 5BP7A 1DQRA 2EEPA 3H4IA 3WLQA 5CFOA 1RU3A 3D7LA 4YDQA 1A9SA 4M8NE 4DDHA 2ZRDA 1YBAA 3DZDA 4HQNA 4XEUA 2GM4A 4GKJB 3S7TA 3NGMA 1S5PA 4R68A 2ZYUX 2XQIA 3L40A 1A5BB 4KXMA 1V26A 2BDTA 2WKRA 3FNEA 1LDNA 1EGVB 2PSSA 3OFNA 3V7YA 4ZT2A 3QHAA 4YV1A 4B3RB 1HE2A 2NQ2C 3UK2A 1NNI1 3QG5A 4UBJA 1EFHA 4B6EA 1WUTA 2AXPA 4UM8B 1Y33E 2DPHA 2HADA 2ORYA 4LZPA 4UNIA 1K5PA 3R9XA 1UJ2A 4JHXA 2PMBA 1K3FA 3LUBA 3GB9A 1M6YA 3CLRD 3LDAA 4EKIA 4IUDS 1G2IA 2ZIEA 2XAAA 4YCSA 3JQAA 4MPJA 4CEJA 3WBFA 1ULUA 1JTEA 1PG2A 4Q9JA 1J0DA 1RJGA 3PKJA 3ZDZB 4D9IA 3PWTA 5EJ8A 1EK2A 2IZ5A 1RQXA 1T9GR 2XTMA 4CR7A 5TQ0B 3LQ2A 3L7KA 3PFHA 3W8EA 5JSQA 5KWSA 4UULA 4QOFA 2IYWA 1MPTA 4BGDA 2PWAA 4N12A 1GGFA 1CX9B 1M76A 1QFJA 2WJWA 3E15A 3PS9A 2IUYA 1M2NA 2WM8A 5H16A 4AO8A 3G7SA 1N78A 1AKYA 5DV9A 4AJEA 1TZJA 2JGJA 4KLAA 3KWJA 5FNZA 3FUWA 4E2WA 3F6EX 1BMDA 4ND4A 4Z7OB 4UDNA 1YZHA 4Q34A 3TW8B 3F90A 1H0KA 1E8MA 4RVFA 5J59A 2L69A 4P35A 1XWWA 5JSZA 3ICPA 3OPQA 3NALA 3RE1A 5LMNB 5TMEA 2PSHA 2D54A 1M8JA 4BFZA 1N0UA 1HGXA 1RRPA 4EMUA 4QYSA 4AJIA 1JQ5A 5GINE 1Z5PA 2PRSA 5J5VA 2V0GA 5C34B 3AWIA 1DBIA 2Z43A 1W75A 1L4BA 1VLQA 2I4RA 2NVUA 4U2FA 4AP5A 1E92A 1PSWA 2WFLB 3WFZA 4BMPB 2RGNA 4O4IA 3W3AA 5IT4A 3USCS 1ZM9A 5ILGA 1KEZA 4HT3B 1W85B 4FGKA 1P2DA 1EZ4A 2V58A 4RABA 3ASYA 3FG9A 3BUSA 4MUHA 3NYQA 521PA 3S55A 1NVVR 3BDAA 4NCNA 2PNFA 4KODA 3JR3A 4OU5A 3ZV5A 1WMFA 4JLSA 5TX7A 5AXDA 1M1XB 3RC9A 3R5FA 4HYQA 5K3EA 5ALGA 3KFLA 2IGTA 1M66A 1TQ6A 1ZIDA 2Q3DA 3QEKA 4KN6A 3KQYA 2H8GA 3K9GA 2V7QD 4KPUB 4O2BB 4AS3A 2P91A 3OZTA 4WEQA 4AS2A 2JFHA 3NTRA 4WKCA 4KPFC 2C59A 4Z54A 1FFWA 4YJHB 5MFZA 1QHIA 3NXSA 5I7HA 1P1IA 3R7AA 2TSYB 2Z3VA 3DWFA 4RMGA 3QMVA 3UK0A 2AKAB 1QXSA 4I4LA 4KQ2A 5KDOA 4K05A 4XVUA 5HIMA 2R00A 2FRDC 2GS9A 1F6BA 4FDAA 1TAGA 4JI7B 1H2BA 2QM8A 2WKQA 4U7GA 3VH2A 2FK8A 5GONF 4OFWA 1D1TA 1SVWA 4FHDA 4GI3A 4HUJA 4LC0A 5LXTF 4N48A 5AVRA 1VM6A 3QWAA 5H1YA 4DMGA 2D1SA 3ANXA 4PZYA 4LGVA 1JSZA 5CHYA 2PXCA 5CK4A 3H2JA 5I4KA 1BWSA 4EHAA 2QMYA 1ZIPA 2ASVA 2XYHA 3GOQA 3O1IC 4JZKA 1YRWA 5LZ5A 2UVDA 3IDAA 1MIOB 3LGSA 1JX6A 1ZJZA 1EBBA 3DBHB 2LCQA 2FRXA 3DO8A 3E22B 4PBTA 2Q7XA 2W4IA 3F3KA 4LKRA 4F38A 2TS1A 3VYTB 2WYWA 2NYUA 4J0IA 4P8RA 2V7QA 5AO9A 5EQDA 4IZIA 3CF4A 3OIWA 5KSWB 3MC1A 2HT1A 4E1BA 3ROZA 4PYQA 1XZAA 5AOBA 3GG2A 3U7GA 2IF0A 2XZDA 3IRUA 3Q3GE 2D4AA 2E4AA 1UFOA 3H19A 2XNHA 1PQWA 4OI2A 4PO9A 4UXIA 5T4BA 4M1MA 4U3JA 4FR0A 1XEWX 3TF5A 3EXHA 4E31A 5T6BA 2NPOA 4NBNA 1A4IA 2ZKLA 3KYCA 1UC4B 5KYUA 1RC0A 4J0JA 4E4YA 5MN4A 4YCLA 5ALNA 4UFNA 3ICWA 1QX3A 1M8GA 3QOXA 4KJXA 1I4WA 1KZ6A 1PO7A 3QX8A 4MARA 4PCAA 1JG6A 2H18A 2ISSD 3EIQA 2NV2B 3EMKA 2IU3A 3CN7A 1AZTA 5BW8A 1M0EA 4HC4A 1Y3DE 3EARA 1RWKA 2RJNA 2H1LA 3KEMA 4A0FA 1V8PA 3EDCA 1KE1A 3S8YA 3HWSA 4GDMA 4BMOB 1SHZA 4M7OA 5A2QA 4RJLA 3MWEA 2Z1NA 3P2OA 4HUTA 3QMWA 2YHUA 4PS0A 1XCOA 1N5RA 3TQOA 3UAGA 1GUBA 4XJVA 3IBSA 2YFYA 2FJUA 3DDOA 4KXNA 3JQ9A 3TXYA 1V47A 4UTZA 2ATXA 3E8XA 1MB0A 4FFVA 3VU9A 4EGSA 3SXUA 2DERA 2DB3A 1I5EA 3CY6A 4PO8A 2GAJA 1H1LB 2OAEA 5HBRA 2JD2A 3KZKA 4YV2A 2C99A 4QUAA 1FVOA 1UFVA 2VN8A 4F9FA 4BNZA 1U7PA 2JLXA 1UZUA 1I36A 5LA6A 1ZSVA 3ZVLA 2XKJE 2WUEA 3JZFA 3CPSA 5TVGA 1NJ6A 2BEVA 1XNHA 1YS4A 2O7QA 3G1WA 2XDYA 3FYDA 3GD7A 4LFBB 3IP1A 3GRCA 1E3WA 4B8YA 3GRVA 2BW0A 1YV9A 3W4IA 4Q3CA 4MULA 4LXGA 3KD3A 4DBLE 2ZSAA 3VUEA 4DREA 4ZKDA 4C7OB 1L5VA 2P2NA 5EWLA 4DR1B 1RAEA 4PNEA 4JVNA 4LMPA 5EJ7A 1XVLA 5BW5A 3NOQA 4G09A 4HZGA 4RPKA 2QRJA 4L3OA 3IP7A 3H11A 5EJ2A 1GTG1 1E5DA 3MM4A 4WESB 3HMQA 4WOBA 1DBWA 1LDMA 1QHEA 5C18A 1GPDG 1GTVA 4EG1A 1EVQA 5TPZD 5T41A 1N2IA 1KDOA 1SBCA 4DA7A 1HEIA 3I32A 1NUSA 1T1JA 1YDFA 3RAFC 5SZHB 3L7YA 4BC0A 4J0HA 3CNEA 4RLSA 1T8WA 5DKFA 3B89A 3C3WA 3FHCB 3PHBE 4E08A 3L8GA 1YJQA 4DA4A 4YUWA 3KJHA 1WHTB 4P3OA 1C4OA 2O2HA 4WXMA 2FMFA 1CZKA 2BBWA 1WMDA 3E2MA 3I9NA 4OXIA 4ARZB 4E5SA 1JECA 3ETLA 5A0TA 1ZJJA 3HQ4O 4W5HA 3A1WA 3Q9LA 2ACVA 1LDBA 1M6VB 3DVQX 2EF0A 4FDVA 4WLUA 3NV7A 3U62A 5GJCA 1SU6A 1XI2A 2B69A 3M33A 1VHLA 1PGQA 2P9EA 3OU6A 3OOJA 4B40A 3B9BA 4B83A 1P7CA 1QNLA 1TB4A 2VEOA 1ZWLA 3Q3VA 1D2CA 4MYCA 5CFZA 3IMFA 3IB3A 2C4UA 1M6WA 2GZHA 4EA6A 5HPYB 2JCBA 1UKVY 4CQLB 5ALTA 4EJ6A 4ZYXA 2BN4A 5FA5A 4PGHA 3A4LA 3P97A 1HFEL 1TZCA 8ADHA 4MXDA 1U0RA 2XZTA 3L1JA 5TPZA 1ENZA 1BKDR 3TNFA 2O8CB 4KKVA 1GPLA 1ZHFA 1CUVA 3OBIA 2K5UA 3BD9A 3JQCA 2ODTX 1SQGA 5BQ5A 2HM7A 2YWFA 3C8ZA 3KCQA 4NV1A 4P0TA 5DEIA 3RTCA 4Q9NA 4QPZA 3THXA 1DQSA 3WIUA 2H4YA 1HNXB 4OM8A 4ARUA 4G9EA 3V7WA 2PH7A 3HB7A 3PNLA 5IBQA 1NF8A 1QDUA 3K5PA 4BASA 4BNUA 4XWTA 2OT3B 3AL3A 2VUUA 5M29A 5EHXA 2E18A 5CDHA 2G9VA 4I8DA 4CL8A 3OUTA 5DGCA 1QZZA 1TCVA 1NLYA 1P1HA 3PRYA 2IW3A 4EYSA 4AB1A 1K9VF 1XSEA 2XOKD 1OYVA 2NP6A 2IS2A 3AI2A 1QH8B 1U7UA 2DQZA 2PBZA 1OU0A 1FW8A 5ALDA 2PGOA 4ZZIA 3EE6A 3D64A 3ZV6A 4DB4A 4I1PA 1SURA 4NS4A 2E5FA 4PC7A 3G8CA 3TFWA 1HDGO 3H0CA 1GPAA 3HVJA 3H3FA 4M87A 4RZIA 4YMIA 2Q8PA 1G9TA 3O5AA 4M60A 3CISA 3DE5X 3M8KA 1L4HA 4DGSA 1FQOA 3RSSA 3LT0A 1E5QA 5HK9A 3MD0A 2I2AA 3D4PA 5L6MB 4DOMA 1BD4A 1A7UA 2E4YA 4EHBA 1B8PA 2IUEA 3RSQA 2F55A 3CR7A 5BW6B 4PZAA 3JZAA 2OCXA 2QRZA 5EIEA 2A67A 2X5OA 1M2VA 1M34E 3UC5A 1LPOA 1RI2A 3I9KA 2QROA 2Z8XA 1DL5A 4IW3B 2IP4A 2XUAA 3HB4X 4CU2A 4F60A 5KUTA 2NMVA 1SXGA 2GRAA 3FYHA 2D3WA 2OXCA 1AKQA 2QL6A 3GPIA 4MEBA 4BX2A 3E9YA 2PD4A 3IHLA 4CG1A 2L82A 1BDBA 3KDSE 3RBVA 2VHWA 3E2PA 1JMVA 2ZQYA 5KYVA 1WUIS 2DWUA 5K0SA 1FX0A 5BN3B 3GGOA 4IZ6A 1ZVQA 3P7MA 3UOAB 4Z49A 4LMRA 4GZ6A 3O2NA 3ET4A 4NCAA 2M9MA 5AUQA 4UAGA 4K03A 4F3TA 2QN6A 3W3AD 2XOKA 5YASA 4B34A 3WNDA 4D9GA 5SZJA 1OOEA 1FDUA 4ESVA 1L7DA 3BWDD 1MV8A 2QTWB 1G60A 3OMXA 3PYMA 3WB9A 4JLMA 4YV0A 5K09A 3FMVA 4QGHA 2OZVA 4KU4A 3GDHA 2OCIA 3AESB 2MR5A 3E8MA 1NVEA 1RMQA 2VPPA 2RGCA 4OKSA 3LHKA 1PVVA 3VU0A 3MJTA 4HAOA 5AR1A 1MW9X 1NQXA 2XIJA 2R7NA 4TPKA 5DM70 2XUPA 4OQZA 2JGAA 3C45A 3B6EA 3PICA 4KREA 2H5IA 3RIYA 1H2WA 1N1GA 3EXFB 3AYXB 2ID8A 4N7RA 2BHLA 1QCYA 1N6OA 2GUWA 1KHTA 3A6HA 1FTWA 1BFUA 1EUCA 4E70A 4NCBA 4GZ3A 1XCJA 1A9TA 3TS1A 4DARA 2A33A 1Q84A 2ZTSA 3R5XA 3VU1A 1QO0D 2AWNA 3DVLA 5T3YA 4F3KA 5J23A 2IHTA 3GWZA 4ML3A 1ODFA 3K7EA 2CWDA 5K2MA 5EA2A 3W9BA 4B79A 3A9CA 4FSHA 2CLKB 4XYGA 2HLDD 1YB7A 4K9SA 2QGNA 4JL8A 2HDOA 1P2TA 1A8SA 2H1FA 2OVBA 1LVHA 2V5AA 1UWKA 2AQHA 1UIMA 2V7GA 3HDJA 3JVUA 4YAGA 3KEGA 3MYYA 1B1CA 3KAPA 3PFBA 2JLVA 3I2IA 4X8HA 4R98A 2PKQO 5IC6A 3G13A 4WACA 1ZO8A 3BCUA 4A6EA 3PE3A 1TVKA 3NHBA 4XGIA 2P4EA 1GZHB 1LPBB 4PZUA 2FW7A 2X5JO 3TXXA 4EJSB 3GMSA 2R6CA 4OHFA 4CDRA 1NVDA 4JV5B 1UR5A 5KOHB 1PL6A 3TSWA 4BNFA 1QKKA 1SOVA 1XZJA 2QJWA 1Q95A 3CLTD 3PL1A 5C2JB 1QHXA 1Q3HA 3PXAA 5AVXA 3UNXA 3I28A 3VSAA 2DEUA 4HVAA 5CH8A 3RHZA 3IUJA 2VQEB 1JSCA 3RVKA 5K6AC 5AJUA 2VZLA 2HIAA 3TUIC 3MINB 1TNDA 1QO0A 3NM6B 1LJ8A 2OO7A 5A05A 2IU0A 1F7UA 4KACA 5D00A 3ZWOA 4HPXB 3BHIA 3I45A 2Q3FA 4EW3A 3A6PC 3PUWA 5LD2B 3G6WA 3FNBA 3E5HA 1WTAA 3U0BA 2HLDA 1MHTA 5JTTA 1Q14A 5DWDA 4PHHA 5HUJA 4NXMB 5INTA 1LX6A 1MT3A 3HM9A 1AZSC 1XU9A 2AMFA 3PK0A 3MMNA 5DMHA 1KKUA 3LVQE 3MCVA 5JT1A 2CJWB 4NVRA 5SY9A 4LQDA 4PC6A 2O06A 2RARA 4LAFA 4TMKA 3LL7A 1G8FA 4HD8A 2O8DA 2XXJA 3W4JA 5FWXA 5HW0A 1A50B 4AZ3A 4JEMA 4B3DA 1JAHA 4CF4A 2QTZA 1D5CA 1JWBB 3DYIA 2J3MA 2O1XA 2OWDA 2R6ZA 4M1YA 4A91A 5KQLA 3TVYA 1D09A 3SX2A 4M7WA 4YB8A 3BAZA 1Y8ZA 2JZOA 1HDZA 3P1JA 2ZYGA 4NY1A 4NBWA 3U60B 1QJ4A 1SC3A 2J5BA 4R0MA 1N36B 1ZCZA 4MUXA 3DKKA 4MW0A 4LGMA 4OQQA 7REQA 2WVGA 5L3SB 4LDNA 4N7JA 1CC1S 2OV6A 3F73A 1TAHA 3PTAA 3IP8A 2A0UA 3A6JA 1CZRA 2FUCA 1IJBA 3QNWA 4CTMA 5JJKA 1S1MA 4CM7A 3B60A 1GSAA 1R4NA 4NNPA 5JXGA 5ELXA 2PZBA 4DV0B 4GO1A 1AKMA 3GEHA 4KP7A 4QUJA 1V39A 4WOPA 4BAUA 2C7VA 1I32A 5K0NA 4DM3A 2QX4A 4PSKA 2GERA 5E4JA 1GUAA 3ZDEA 4YCMA 2IT1A 2KS6A 3JCZA 4IV8A 2I33A 4WK6A 5J4LA 2A1IA 3U9SA 2JD1A 2VLBA 4C76A 2I99A 3L8ZA 3N3BC 1U6JA 1DX4A 1H9AA 4JODA 4NONA 4X8MA 3PXGA 3KS9A 2I2BA 4TQ9A 3SNKA 1J5XA 2H06A 1I6LA 3ZJYA 3E9QA 1U90A 5JQGF 1KOFA 4F6RA 1ZBQA 3DT8A 3IS3A 4OTZA 4MGZR 2Z6VA 3ZV4A 2XNCA 4MQ5A 4ZVQA 4OHUA 5IAJA 4DCSA 2WTNA 4CHTA 5DFAA 4FNAA 1OFTA 1B8UA 2XE8A 3NM4A 1RMTA 4DIKA 2P9TA 3NNNA 3PC8C 5DTJA 4J7XA 1HWYA 1MGPA 2QRHA 4EUSA 4A1FA 2PMKA 3PP8A 2EF1A 1FP6A 3ABZA 2HHJA 4Q5IA 2O8EB 2VAWA 1WV1A 2QQGA 2C54A 1C29B 3D3NA 3HRHA 5TJHA 3I39X 5ER9A 4GR9A 1NBIA 2RDMA 3B6JA 4XYMA 3MLEA 4PWZA 1N33B 2ABWA 3U4QA 1KIMA 5AW5A 2COKA 2IC5A 1M8KA 1UDBA 2B4KA 3A28A 3CVXA 2QE7A 1SUCA 3W5UA 3N07A 1K08A 3ZU6A 4MQBA 1NULA 1DPGA 3G5AA 1E99A 1GWNA 4C5CA 3WO1A 2YZKA 4J8PA 4L8GA 4GM0A 5KKAA 4R1NA 1SKMA 1YBHA 1KYQA 4IRXA 3WQQA 3AI3A 5JZOA 2NADA 3DDZX 3T1QA 4Q7QA 4B2PA 2JLWA 4YRCA 4R2XA 4EG5A 4JASB 3UT6A 1SWWA 2E55A 5JROA 2WIBA 1W9HA 5JZSA 4QDJA 5D6OA 2P7HA 3VOSA 4FQ8A 5D51S 3W9YA 2XT9A 5H7XA 1Y80A 3IBGA 3OECA 4D5GA 4D8XA 1XTZA 5COAA 1G8JA 4NZZA 4ZQGA 1V1JA 4ZEMA 1WW8A 5I4BA 1S96A 2HRDA 4JKIA 5AM2A 2C8LA 4FGWA 4LV6A 2MU1A 2F3TA 2CNKA 1BHJA 4QU5A 4RCZA 2J6BA 1FB5A 1PFUA 1A0OA 1FZQA 4GYWA 2RG1A 3RABA 3RS4A 4QUKA 5H82A 2ZCVA 1Y6JA 4OU4A 2XR1A 5K45A 4NYIR 2A5LA 2PMWB 5HIAA 3VHLB 3TLAA 5CBKA 3G1TA 1Q7EA 2GT1A 2Q6LA 4X7PA 3KYDA 3I01M 2J0UB 2O8NA 2IV7A 1O8BA 2C9MA 5BSRA 4TXLA 5TS2A 1N0IA 4C5BA 1IZ8A 1E64A 2C97A 1THGA 4PZEA 3UBMA 4JUCA 1QLHA 1TYCA 3QUTA 1NQTA 2FMHA 4E22A 1C8KA 4L5CA 1ZJYA 1ZK3A 3CTPA 4UDYX 4DV2B 2RGWA 2NO0A 4WECA 1AS3A 3F4KA 3T9DA 4DRXB 2W6PA 3B53X 3G89A 2KW5A 5DHPA 1XCGB 1YXMA 3OZSA 3KE9A 1JPUA 5LWQA 4LVUA 3TECE 3ITDA 3EZFA 5AK3A 4RJKA 3ZS9A 1RZRD 2I7XA 4R4JA 4YGXB 5ALXA 3FPBA 3VR3D 5BSMA 4OREX 5AI9A 3I52A 4CL2A 1Y8RA 2G1JA 3M7IA 2XUGA 3AVUA 3AERA 5JS2A 4BXOA 5EGSA 4F21A 2Q6IA 1VLHA 2NUPB 1OIWA 2QDKA 4C2AA 3W6ZA 3AHDA 5DASA 1XAGA 2EL9A 3VHRA 3INRA 4RK0A 5CJPA 5I8WA 3DQPA 2ZPUA 2ADMA 3F0TA 3Q12A 1L7BA 4ZEVA 1L4FA 5DWVA 2AZ4A 1BMFD 5AVKA 1ZN9A 2NXCA 1TU3A 2VWHA 3DONA 3WJ2A 4TSKA 2ZJ7A 1PSDA 3FCXA 4Y2SA 3AJDA 2NT3A 3ILSA 5ALUA 1LLFA 3BHMA 4EKNB 5DRTA 3U7QA 1Y4SA 4OYLA 3HNOA 3IXQA 2QVLA 3R5KA 2NT4A 4CV1A 4KKXB 4MLZA 1C7RA 5IULC 4NG5A 2I1VB 1XD2B 5LYJB 4N9QA 4WUTA 4V39A 3T15A 2JJ2D 2K7ZA 4KMRA 3AFIA 3QLTA 1HT3A 2FEWB 1R6TA 2H2HA 3L8MA 5KYYA 2QP4A 1DRUA 2HMSA 4F86A 1KC3A 3HI4A 3GDWA 3GZJA 4QLBA 2QIOA 1W35A 2QVXX 2ZGVA 3PC6A 4XVRA 4G63A 1U3VA 2PNJA 1ZVJA 5LQSA 3W8FA 5B6PA 3TNYA 1X38A 1FTGA 3KUCA 4KQJA 4DDVA 1RZRA 2QORA 1M6HA 4JL6A 2WUFA 2XXBA 3EGWA 1TUIA 2QD3A 4N6OA 4NAUA 1L9KA 3DLBA 5TRTA 4X64B 4A5OA 4HDRB 3UGTA 3VJRA 2ZJYA 4HVTA 3V4OA 4DBZA 3OQVA 3C8HA 3U39A 3QKSA 3THYA 3GGGA 4G0QA 2XQJA 1BMFA 1UMDA 1Y9DA 3T3IA 3BSYA 2PY6A 5EIHA 2PFSA 4RVHA 5DLDA 2I22A 2WHQA 3BQ9A 3NEYA 3NTQA 2QTFA 2X4LA 4NJOA 4NV0A 4X1KA 3ROMA 4G0MA 3DFKA 4TQGA 5EZYB 2ZDGA 5THXA 4D3FA 4UE6A 2OHIA 2QLBA 5B4TA 4UXHA 1PEKE 1GQOA 4AF7A 3MOGA 4UQLA 1DDOA 5B3KA 3DBIA 1QAQA 4JLDA 4FFNA 1YUNA 3KT8A 3H8VA 3LCJA 3O21A 4Y1RA 4HGNA 5AKEA 1TXGA 1TM5E 1LC0A 3S8EA 1OYWA 5CCDA 3NHFA 3T4EA 1KAOA 1E2DA 1MJGM 5HP4A 4EY8A 2GTHA 2W2QA 3P5BA 4JBYA 4O2AF 3F78A 3DZHA 3ZCSA 3ZK8A 4AI6A 4O4JF 1FMCA 3MSCA 2ZIXB 5ICMA 2GEDA 5JS7A 3THWA 1TEVA 5C8YF 5JDCA 3MBOA 3QJYA 4L73A 4MKHA 4F2GA 1TVMA 3FCYA 1JB1A 4J7CA 3SKXA 1X7YB 4Z4GA 2HU8A 2NVOA 2PO7A 1LY1A 3QITA 2HIMA 1GXSB 2A9JA 4QQFA 1E2BA 4RZ2A 5CDYA 4G8BA 3RSGA 1OTYA 1TQ8A 1KO4A 1NM5C 2MSKA 3IUYA 4UKDA 3RYFB 4M1SA 5JJIA 1NXXA 4PX9A 4H1TA 3OIUA 4OQYA 3UMVA 1PNRA 4HWPA 4KFRA 3F8TA 3ROPA 4KSYA 3TUJC 1EFTA 3AEQA 3MUOA 1VPVA 2AL7A 1RS0A 2VHCA 1G3QA 2X8LA 1UXHA 2A5DA 3O9MA 4IKOA 5EMHA 4AJ1A 1Q0SA 5KS2A 3QBJA 3B51X 5FCDA 3TPFA 2BMFA 2Q4RA 1E4VA 2FCRA 5AJTA 1K89A 1Z35A 4AJJA 1G66A 1Y8CA 3W8DA 3A27A 3CZPA 2NU7B 2BM9A 2YXNA 4JR0A 4NU8X 4P4LA 2FPLA 3CRZA 4F12A 2PQ0A 3G0IA 2PZGA 3MRSA 3F5QA 4Y7CA 3ND5A 3PUXA 1QHHB 5CK5A 4TMVA 1JG4A 2QAGC 3LY5A 4GM4A 1A71A 3ZLUA 3R0QA 3R44A 3I1YA 3QWHA 1F06A 1MABA 2YV1A 1Y8AA 2R1VA 4YLEA 1V4VA 4U2KA 1BN7A 2V0NA 4BNLA 3PFFA 1VGRA 3CLSC 3CPHA 4M86A 1ZOLA 3GOHA 1MVOA 5B4VA 3VNVA 1GKLA 1YDGA 4KTVE 5AHRA 2HSDA 2XCOA 5FF9A 1OROA 2AHRA 3VNAA 2HTEA 3EZXA 1U0SY 3HUDA 1T9CA 2D2FA 1KFCB 1TO2E 3QVGB 1YJAA 4IJMA 5BN4A 1HDIA 1DCKA 2IUSA 3G3EA 4GPD1 1N5OX 1SZJG 2PAFA 3VR1A 2BTOA 1IIRA 1E60A 3QV1A 4PSCA 4YT8A 3KJEA 3GFPA 4JYZA 3SR4A 4CKWB 4O2LA 1OFUX 1Q19A 5AWFC 4B4UA 4BMNA 2GBPA 1RHMA 3DMDA 4V0SA 5CLGA 4JT4A 4L8LA 1BHSA 1T8SA 2CNLA 3KTAB 2WZBA 2ZI5A 3C8UA 2DHRA 3IEPA 4OGKA 3SQLA 2EARA 1G5QA 2FFBA 4CNQA 4ZICA 5IMSA 2WVHA 4O33A 1MC1A 3H18A 1UWLA 4TWRA 4Z3KA 3N8NA 5CVCA 2XAUA 2RH9B