4LOAA

X-ray structure of the de-novo design amidase at the resolution 1.8a, northeast structural genomics consortium (nesg) target or398
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
158
Chain Sequence
SLAKNIVFIGESGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKASEIWEQYGWNFALEQEQKMADFFSSCEKACIATSGSFVNVSNLEKAGFCIYLKADFEYLKKRLFPLFSDEIKWKKHYNETLSKYEQKANFILNIENKNIDELLSEIKKVIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De-novo design amidase
publication title Northeast Structural Genomics Consortium Target OR398
rcsb
molecule tags De novo protein
total genus 59
structure length 158
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4loaA00
2YOGA 2CCGA 3WP1B 2ZI3A 5B2ZA 3K0AB 3BGWA 3PEUA 2CE2X 2ZROA 3C4JA 3TNFA 1YJ5A 2VYFA 1LF5A 4LHYA 1VG9B 2ZSBA 5FUYA 4DCUA 2AXPA 1N5JA 1GDDA 1W49A 1IBRA 5G40A 2VHTA 4QJ5A 3QENA 2D62A 4LJ4A 4ZDIA 2D4HA 3GLFA 2YZ2A 5TMPA 1RPZA 4MGKR 5LB4A 2FMXA 4IVQA 3GCGA 1ZIOA 5DHFA 2JLUA 1KJYA 2JCSA 3G5UA 4RFSA 2WMOB 4NE2A 2DPXA 5IHPA 1M2OB 1CR4A 2O5VA 3K0SA 1YKSA 3SYNA 1R7RA 4FMCB 1J99A 3CRMA 1XCGB 1GP2A 2CLSA 3B7GA 1JALA 4D0LB 3AGPA 3AUYA 1C1YA 2A5GA 3T1VA 4K8OA 2ZRNA 1K6MA 3ZH9B 4U02A 1NVVQ 3ZIAA 4TMWA 4EPTA 3LW7A 1GTVA 5L3QB 4F93B 2VSFA 2BEKA 2GVDC 4EFNA 4EQ6B 1QHGA 1XEWY 5HR5A 4DCSA 3K9LA 4C0SA 3K0CC 2P5TB 4N0EA 3SS8A 1DO2A 1Q1ZA 1IM2A 4A4DA 4NMMA 4ARZA 3GEEA 4H1VA 1GZSA 1SVKA 3N5CA 1W47A 3Q5EA 3QVVA 4YONB 1CU1A 1T4GA 4Q01A 1G291 2JA1A 4TLCA 3SBDA 3IGFA 2PX3A 4B33A 4C0LA 1W44A 2ANBA 3CNLA 4JSYA 2GBLA 2Z5FA 4BPBA 5B57C 4BWYA 1WBDA 1KJWA 3SYKA 1L8QA 1LS1A 2ZJ8A 2ZRBA 3KQUA 3U44B 2WIAA 4M9XA 3OEEA 2O8EB 5HZHA 1R2QA 2F43A 1E3MA 1E9EA 1ZRHA 3UWOA 4DT1A 5CB8A 1TU3A 2UVQA 1HE8B 2IL1A 1TQ2A 2QQEA 3MCAA 4A2QA 3LX8A 1HYQA 4FI3C 1YR6A 4PC2A 3B1VA 3HR7A 3RRZA 2YWHA 1IN8A 1Z07A 3QG1A 3KQHA 4TN1A 1E96A 4UXJA 4GT1A 2PEZA 2J5XA 3G0HA 4PQFA 2ASEA 3LFUA 1TEVA 2F55A 1J7KA 1C4OA 1OHHA 1RJ9A 1OH7A 2GCOA 1HQYE 4CT4B 4B3BA 1VPLA 4E07A 4BFWA 4BLQA 4PR0A 2HJGA 1XRJA 2OCBA 3PV0A 4HDQB 1W5SA 2ZRCA 3PVSA 4K46A 2KJQA 2WM9B 2OT3B 2PT7A 3QBTA 1OH8A 3CO5A 4DIEA 3TUJC 1KHTA 1XJCA 4P32A 4RZUA 2ECKA 1E2FA 1E9DA 1FX0B 4HDOB 1KI4A 4QBGB 2QMOA 1XTQA 3P4XA 4FD2A 5C2JB 2AK3A 1RYHA 5SZJA 4G5GA 1JR3E 1AIPA 4DEXA 1Z83A 2OEPA 2ZR0A 1YZLA 4KI0A 4DSUA 1YRAA 1G19A 3AF4A 2JIZA 4LBYA 2BM1A 5EXPA 3UWKA 1E2GA 3E5HA 4TMXA 4MKGA 2J0QA 2Q3MA 4TMVA 3SBEA 3V9PA 1CJUC 1LW7A 4V0KA 3DKVA 3GLFE 2ZYUX 1E4VA 2BBOA 2WVJA 3K53A 5E95A 1T8TA 3DKPA 4EAQA 4Q9IA 1QHYA 2X2EA 2P6RA 1NMZA 2QP4A 2BBWA 621PA 2X77A 1VCIA 1VMAA 5FBVB 5JRJA 4TYWA 4MA4A 3MWYW 4GBMA 4CF7A 5LPNA 2LKCA 5EE0A 4EPVA 2CLCX 3L0IB 4LBZA 4TLAA 1HUQA 1W36D 2P67A 4MGZR 5P21A 4M9SA 1G8HA 3REGA 1IJEA 4M1KA 1NLYA 5JS7A 3DZDA 3RNLA 4E09A 3A36A 1P2TA 3AUXA 4HZIA 1D2EA 1OIVA 2FN4A 2BIFA 2FSGA 4Q4HB 1R0YA 4DSNA 5HKKA 4C30A 1ZVQA 4OBEA 3T5GA 2PEYA 1E79D 4GP7A 3RAPR 1WRBA 3BFXA 2YHSA 5LD2C 4S35A 1XWIA 2XB2A 4LUCA 4LRWA 3CUEF 4LV5B 1G17A 4OL0A 4OHWA 2X19A 5EE9A 2XOKA 2IBMA 1E9AA 1Z06A 5TV2A 3NH9A 4E22A 1Q1QA 3I8XA 2VHJA 2GCNA 1T3HA 2DWQA 5EZ5A 2BKEA 1F2TB 4MYUA 2CL6X 3M1IA 5JJIA 3K0AA 4BEJA 1R4AA 3GLHB 3AKCA 3BK7A 5IF9A 4FW9A 2ZS8A 5AR1A 5ANRB 2Q6TA 2GK7A 4NL4H 3IEVA 1KO5A 1FMJA 1SGWA 1OJLA 3GLIB 2CL0X 3AKDA 3KX2A 2WKRA 5A0FA 4JMPA 1BMFA 4FMBB 3SOPA 1M8PA 2GTPA 1TQDA 1NIPA 1HEIA 2WWXA 1G5PA 1MT0A 4D4KA 1P4SA 2JAQA 1JXMA 1NJFA 5EJEA 4NCJA 3B9PA 5KTYA 1NVUQ 3QUSA 4B2PA 1EFUA 4KYUA 4LC0A 3KB2A 2HCBA 2RHMA 1UBFA 1KMHB 4HB2A 5DIFA 4A82A 3WNCA 3AKYA 3OHMA 3VFDA 1J70A 4GI7A 3PEYA 1GRNA 2PCLA 4Q9LA 2EFCB 4EJSB 1DVRA 5L3QA 3RHFA 2A3RA 2VL7A 3NBFA 4EQ6A 4DLWA 1ZJ6A 2LWIA 3D6TB 5FPKA 2Q3FA 1G41A 2R62A 1N3BA 5KSZA 3W3ZB 2FNAA 4HAUA 2ZJZA 3GJ7A 1I2DA 2WMNB 4Z54A 3WNDA 1RRGA 1N6OA 4ZI2A 1ZM7A 5FI1B 1OYYA 2W6IA 4CZ2A 2AWOA 2W6JA 4YMVA 4ESVA 4KLZA 1X6VA 2NGRA 1WP9A 4KBGA 5CJPA 1OH5A 1W4AA 4MRRA 1YVDA 2WPDD 1Z47A 3U44A 2O8EA 2D7CA 1S2MA 5IDVA 5FPHA 2WKPA 2A5DA 4QBFA 2RGGA 3X2SA 4LPKA 4QRHA 4OHXA 1PVOA 1FTNA 1GKUB 4QGGA 1Z08A 4D26A 4JLJA 2BMFA 2HDNB 4P33A 1E69A 2FGKA 2DCUA 4TZ0A 4L5BA 4O2LA 1E94E 3QXCA 4J0QA 1FFHA 2JJ8A 2GRJA 3QPUA 3MLEA 4GFDA 2ZSDA 2F9MA 4ERNA 3ZLJA 1XD2B 2ZVPX 4ACBA 3LQQA 1FTSA 5AUNB 3KL4A 1II8B 4ITRC 4BLRA 3I5YA 4GP6A 1QHSA 4D4JA 1NY5A 4JL5A 4OQMA 4RSGA 3K9NA 1VDZA 1Q44A 2OSBA 4TQUS 4ZKEA 1NP6A 1KTVA 3R9XA 3FGNA 4QFMA 4OI4A 2CHGA 2VQSA 3GD7A 2JLZA 5DN6D 4LPSA 1NN0A 4LK2A 1HY3A 2ZRLA 2BC9A 4Y0VA 4C0JA 1YRBA 3AF0A 3C16C 4DJTA 3QEJA 1MRSA 4P4SB 4WW0A 1XBTA 2R8RA 1GAJA 2WWGA 3W34A 2YC4C 5K8IA 3L0OA 3T12A 3CF2A 1DELA 4XTCS 3ZVRA 4ASUA 3B1ZA 1FP6A 2OUKA 4Z1MA 4DC9A 2HUPA 3X1DA 3GP8A 2YJTD 4M9QA 4D25A 4AI6A 2WTUA 4TMKA 1GL6A 5CDFA 1DBSA 3CH4B 4F91B 4UXHA 4NHOA 1XEXB 1OXTA 2W0MA 5CJ2A 5FR1A 1WXQA 3T34A 3B9QA 1FUUA 5FBLB 2J46A 4G0NA 4YMSA 5FH9A 4JT2A 1WCV1 2DYKA 2N1BA 4EPWA 1KYIA 2QGZA 1HV8A 1ZNZA 4MUAA 5E3HA 3VNUA 1PUIA 1FZQA 3AVYA 2FE4A 4Q4HA 421PA 3F0TA 3IPXA 3M4YA 4BFXA 4B71A 3QVUA 3I3SR 4B74A 1R6BX 1XZQA 3NHAA 2ERXA 4OJQA 3SYLA 2GZDA 2ZE6A 4KU4A 4ZV4A 2EFDB 2PX0A 3HP1A 2HYIC 3UIEA 2JDID 4P31A 2NPFA 1COWA 5CLLA 2IXEA 3OFND 5KDLA 4GSYA 1K8RA 3I4LA 1JPJA 2Z43A 1W36B 5JEDA 1TAGA 3DMNA 5KNBA 1S9DA 1AGRA 2G6BA 2DFTA 2PLRA 3KXKA 2R6GA 1XP8A 3K9HA 3EC2A 1MO3A 3AVOA 3AV0B 4OK3A 1RW4A 2WBLC 1G8YA 3A4NA 4AYTA 3EPKA 1OIXA 1XCPA 1HT1E 3CX8A 4CW7A 3FMFA 3ADKA 3LRPA 3HDTA 3GLHA 3IIMA 1LFDB 1P61B 5FR2A 3TR5A 4PFSA 3WYFA 4KITB 1E0JA 3NH6A 3MJHA 2ZE8A 2BEJA 3X1XA 1RFLA 3S1AB 4ON9A 4A0GA 4U7DA 4I1VA 1DOAA 2QORA 1XPOA 4JVSB 2NOAA 4LYJA 3GLIA 2C99A 1QG2A 2R6AA 5KSYA 3DM5A 2HLDD 1TPZA 3SN6A 2QP9X 3KKNA 2DFKB 1LY1A 1JQLB 2C96A 1EFCA 2KBFA 1AGPA 5HE8A 3RSLA 2OILA 4PQRA 2YV5A 1UADA 3W9YA 4DEYA 3DO6A 5K8TA 2OO7A 4F4JA 2AK2A 1V5WA 3A58B 1KZ7B 4G5OA 1KMHA 2PMDA 4TL9A 2ZJBA 4TTRA 2WAYA 4LHZA 1DAFA 4IDQA 1AJEA 2ZIAA 2KB0A 4EJSA 1RRCA 3LX5A 4XWAA 3U7EB 5EXSA 1IY2A 2C9OA 3ZQJA 3ZD6A 3RS2A 4A8JC 3TLXA 4CDGA 4CEIB 4XWOA 4OK5A 2FPMA 2QAGB 5KPJA 1CJTC 3PJRA 4V03A 3U3MA 3L8YA 1IY0A 1N6IA 2IHBA 1DAHA 4URXR 1KI6B 3KKPA 5KDOA 1FQKA 1XD8A 2C5LA 3ECCA 3TUZC 3ZVLA 2GAAA 1Z8FA 1T9HA 2VP6A 4Q5IA 1TTTA 3LBHA 4WAUA 2YWFA 2RH5A 4QM7A 4QJ3A 3K09A 3FYHA 4WOPA 2MSDB 1I4LD 1KGDA 3NWJA 5CDFE 3RS3A 1DAEA 2H8KA 4X8HA 3PEWA 4G5RA 3U3RA 2AN9A 2QA5A 2H7VA 1L2TA 1N0WA 2QPOA 3CKLA 1N6NA 4WXPA 5FTKA 4BFSA 4AWXA 1E98A 4LJYA 2QRNA 1G3RA 4D4MA 4M1MA 2OCYC 3H2YA 3LNCA 3GFTA 2HYDA 3PENA 1E2LA 2V9PA 5CK4A 3QSYA 2H57A 5FBWB 4I1OA 1ZM3A 2SHKA 3RRYA 1IN6A 1VKJA 2IYRA 4UNRA 2QE7D 4A92A 3R9WA 2RGBA 3VU9B 1XD2A 1ETUA 2OAP1 1AM4D 1II8A 1JBKA 5JSZA 3I92A 5JI3E 1NF3A 1KK2A 4P4UA 5AUQA 3TW4A 2Z0MA 4ESHA 1ZAKA 1AZTA 2XNSA 2E1RA 4A1FA 1XPRA 3RS4A 1TQ6A 2VA8A 3B2EA 2AFIE 1L4UA 3EC1A 4ARZB 1RRPA 3FE2A 4HLUC 4OI1A 3GLHE 3UG6A 2AHOA 2ZI5A 1MABB 3BOSA 4P4SA 1KI1A 1MO4A 1A2KC 3U3OA 2GESA 2Q0HA 4KFRA 1P7CA 4DSOA 1VECA 4HAYA 4B6FA 3GLIE 5K8UA 1N6KA 5FOWA 5EE3A 5E7MA 3WYGA 3AGQA 1MO5A 2VH5R 5UKDA 4TQAA 1Z6GA 3BFKA 1E9RA 5HTKA 4JLAA 3TW8B 3ZS8A 5FOXA 2HXSA 1GG2A 3K70C 3ZZ0A 4RZ2A 1CF4A 4QHSA 1Z3IX 5BN5A 2QEQA 4URZR 4BZPA 1J8YF 2YVUA 2IWRA 2GXQA 2IXFA 4B32A 5JJKA 2QZ4A 3AVTA 1TX4B 3TR0A 4HATA 2C9CA 2P6UA 3CF6R 3FHCB 1EXMA 1F48A 2QMUA 3U6BA 3PUXA 1NN5A 4JKYA 821PA 3REFA 2QMHA 4Q02A 2FPLA 2Q9BA 4M1YA 5F9FA 1O3YA 2O8BB 2H5EA 2CCJA 2OZEA 4O25A 5J5CA 1S0UA 4ASUD 3AEZA 4XOIA 2REXB 1KK1A 3CZQA 4Q7JB 3K8YA 5BN4A 2FFBA 4WZ6A 3KUCA 3SFZA 3LH5A 4PO9A 4DWJA 2OCAA 3O8RA 1W7AA 1W4RA 1X8JA 3M6AA 1G6OA 4X8OA 4JZKA 3P32A 2QMEA 4V0MA 4TYYA 1E79A 2FG5A 3EXAA 4JYCA 4ABYA 4DLZA 4WXRA 2ZYVX 1T5IA 1SZPA 1CRQA 1DAGA 3U7HB 1AKYA 5BW8A 1EFHA 2QM8A 4LSGA 4BEBA 4N0DA 1UEJA 1N2CE 4GRAA 4B44A 4HLDA 4PZYA 1DPFA 3BH7A 1SVWA 2BCGY 2ATXA 2FZ4A 3S1AA 3THOA 4JJZA 2J7KA 4BUJA 2WWIA 4W5WA 1CIPA 1K5GA 4IKEA 3GJ8A 3RVBA 3UG7A 2QT0A 2R44A 1R8SA 2R6DA 2C8VA 1E2HA 2MMGA 1ZC4A 4TYQA 1NMXA 2H17A 3AF1A 3TSZA 4AURA 2N42A 1R5BA 1SXJD 1PV4A 3IHLA 1CLUA 3T1TA 1OLOA 1JI0A 3D31A 3IKJA 5A4JA 2C78A 4MDFA 1E9CA 1GKIA 2BCJQ 3EA5A 1H8HA 1T5LA 3SJAA 1NMYA 4RD2A 1FW6A 1JECA 5BYJA 2AFHE 2QPTA 2ZSFA 3QIAA 1XEFA 4NYMQ 4PPGA 1KNXA 2IYSA 2LKDA 4Q1AA 1BIFA 3CB4A 4CEIA 1GWNA 3B78A 2QAGA 1NVVR 2GZHA 2Q21A 4DLUA 5GJVC 5JECA 1KI6A 3W5JA 2RGDA 5TARA 2WWHA 3HR8A 5JWRA 1XU4A 4LV6A 4M1SA 5HZKA 2PZGA 1IONA 1GILA 1X86B 3EIHA 4GZLA 1QVAA 1L7VC 1NSFA 3H4MA 2C9YA 3I73A 3DHWC 2EW1A 4JLVA 4Y0AA 2J9RA 2GF0A 3BH0A 1U9IC 4WZBE 1AS3A 4LV8B 1SVMA 1YR8A 3NIBA 1I4DD 4L9SA 4OQXA 2YWGA 1N25A 1QVRA 3CRQA 3K0FB 1W0JD 1FMLA 1ZUIA 3R20A 3QQ5A 4JSTA 1T3SA 2J7PD 1OKKD 2XNDD 3CPJB 4LJ7A 2GXUA 1S3SA 3HPQA 1OPXA 5J4HA 3AF2A 4UNQA 5DO9A 4KODA 2WPDA 2FZLA 2J3EA 2ONJA 5HPYB 3IO5A 1N5IA 4CEHB 3T5DA 3VU9A 3R8CA 2ZREA 5DNYB 2BBSA 4HB3A 1KMQA 1MO6A 2HEIA 4JLMA 1A5TA 3SC3A 2MMCA 1VIYA 3BD9A 3PIRA 1OW3B 1W2HA 1EFTA 1R0ZA 4PSAA 4YDSA 3MSXA 1BO6A 2WWFA 3AKEA 4YMUA 1JJ7A 2P65A 2CHVA 4V0ME 1TF7A 1Z2AA 2PZFA 2NO1A 3MMPA 4GPTA 3VR6A 3TMKA 1MABA 3VKWA 1HQCA 4FN5A 2Z83A 1E4YA 4PZZA 2B8WA 1NSTA 3VHLB 2FV8A 2ZPTX 4D82A 4O2RA 3GMTA 1HE1C 2G77B 3CWZA 2YKGA 3O47A 2V55B 2PLFA 4NYIQ 1U98A 2OCPA 2AKAB 3T06B 1AK2A 1E2EA 4NH0A 1V43A 1XCMA 2EFGA 2EVWX 1SKYE 4PPFA 2L0XA 5C4GB 3ZVNA 1CRPA 1NL3A 4NKRA 3R8FA 3NDBB 1U0JA 4QXAA 4KCGA 1XMVA 2CXXA 3AQ4A 4Q1FA 5DN6A 1OF1A 2XJ9A 1ZU5A 2NO9A 4NYJR 2FFAA 2ZYTX 2X2FA 1II9A 4LHXA 1EESA 2QT1A 4B3CA 3EASA 4FMCF 3UANA 4PC1A 1K5DA 4RKEA 1E2PA 4U00A 5B30A 3N2IA 4R7ZA 3B5JA 3CR8A 3W90A 1ZBDA 3IHWA 4G3XA 2IX3A 3BXZA 3U3JA 3KFXA 3IQWA 3OE7D 3KJGA 4RCZA 3SQXA 2OESA 2O8BA 4PSVA 1UKEA 1KI9A 1OFHA 1SHKA 1XTJA 2IUTA 2ZRDA 1T6NA 4N3NA 4B6EA 2EFHB 2RGNC 2EU8A 2V7QA 4LHVA 4MYCA 1MH1A 3MRSA 4Q9JA 2WICA 2G0NA 3QE0A 1G1MA 1CULC 1RYFA 1D2MA 1WQ1R 2IYVA 1GNRA 3KKQA 3KDSE 4FXPA 4BLPA 1O87A 2CBZA 5E7IA 1T91A 2PZEA 4NCKA 3KJHA 4AG6A 4Q9HA 2BBTA 1NJGA 4JBWA 2QSYA 2JASA 4Q1CA 2OM2A 3ZYCA 2JDIA 2REOA 2JLRA 4ZCMA 3C8UA 3PUYA 1OSNA 4TYPA 4Q1BA 3OFNA 2QBYB 3B1YA 1E2MA 1S96A 3CPEA 3PCRB 2XZLA 3PFIA 2VHQA 5KSPA 2RMKA 4A15A 3L0SA 1G5TA 4Z8YA 2ZE5A 1G6HA 1JAIA 1Z22A 1KO8A 4NBSA 3SHWA 5J4KA 3DVLA 3B6EA 2BMEA 3ONWA 4DDWA 3GLGA 3SEAA 3EZ6A 3QF4B 1NRJB 1WF3A 1Z0IA 1ZNXA 3OEHD 4YXWA 1EX7A 2PBRA 3GJ5A 2W2VA 2IF2A 1ZP6A 2OLJA 5KNCA 2R65A 1PLKA 3LAWA 4P4TA 3B60A 2GK6A 3CRW1 4LZZA 4EFLA 4M53A 3D7MA 4OQFA 3LVQE 4HYYA 4LYFA 1C9KA 3GPLA 2GILA 2Z4SA 1JEDA 1JJVA 3A1WA 1CR0A 3C5HA 4FWIB 4PPQA 3VHXA 2DWPA 3EW9A 2RB4A 2V6JA 4LJAA 2HLDA 1XTRA 5EE5B 2ZUCA 3QF7A 4D80A 5KYKA 4B47A 1OB2A 2I1QA 1MRNA 4DCTA 5FOUA 1SXJB 2ZE7A 2HT6A 2D7DA 1F60A 521PA 3K1JA 3VR5A 3TQFA 3W6NA 2H92A 2IXGA 1J2JA 3AB3A 4O3MA 2ORIA 5CYPA 1EK0A 2W2TA 1N5KA 2GJAA 5SZKB 2JLYA 3TQCA 4ZKDA 3NEJA 4KBFA 5IK2A 4DCNA 3U60B 2YOFA 5E7JA 1IN7A 1H8HD 3T1QA 3MWLA 3PR1A 4QNRA 5H70A 2NO6A 2F3TA 3BB1A 4PTLA 1RE0A 3B1WA 3TBKA 3K0FA 1NN3A 1VHLA 2IS2A 2N46A 5IT5A 4JBXA 2GJ8A 4RFVA 1DEKA 1U2RA 4Q21A 1DTSA 3RC8A 3LO5A 3LBIA 3LV8A 1G18A 1Z6XA 4WZAE 4CEHA 4DDUA 4US2R 2F7SA 2HV8A 1M7BA 2WSSD 4BECA 4QG7A 2JGNA 1II0A 3EZ7A 1UJ2A 2GHIA 2YINC 5G3ZA 1KSGA 3RSOA 5CB6A 5DH9A 1NG1A 4IXMA 2J1LA 1LTQA 1YZNA 3TRFA 3VX3A 2UZ3A 3IQXA 4DXAA 3FOZA 1G7SA 3LLUA 4Q66C 1Z2CA 3UKDA 2QE7A 1G7CA 2GCPA 3LD9A 2IS6A 3QKTA 1JR3D 4GOKA 3L8ZA 1OFIA 4I1UA 2DWOA 3KJEA 2IW3A 4TLDA 3RANA 2J0UB 5C4MA 4HAXA 1FPMA 3A4MA 1NN1A 1Q1BA 2XTMA 3DEFA 3HWSA 1Y3AA 3NC1C 4FMDB 5BWMA 5JCZA 2A5YB 4F38A 5GADl 2GBLC 4PQYA 2RAPA 4C0QC 3L0PA 3EIQA 4I4LA 1Q0UA 3PEVA 1WE2A 2JJ2A 1UKYA 4M22A 1ZD9A 2FDCA 1YZKA 4CVNA 4L15A 4Q7MB 2BWJA 1GOTA 2QSZA 3GFPA 2H18A 3R7WB 3VKGA 3OAAD 2WV9A 1OV4A 3H0KA 3F3YA 4P0TA 4PZLA 1KKMA 2ODBA 2CHQA 1YQTA 4P3YA 2G3YA 2OV2A 5TVKA 4D81A 4AYWA 4OYHA 3NVAA 5JSZB 1OXUA 1UFQA 4QJ4A 2D06A 4DLTA 4GMXA 5G3YA 1Z63A 3ND9A 2ZU0C 2XZPA 1E1QA 1MKYA 4WBSA 3H1TA 4XD7D 4DVGA 1JAHA 1ESNA 2ZRIA 1CJKC 2WJYA 1WA5A 4BLTA 3EX7C 1TEXA 2J0VA 4AD8A 4C0KA 2IHYA 1KSFX 1QHNA 5DISB 1ZYUA 1E0KA 1VYVA 5JWOA 4MQBA 3PITA 2KE5A 1Q3HA 4Q9KA 3SJZA 3KUDA 2RKOA 4FMDF 1NI3A 4Q1DA 3Q85A 1XDBA 5D3QA 4H9GA 2QBYA 1PLJA 3B8HA 2NG1A 3BORA 1RKBA 1KJZA 3HJNA 1PZNA 4ZO4A 1HT2E 1CJMA 2HT1A 5EUQB 1NKSA 4EPYA 1Q21A 2IEYA 4NCHA 5C18A 3QF4A 3BB3A 2IYQA 3I61A 3RWMB 4W5HA 1U8ZA 5FBQB 1OB5A 3OIUA 5HCNA 1ZM2A 2V7QD 2ZJ2A 5FL7A 2QRZA 2OG2A 1KDTA 2XGJA 3N2EA 2QAJA 1Y63A 2WIBA 4UNSA 3FKSD 3TGPA 3AF3A 1ZM4A 1Z6YA 4UNPA 2XSZD 1DAIA 4KSCA 1AN0A 3MAAC 2R6CA 4IRUB 4URVR 3JZMA 2JJ1D 4QBIA 2FPKA 1QF9A 3H84A 1R0XA 1XEWX 3AVVA 3SNHA 2BKUA 2X8AA 2IYLD 3W6OA 1SXJA 2VPPA 2K5UA 1HURA 3UMRA 1N6LA 1TQ4A 4KJZA 1TNDA 5KPDA 2IS1A 4AG5A 3U2QA 3CRRA 4DCVA 4K81B 4YXWD 1H8EA 4L4UA 1NBMA 4M1TA 1P2SA 3W5IA 5J4YA 2OBLA 1YR9A 4B43A 1US8B 3MWJA 2G0TA 2VRWA 2BV3A 1G5RA 4QL3A 2CCKA 2FU5C 4IFBA 4PC3A 2GEDA 2IS4A 2QY9A 3DOFA 4DB2A 4XVUA 2ZANA 3OZXA 1VIAA 1Z6TA 1A82A 4HDCA 4F92B 1P9NA 2O8CB 1KO1A 3AVQA 3VR1A 4Q1EA 3UXMA 4ZDJA 2BMDA 3WHLA 4JL6A 5FBRB 1SVLA 1XXHB 2O0KA 2WSMA 2WWYA 3V4FA 1X1RA 4B75A 4L8GA 3NEYA 4A0FA 4FWTA 5EP3A 3BC1A 2ODNA 3AVXA 1E32A 2R6FA 4KFTA 2JLQA 3SZRA 2RGEA 3FB4A 3HU1A 3IPYA 5FOSA 1TUIA 4C4PA 5IK2D 3IBGA 1Z5ZA 1VHTA 1W0JA 2O52A 2YYZA 1G3MA 5J4VA 2OBMA 1QG4A 2F1RA 4MUBA 2GEUA 4ZDKA 1TADA 5KO2A 2J7PA 1OKKA 2XNDA 2FF7A 4PANA 4DIDA 3EZFA 4TSFA 3PUVA 2D3WA 2E87A 4IVRA 1OH6A 4H1UA 2W0SA 3A6PC 5AJVB 3IBYA 3LWNA 2OE2A 4AYXA 3LA6A 2J0UA 4Q00A 1IXSB 4B73A 2ZUBA 1E2JA 1XTIA 4Q7KA 1UBGA 4TLEA 4W7SA 1ZCBA 5CIWA 3ZDQA 4DZZA 4NPHA 1KAGA 4IDHA 3LLMA 1X8LA 2QN6A 3ZD7A 1M7HA 4DDVA 4KHZA 5A5GA 4QM6A 3JZAA 1ZIPA 3QKUA 5FL3A 5CK5A 3BERA 3CLVA 3GEIA 1VG8A 3VR2A 4URYR 1IHUA 2ZAMA 1VG1A 3CRVA 2GDJA 4RD6A 3R7WA 5EP4A 2B8TA 4ZPXA 3LDAA 4EPXA 5JEEA 3THXB 2UZIR 4MGYR 1AQYA 1E9SA 4I99A 4FINA 2GETA 4A6PA 1XMJA 1OFTA 2D2EA 3CPHA 4M2LA 3TAHA 4DLYA 2O8FB 1CS4C 3UMSA 1P72A 3IDQA 3MD0A 2H1LA 2ZRJA 3RRMA 4HUTA 1YZGA 1P62B 1G8GA 1SXJE 2ZYWX 2OLKA 1AS2A 4TZ6A 2VP5A 4URWR 5L8VA 2BHRA 3WHKA 4QGAA 1AS0A 1EX6A 4US1R 3P1JA 4JKIA 1R10A 2JJ2D 3CNNA 2NPIA 1YR7A 4LGMA 3TAUA 2FFHA 5EZ6B 3K0CA 3CW2A 3EWSA 3QG5A 1W46A 2G1KA 4DSTA 2IT1A 1UDXA 1TMKA 3OE7A 1F3OA 1CTQA 2CVHA 3CX7A 3U7GA 1GRQA 1Z29A 3RABA 4BQSA 3Q9LA 4U5XA 4DBLC 5FOTA 2WJJA 2C04A 3WRXC 3ZGXA 3IIKA 3AVPA 1ZU4A 2EFEB 3B13B 3QBVA 3SI7A 3UK6A 2Y8EA 1E1QD 3EWAA 3JVVA 5JWHA 1RZ3A 1PJRA 4OHYA 3C14C 5FTNA 4M21A 4LJ9A 2VF7A 4A2PA 3I1FA 2HXYA 4D0NA 2O0HA 1NNEA 3MGCA 1P5ZB 4GL2A 2EWVA 1CKEA 5FI0B 2F6RA 3NDPA 3SHFA 1TF5A 5DGXA 4TT3D 4DLVA 2OXCA 1LVGA 1CR1A 4JLKA 3RC3A 1A2BA 1UKVY 2RGAA 1SKQA 4IDOA 2XXAB 5SZHB 3C7KA 3E1SA 2AXNA 2ZITA 2XAUA 1A4RA 1BYUA 3OEHA 4PC6A 5BN3A 1ESMA 1GRRA 5K8LA 1XX6A 2ONKA 4IJMA 3THWA 3T1OA 2B7CA 2V4ZA 1WB9A 4ILEA 4BFZA 4HAVA 4QKQA 4D0GA 5TB5A 1BOFA 2AL7A 4MYHA 1W0KD 4B3DA 1E2NA 2F3RA 1VCNA 2IYXA 3FDIA 4GOXA 4FCVA 2CK3D 2FSFA 2NTYC 5FL7D 2VSOA 5F3WB 1N6PA 1CP2A 2NQ2C 2W58A 5EP2A 1G64A 1D2NA 3MJRA 1G4AE 3QEOA 1US8A 4OI2A 3ZS9A 5F98A 2KWIA 1E99A 3K70D 4M4SA 1S1CA 3UMFA 5FTLA 5DE3A 2PJRA 2Z4RA 1QHHB 4HUQB 4A6XA 2BJWA 1N6RA 4OQNA 3FMOB 4Q4JB 1DS6A 1EFRD 1UDWA 2REBA 2A30A 2OFOA 3GLGB 2WAXA 4TTQA 5J40A 2A7QA 4LDJA 2O8CA 1L4YA 4E5UA 1GSIA 3NBZC 2AWNA 2FA9A 1W4BA 4KLNA 2DR3A 2HF9A 1DARA 2Q9CA 2KSQA 1XXHA 1CJVC 4JL8A 2QQ0A 4M1WA 1Z0KA 2GZAA 2QROA 5TDHA 2GNOA 1H65A 1H8ED 2XITA 3VX4A 1NBMD 3V4RA 3CBQA 3ND8A 4C0HA 4QBHA 1W48A 4F7WA 1NKTA 4AKIA 1S3GA 3Q8XB 4GOJA 4CT5A 5KU1A 2CEAA 4JVNA 3TUIC 1P6XA 2GXSA 3SJBA 4EJSC 2GWHA 2VF8A 4PHFA 4BFUA 4AKHA 1YU9A 2QL6A 4HZUA 3OIVA 1IY1A 4YC7A 3RS7A 3WBKA 1M74A 3RS5A 4L16A 2OFXA 2QGNA 2O8DB 1OE0A 2J41A 4IDPA 4F4CA 4OQLA 3CNOA 3E2IA 2AD5A 3MG9A 1XTSA 3W6PA 5M04A 2WSSA 5DI3B 2EQBA 3K9GA 5SZIA 4FIDA 5E4FA 4QOSA 2CNWD 4X8LA 1KI3A 1JPNA 2ZRPA 3CR7A 3K09C 4IFEA 4URUR 4JYBA 3ZZTA 3ASZA 3VKHA 1UBEA 3V00A 5B64A 3NTUA 4NDZA 4NYIR 1G9XA 1XJQA 1JR3A 1G3QA 1Q57A 2A2ZA 3C41J 3A1SA 4B34A 3GFOA 2LCFA 3JVUA 4HB4A 4AY2A 2VLIA 2ZRAA 2CDNA 2VHCA 1X1SA 3THXA 5FUWA 4TSFD 2FEMA 3QXXA 5CITA 1GKYA 2O8FA 5JBQA 2PH1A 4MITA 1XNJA 4QGHA 4WA7A 3FKQA 2BDTA 3Q7QA 4MRSA 2YOHA 4M9ZA 4IHQA 4QC2A 4WIAA 3A1UA 4MGIR 1X8KA 1G7TA 4KVAA 4BZXA 1FUKA 4RVCA 4DHEA 4M8NE 3DOEA 2I4IA 3OAAA 3OIWA 4XWKA 3I72A 4IOJA 3CM0A 4DUGD 3VMFA 1FNMA 3RRNA 1EWQA 1PLLA 3DDCA 3LBNA 4LCBA 4A8JB 3BH6A 3LQRA 4YLGA 1P2UA 1ZCAA 2PCJA 1GFIA 2VIIA 1MR3F 4BZQA 3KQNA 4LHWA 3VR3A 3W8NA 1TU4A 3DZ8A 2ODWA 2ZSAA 3ASYA 2ZRHA 4UXIA 4OK6A 2XEXA 3AP1A 4TMZA 4XD7A 4YMWA 5AJZA 5LBIA 4GDFA 4A36A 4PAMA 4R2HA 4IEIA 1E9BA 2QENA 4IOKA 4KV9A 4RD3A 4YQFA 4EUNA 4GZMA 4RD0A 3AVUA 2IK8A 4DB4A 2WJVA 4JLPA 2OXRA 1E2IA 4MRVA 4KSBA 3WXMA 1IXRC 4NTZA 1XXHE 2CLDX 1G20E 3B82A 2I3BA 4LJ6A 3GJ4A 1NVWQ 1OIWA 2FGJA 4JLOA 2ZJOA 1E0SA 2ORVA 1D9XA 2NO7A 4PO8A 1ZW6A 3QXHA 1JNYA 1KI7A 1QZXA 1W1WA 5C1BA 1RIFA 2P0EA 3HYRA 3MFYA 4IXNA 1B0UA 4TLBA 1KY3A 3LXXA 4G1UC 2HF8A 2ZR9A 2IYYA 3HPRA 3F5FA 5B58C 3KQLA 5FFMA 3I32A 2PMKA 1N0VC 4OKSA 3TSOA 1LB1B 3A8TA 4B3GA 2ZXUA 1IN5A 4KAXA 2XXAA 3CF0A 1SVIA 2VBCA 4S2EA 4WVFA 1G7RA 1KDOA 2G1JA 2WOOA 3ADBA 2KI5A 4JJKA 3Q7PA 4A2WA 3KTAB 1W36C 2HCJB 1SVOA 1HH4A 3O8BA 2ZRMA 3FKSA 3BJIC 3SU8A 2BOVA 4W5JA 3KXIA 4II7A 4BGDA 2V1XA 2XSZA 5L3SB 1U0HC 1UKZA 1ZD8A 4R2IA 4MRPA 4C9BA 2BVNA 2D74A 1XJ0A 5CM9C 4LJ8A 2UKDA 4RZXA 2JJ1A 4B76A 5JHHB 2IUUA 5DLQC 1IN4A 2J59A 4PPNA 3EA0A 3O8CA 1OXVA 2NMVA 1MV5A 3IIJA 1R0WA 1QHHA 4HUQA 1ANKA 5LB2A 4BFYA 4Q4JA 2XZOA 5FOVA 2JLVA 1JEEA 1ZUHA 4IEEA 4B3XA 4LBWA 1P73A 1UEIA 2P6NA 1NG9A 3ADCA 1OXSC 5G41A 1ZMXA 2BMJA 4JS0A 1E2KA 2QG6A 1SULA 2QTHA 2VSXA 1SQ5A 3QKSB 5CM8B 1M7GA 4CEJB 4LWZA 3C15C 2IEZA 5IRCD 3P4YA 3K70B 5JS8A 4NYJQ 1D8TA 1HA3A 1F6BA 2ZVQX 4G5SA 3WBJA 5GJBA 4MKHA 2W2XA 1D9ZA 1SHZA 4E03A 1TUEA 2FOLA 3QJYA 2V54A 5C46F 2RCNA 3GJ3A 3NG1A 2GXAA 1U8YA 5D3MB 4RJLA 1S9HA 1ONBA 2WJHA 2ZRKA 3GJ0A 4GNKA 1UM8A 1Z0AA 2C77A 1KI2A 1XF9A 2QPAA 2JATA 1Z0DA 1CXZA 3BS4A 1IJFA 4MDEA 3WMFA 5DSZA 4QHTA 3EG5A 2OFWA 4JLDA 4B48A 4BFTA 2O8DA 2V8OA 3DPUA 1OFUX 2QAGC 2DY1A 1N0UA 3NBXX 1J90A 1J8MF 4BRWA 5JHGB 4HEJA 3OF5A 5DI3A 1F2UB 2NIPA 3D8BA 3CH5A 4PC7A 2NZJA 3X1YA 3I62A 1Z6AA 4PHGA 4MKIA 1D6JA 4XJXA 2O0JA 3FTQA 5J4LA 2GKSA 4C2TA 4IVPA 4TL6A 5LDDC 4HSEA 2F1JA 4LOAA 3HYTA 1S1MA 1SVSA 4CGZA 3E70C 1R8QA 3PQCA 2B6HA 1ZC3A 3BAFA 3U4QB 2ZUDA 2TMKA 5H8WA 3GEHA 2NZ8A 1WDTA 1FOEB 1G8PA 3FFAA 3T15A 4B3FX 5FPTA 2RHDA 3L43A 2ODEA 2ZTSA 4MYTA 4RCYA 5ELXA 2A5JA 3KZ1E 4HLCA 2CVFA 5TXGA 1A1VA 3WP0A 1ZUNB 4NONA 3SFVA 1G21E 2Q9AA 3K0EA 4PHTA 4DKXA 1I2MA 3FMIA 4YDHB 5AJYA 5GJWC 1YZQA 1CEEA 2GVZC 3HU2A 1AQUA 4PSKA 2GJKA 1MOZA 1KK3A 5EXXA 1EGAA 3RLFA 5HCIA 3OESA 1GM5A 2FSIA 2QI9C 3BFVA 2XB4A 3NKVA 4RD4A 4LY6A 1GL9B 1E1RD 1U94A 2ZRGA 1Q12A 1XD9A 3WYAA 4UQOA 3KB1A 1UBCA 3DM9B 1G3UA 3SR0A 4A8JA 3F8TA 4UJ3A 3AM1A 5GVSA 4JVLA 4TYNA 5AK0A 5HE9A 5DI9A 5AUOB 1KDRA 2PL3A 4V0OA 6Q21A 5KHOC 2BJVA 1EG7A 4US0R 4PAQA 3GLGE 5L3RA 1AKEA 2ZETA 3X1WA 3HU3A 5CYOA 2CL7X 1OYWA 1KZGB 2WWWA 5CLQA 5F2EA 3GJ6A 4L9WA 4RKFA 2GA8A 1GVNB 3AH8A 3VNVA 2NO0A 3UPUA 4JVMA 4DRZA 1ZD1A 4BFVA 2G9NA 1BYIA 1FNNA 2QTVB 4G5QA 2FSHA 2ZQ5A 5JFGA 3O8DA 4AK9A 4OHZA 1YZTA 3ZIAD 3NXSA 1NIJA 1ZM9A 2ZI6A 4ACAA 1XMSA 2FX3A 5BYKA 3BRWD 3ADDA 4F4IA 4Q4LA 3J81k 1N6HA 4QHYA 3KQKA 3BB4A 3QKRB 1FL9A 2Z6VA 4XH9B 1IOZA 4ZCLA 3TVTA 1Q1EA 1CBUA 2GJSA 4Q4AB 3WMGA 3BBPA 3Q72A 1NY6A 2YNMA 4PAOA 2ZM5A 3KTAA 3FHTA 4ZIRB 4JLBA 3KJIA 2AX4A 2PJZA 3OIYA 2WOJA 4TT3A 2G83A 3QXSA 5L3SA 5KDDA 5JI2E 4JT4A 2EYQA 1PUJA 4GMDA 4HLUA 1YZUA 1FX0A 3OEED 2XX3A 3P26A 3NBYC 4C2UA 5F9HA 1DG3A 2VTKA 3W8RA 4TL7A 3CIOA 4XIGS 3TH5A 4TWZA 3SQWA 1XPUA 4HAWA 3QNUA 1ODFA 2ZRFA 4TQ9A 4DLSA 1W0KA 1G8FA 8OHMA 1Q20A 1ZNWA 4PX9A 2FWRA 3I8SA 3QKSA 3W3AA 2CK3A 5EE1A 2ZI7A 4PO1A 1DAKA 2DFLA 1OHHD 5JCPA 2ZJ5A 1XFAA 2E9SA 1F5NA 3LXRA 3QPWA 3U3KA 4CEJA 3A1TA 1B23P 4HLQB 4I1SA 5KNDA 1JR6A 2GEVA 2JEOA 1E0AA 2B7BA 1Q22A 1LV7A 2CJWB 4R71A 2A5FA 3A4LA 1EFRA 1U8AA 2CMKA 3Q3JB 1ZNYA 3D3QA 4JBYA 3EPLA 5D3MA 2ORWA 4M1OA 4FCTA 4ZCIA 1KDPA 2A9KA 3FPAA 3QOFA 4V0LA 2FFQA 1JQJC 4KFSA 3THWB 1AA9A 3PUWA 4AIIA 2DBYA 5FTJA 1G4UR 1VYTA 5FPSA 4EPRA 221PA 2VP0A 1D5CA 2IUSA 1KIMA 3FFBA 2JIZD 4KFUA 4Q48A 4TMTA 5H68A 4AC9A 1LNZA 2ZS9A 4BE7B 3U5ZB 5GJCA 2WKQA 2R2AA 3KKMA 4IW3B 2VP2A 2WZQA 1F2UA 4LI0A 1OXXK 2DHRA 4BLSA 4DDTA 1IXZA 4YMTA 2C2HA 5JJLA 5EQTA 2DFNA 2G88A 3BE4A 3TSWA 2J0SA 4HAZA 4QNMA 3U4QA 3LVRE 4LC1A 4EIWA 3BIFA 2JLXA 4V02A 1F2TA 4G01B 1NVXQ 1YE8A 3A37A 1KY2A 3ZJYA 2QUZA 3SE0A 2ERYA 1E9FA 1NLFA 4NP6A 2ANCA 1VYUA 5HKKD 2CNWA 3PUZA 1YHNA 2EWWA 3EPJA 1HTWA 2IWHA 2OBNA 2QM7A 1TL7C 3AVWA 1RVDA 3RYTC 4PHHA 2ZR7A 4UKDA 1SKYB 1QHIA 1G3IA 2XOKD 5DYIA 1T0JB 3ZZUA 2P3SA 1P2VA 4C3ZA 4EFMA 5L3VA 3CWQA 3EZ2A 1RC8A 3QI2A 2JLWA 1VCOA 1U81A 1DO0A 2FEOA 4HZUB 5LD2B 2OHFA 1KK0A 4LJ5A 4DLXA 1P9RA 3X1ZA 3UATA 3CZPA 1AZSC 4B2LA 3RDPA 4MRNA 4NU0A 3Q5DA 4I81A 4D2IA 1ZINA 3KKOA 2GF9A 3LW8A 5AJXA 5AJWA 1Z0JA 4TL8A 3SDZA 2ZEJA 1IQPA 4QGFA 2C98A 4Q19A 3THYB 4C7OB 1VG0B 1FP7A 1U90A 3QY0A 1G16A 4MH0R 3KFVA 4DUGA 1Z0FA 2HJVA 2RGXA 4Q03A 1BMFD 3U61B 3EAQA 4MKFA 4Q7LA 4AKGA 1KSJA 2C95A 1GIAA 3EZ9A 3NHBA 1S8FA 3RWOA 3VTKA 3EIEA 3IUYA 2JLSA 1Q3TA 1XMIA 4A0HA 1KOFA 1P75A 1KAOA 2XTZA 5JLJA 4OI0A 1U9IA 4Q47A 2MSCB 3WNBA 3VR4A 4BASA 2CE7A 3IEUA 2EYUA 2VHUA 3AP2A 3GLFB 3RS0A 1VTKA 1OT3A 2QNRA 4D6PA 3R9IA 1GNQA 1GNPA 2ATVA 4RFSB 1KSHA 1P60A 2IA5A 3ETLA 1S4QA 5EP1A 4D4LA 3EPHA 3QKRA 2VP9A 1EWRA 1ELOA 4KYIB 4XTRA 2VEDA 2J87A 3TKLA 3U7FB 3CX6A 2Q3HA 4R9UC 1W2GA 4Q4AA 1JXOA 3PG5A 1DADA 2X1VA 1T3LA 4R98A 1NBME 2W6ID 2P2LA 2AR7A 4ZIRA 2W6JD 2IYWA 1XTKA 5GVRA 4UJ5A 3U6KA 1KO4A 3TJZA 1TF2A 4HI0E 2VO1A 4EKDA 2DB3A 2WJGA 1DG1G 1M1YE 3LY5A 3TK1A 1KNQA 1XB2A 3VAAA 1N5LA 2AD1A 4AKEA 3ZVMA 4NCNA 1RRFA 2XJ4A 4LX0A 2F9LA 1P3JA 5J47A 2H16A 4Q18A 3WY9A 4DLRA 4Z8XA 4ZI3A 3QPVA 4X8MA 2V3CC 1KI8A 4BLOA 4XSGA 4LYAA 2R9VA 1Z28A 1M34E 1WBBA 1E2QA 4C0BA 2C03A 5DYGA 5KSOA 3TE6A 2A78A 1DAMA 2ZS7A 1KKLA 5JRZA 2D2FA 2V1UA 2KBEA 2FJUA 2IYUA 2V6IA 1WMSA 2IYTA 1BH2A 2RGCA 2F43B 2W83A 4NZYA 4N1AA 3VQTA 4DT1B 4A9AA 3AP3A 4JIMA 1M6NA 1U0LA 2CJWA 2B92A 2QP3A 1XEXA 2F1HA 3H86A 4OHVA 2IC5A 4Z51A 2FH5B 4FCWA 3FMPB 3EARA 4RY2A 1R5NA 1U99A 2PT5A 2W00A 4BRUA 4W9MC 3ZQ6A 1T0HB 1LF0A 1W5TA 3WRYC 4B35A 3MUFA 1RJ9B 2ZSEA 5CIQA 4NYMR 4XVRA 1FQJA 2GCOB 2XTNA 721PA 3P20A 2IF0A 1UF9A 2B21A 1SXJC 5FPYA 3CONA 3DL0A 1UAAA 1E2DA 2RGNA 5H1YA 4C0AC 2P5SA 2ZJAA 3T61A 5FUVA 1I4TD 3QXJA 3A1VA 1GUAA 1W4CA 4RZ3A 4Z1MD 3N70A 2J45A 2MSEB 5JMTA 4EDHA 3G82C 3L82B 4IDNA 2ZI4A 4LBVA 1VCMA 5KOYA 3FWYA 1E6CA 2F1IA 5KUTA 1BKDR 1GITA 3T35A 4KO8A 4IOMA 3P27A 1BS1A 4POAA 4HB0A 4LYHA 3FVQA 3IO3A 3NC0C 5FTMA 1A7JA 1QHXA 5G53C 4XSHA 2OAQ1 1X3SA 3WMEA 2VP4A 3FHOA 4NCIA 1KO7A 5DHAA 1QBKC 4UNNA 2AKYA 1COWD 1QDEA 5TY0A 5JZVA 3GJXC 4KVGA 3L2OB 2ZI9A 3B1XA 4OJKA 4CYMA 2IYZA 1NLZA 4O0MA 4B2IA 1XZPA 2YWEA 3IILA 1QRAA 2QTFA 4PXAA 1CR2A 4V0NA 5EUMA 3MWKA 5AWFC 3TVDA 2I1VB 3TIFA 2YC2C 5BQ5A 5AUPB 1GL7A 4RD1A 4A0RA 3DMDA 3SJCA 3KXLA 1T8UA 2BM0A 4ZDWA 4CIDA 4CRWB 4IOLA 4JLNA 1DE0A 2GAOA 3M0EA 1R5OA 2ZJYA 2ZAOA 5BXQC 3ICQB 3PXGA 3C5CA 4KXFB 3ICEA 5EXTA 121PA 2GJ9A 2ZU6A 3THYA 4C7OA 2WJIA 1IAQA 1UPTA 1E1RA 4M0LA 3B85A 4XVQA 2WHXA 3GQBA 4TTPA 2QU8A 1JB1A 5FUXA 1LS6A 3BWDD 3I5XA 1P9WA
chains in the Genus database with same CATH superfamily
4BQOA 2CCGA 4A6DA 3IBTA 4G24A 3M1YA 3WK9A 5THXA 1SBHA 2NZXA 3NYWA 4E15A 2Y4OA 3KFLA 5B2ZA 1J0AA 3U16A 3TXYA 4MGEA 2CE2X 4GKBA 3K3PA 2VYFA 1LF5A 4LHYA 2VDVE 2WUVA 2ZSBA 5FUYA 3VKUA 4E2XA 2A33A 5GM1A 1Z5UA 4UPEA 1W49A 2WUFA 4JNKA 4GE0A 5G40A 4BGEA 3G9TA 3QENA 2D62A 3C3XA 3EMVA 4EGAA 3EMDA 4GVLA 4L73A 4ATNA 1RPZA 4ZV7A 4G2TA 3HWRA 3C70A 1ATZA 2P9EA 2WWRA 1TQHA 1V7ZA 4MHSA 4O1HA 5L4LA 2HHJA 1KJYA 1WXDA 4TXJA 2JLUA 2EGHA 3KO8A 3BREA 5F1OA 2YY6A 3JQFA 1NT2A 3NBUA 1V35A 3QVWA 1R7RA 4TXNA 4EG5A 3V8MA 3CRMA 5EINA 3FPSA 2CLSA 4D0LB 1JALA 2W6CX 3AETA 7YASA 3AUYA 1JYEA 4HMOA 3P9ZA 2A5GA 1NW7A 2BP7A 5IC5A 1AZLA 1XALA 3T1VA 3L4BA 3S1LA 1NVVQ 1Y7TA 4PSCA 3KZNA 3H42B 3WQRA 4OAPA 2IW1A 4EPTA 1K1EA 4F93B 1PJQA 1PSWA 3FLAA 2BEKA 1OMOA 1SC9A 2EC5A 5HMLA 1PJLA 1QCYA 1XEWY 4QYIB 3R7DA 3O82A 1K5PA 3W5AA 2BEWA 4Z3DA 3HUUA 4X66B 2PZ8A 2YHBA 2P0AA 4ALJA 4ARZA 5E2IA 1GZSA 4EUFA 4NBWA 2KMLA 3Q5EA 1Q92A 1GTL1 2R8YA 5FTWA 5LWQA 1MJHA 2PR2A 4TLCA 4N7BA 3I1YA 4C0LA 4MQUA 2I4NA 3PXXA 4E12A 3EG9B 2BJHA 2GBLA 3DOJA 2VA9A 4P08A 4HEHA 3IRVA 4BWYA 3NOOA 1CE8B 1UMCA 1WBDA 2GT1A 3WFIA 3KQUA 2O7RA 4M6WA 5T5QA 2WIAA 3OEEA 1QHEA 1R2QA 1E3MA 3GJRA 4MICA 1ZRHA 1Z15A 4LC9A 3UWOA 1TU3A 1Y7PA 1BOOA 1TQ2A 3IAEA 3Q98A 4MRMA 4U63A 3INNA 4UCWA 3RRJA 5BOSB 2I4MA 5C1DA 1HYQA 3P0IA 4G26A 4PC2A 1G2PA 2HSJA 4OAQA 2QTBA 3OZ7A 5M29A 1VFNA 2YWHA 1IN8A 3ZHTA 1MA0A 1Z07A 4RXTA 5I8PA 4YMGA 3NONA 4WFIA 4UXJA 2H1HA 4R0MA 3FI9A 3ICOA 1XT6A 3R3SA 4J75A 3T3PB 4C0WA 1EGVB 2JHAA 1N7HA 3LFUA 2F55A 5AKIA 1J7KA 1C4OA 4HRAA 2O05A 3E5MA 1FDTA 1RJ9A 3P2JA 4R1SA 1HNNA 4YK7A 5IBQA 1E1DA 1OH7A 3PNLA 5CURA 5KX5B 4LFAB 1BVUA 1HQYE 2DOKA 3P94A 4CT4B 4KPYA 2HJGA 1QGUA 2ZRCA 4K46A 2QTTA 3VNRA 5AESA 1H23A 1T9GR 2OT3B 3PYLA 5BWCA 3TIXB 3LQ1A 3PQ8A 1ZJWA 5BT8A 4CCWA 2ECKA 4FMPA 1E9DA 4C7JA 1T9CA 4KQWA 2WFLA 3N2KB 2QMOA 1XTQA 4RPGA 5TJHA 5KWVA 1XLWA 2WA1A 3TOCA 4E21A 1YH3A 3NHLA 1IZYA 3C8ZA 1CZHA 4R8KA 1E3IA 1AIPA 3PSHA 3D6NB 2VYVD 1Z83A 4FSXA 1UQTA 1YZLA 4HL6A 1USKA 3OUTA 4KI0A 4WXYB 3RVLA 2HRCA 2FOXA 1AMNA 3T7SA 1RZRD 3VO8A 4N4AA 1HZZC 2ID7A 2PYZA 5FFNA 2VPWA 1QCDA 4JN6B 1I7QB 1MZVA 2BM1A 5AI8A 3UWKA 1TO2E 3EEFA 1J1UA 1KZHA 3L7IA 4WCDA 3FUTA 4HAOA 4W1SA 3GLFE 3WHPA 2WVJA 4IDFA 1R37A 4GXQA 1I51A 2P91A 5E95A 2X2EA 3GGGA 4OG2A 4BHTA 4D3FA 3QFTA 2XUDA 5AP9A 2BBWA 2MYNA 4LJLA 4R1OA 1VCIA 4NICA 5CVDA 1FYVA 1CHNA 4MA4A 4CF7A 5LPNA 3OLQA 5CEFA 1YD7A 4LRXA 1U4NA 1PR3A 3PPVA 4JHXA 4FM9A 5EIXA 3H17A 3AU9A 4JP2A 4GX1A 1HUQA 4B6RA 3GJYA 1Z5PA 3OZDA 3X0DA 4DLAA 4M9SA 1SQ0A 3GX1A 1R0RE 4FT2A 3DZDA 5JAIA 3K1ZA 2BFWA 3O7WA 3M9XA 4PYRA 2GPSA 2HU7A 2QXYA 1T2VA 2VAPA 2PXCA 4DY4A 3DHVA 1H1LA 5K0TA 4KQ6A 3ZU6A 3T5GA 4ALKA 4FYXA 1O94A 5LKAA 1TGVA 2AFRA 3BFXA 4LGYA 3EISA 2EHJA 2E0IA 3GROA 3NV7A 1XWIA 1F1JA 1HORA 3DTVA 3IIEA 3HI6A 4RPKA 4R51A 2CV2A 3D6JA 1G17A 4AZ0B 1OTHA 1XZCA 2ZIZA 1T2EA 5EE9A 3RUIA 1E9AA 1YIAA 4WGGA 5JAQA 1T3GA 3L8CA 5BO5A 4E6EA 3WLOA 5C1OA 3W9SA 3NH9A 4E22A 3GG9A 2PS3A 2WNIA 1Q1QA 4F6RA 1S8NA 2VHJA 1IL0A 1V8DA 1Y5NA 1WCIA 2WHRA 1SA0A 2B98A 2DWQA 2Z2YA 3D6AA 4ZVMA 3K6KA 2C0PA 1F2TB 1LBTA 3UOGA 1V37A 3B6KA 3M1IA 5TQJA 2WF7A 1AKMA 1PS8A 2I2DA 2VT7A 4BEJA 3BK7A 4JJ8A 4A8PA 2JEYA 1R6UA 3QTBA 4BP8A 3EGCA 3L7CA 3PXBA 5JXWA 3M3HA 2JFZA 1FMJA 3BWYA 1A8IA 2JD0A 3OCWA 4DRYA 1NYTA 2DUNA 2I6FA 2ZIGA 3NR2A 1UMDA 4RSMA 3EZNA 1UM9A 3KX2A 3PXDA 2D0DA 4X20B 3V34A 1O6FA 1U7HA 2UUCB 1Y8ZA 4FDLA 1B74A 3DEAA 1H2WA 4FMBB 1KYQA 2CNLA 4IQ4A 1M8PA 2GTPA 3GWZA 4TV9A 3QWFA 4CIYA 1MHTA 5EHZA 1G5PA 2JAQA 1NRXA 3AEKB 1NJFA 5EJEA 1K63A 1F4VA 3AB8A 5D01A 1UBRS 4YQEA 4ZICA 5T4FA 3RS9A 1NVUQ 3ILSA 4NZ9A 3KWJA 1EFUA 4KYUA 3TO5A 1LPAB 4XIJA 3FJ1A 5H80A 1KMHB 2FHSA 3D02A 4HB2A 5DIFA 1JTFA 3VFDA 5IABA 1PS9A 2HDWA 1GRNA 3BHIA 3QU7A 4NF2A 4U7PB 1YNOA 3PYXA 1FYEA 1Z8DA 1DVRA 4UE3S 2JGKA 2CEKA 3TQQA 3RHFA 3UMGA 1YQXA 3HVRA 3NBFA 4ZYVA 1GPBA 2LWIA 3D6TB 3MWDA 5IKXA 5KAMA 2CWDA 4CFYA 1GU0A 1K06A 1E3WB 1GDHA 1Z2DA 1N3BA 1R9GA 2Q5OA 3GMSA 1O77A 2BL4A 2JI7A 4GVXA 4RV5A 3U4MA 1ONOA 1X42A 1AF7A 4MVJD 5K3FA 3NAGA 1I2DA 4O2BA 1UMBA 4OXKA 3IAM1 3LDGA 2Z09A 3WNDA 2ZYRA 3ORQA 2OMEA 1QIIA 2PTHA 4QUJA 1GEGA 4FVTA 1LC0A 4KXWA 2B20A 2XB9A 5T41A 1X6VA 1EPUA 5CJPA 2B4RO 3M82A 2ZAYA 3VAZA 3N0XA 1R4MA 5IANA 1OH5A 1XNQB 1ECBA 2VSQA 4PZPA 1CVRA 3GYBA 1SXGA 3EW7A 4MR8A 1K5HA 2WPDD 4QXQA 1NHWA 4BGUA 4KB5A 4CT0A 5ES3A 4F7DA 4BGIA 2AJDA 4RMGA 3H65A 4TROA 5IDVA 2XEDA 1UJMA 4MKRA 4Y2XA 2WKPA 5FPHA 3SR3A 2W37A 3C8DA 1K0FA 1RI2A 3BM5A 1WUYA 4QRHA 3TXAA 4EYSA 1E6UA 4OHXA 5LMZA 2Y1XA 4QGGA 1GNSA 1IIRA 3TZHA 5J5AA 3TCNA 4XASA 3AB7A 3NWOA 2Q4DA 2I80A 1PG0A 2Q5FA 3BCSA 4JUAA 4J0QA 3DVAA 3FNEA 4CIWA 2GRJA 4AY6A 5ICEA 3TSAA 4LQDA 4ERNA 4WN3A 1A1SA 3LOQA 2AZ4A 4ACBA 2IYOA 1FTSA 3T5TA 3UJ3X 4YUAA 5AUNB 3CRNA 5DGCA 4ITRC 1CQIA 4NBTA 1KVQA 1JV2B 1UIMA 2GKGA 3WHIA 1S7GA 4OJMX 1IVYA 2OSVA 2EBHX 3ICWA 2AJ8A 4G25A 1DJQA 3K9NA 1VDZA 4PG5A 2G17A 2ILTA 4CN8A 1TKAA 4TQUS 4WCFC 4UW9A 1NP6A 1KTVA 5CA0B 3R9XA 4JP8A 4OI4A 4C2BA 3U09A 3IEKA 1NN0A 2BM8A 1HY3A 1KGSA 4WLFA 2ZRLA 4CL0A 3EUAA 2WIFA 4EO7A 3C16C 4DJTA 1OA1A 2ZSKA 4EHDA 3V8NA 5J2TF 1MRSA 2DR2A 4WW0A 1GAJA 4CM1A 3G02A 3P9QA 5ECWA 3QX3A 2Z8YM 1Y1QA 2I3AA 3L0OA 3CE9A 4IQ8A 4WE3A 3SHTA 1AXGA 4LYDA 4EG6A 3DZCA 3T12A 1V11B 3BXEA 1AKWA 2RKWA 1DELA 3IELA 2IE0A 3D4IA 3KYIB 3LZCA 4XTCS 5C34B 3MXOA 3VZQA 1UDRA 1TCCA 4WI1A 4M9QA 5KTKA 4AI6A 2UZ0A 4W5QA 1MN6A 3Q12A 3M8KA 1FQWA 3HWWA 4BEVA 4F91B 1IYZA 1FTYA 2VFAA 1RYDA 2WAMA 3T34A 3B9QA 1FUUA 2G71A 3KUXA 3Q3EA 3DOIA 1X1EA 3CN9A 4H1TA 1U9ZA 3SKVA 3MT8A 5BN5B 3L1VA 1WCV1 2QPLA 3S4YA 3LPLA 5B55A 1E3TA 4XPIB 1HV8A 5HM8A 5ESWA 3EK2A 2NUTB 3EXEB 1PUIA 1OWLA 3WQBA 4B09A 3LF1A 4N9QA 2QRKA 3TNDA 4EB8A 4FT4A 1Q50A 2P62A 4Q4HA 2EJTA 1ZD3A 4BFXA 2FMHA 1T8WA 2FUCA 4V39A 3I3SR 4B71A 1VCHA 2F00A 4ZOBA 3FWPA 3OKFA 3EVEA 3NHAA 3KVNA 4KX3A 2LXNA 3C8HA 5DNWA 3LPMA 3UAZA 1KYXA 5EKTA 1BXGA 2PX0A 4MCAA 4ZV4A 5L3ZA 3HCRA 2X8JB 1H93A 2BGIA 2R7NA 2JDID 3MUNA 4P31A 4MWEA 3HM9A 1COWA 5CLLA 3HYSA 3L6UA 3QLJA 4YPVA 4GSYA 1K8RA 2DSNA 1JPJA 2Z43A 3AEUB 1VB5A 4LHSA 1RCFA 4PBTA 4URUR 5AICA 1XEAA 1PJ2A 4KR9A 3DMNA 1AGRA 4E5MA 2R6GA 1NJ5A 5BN4B 3P7MA 4F96A 2XQGA 4DR4B 3K9HA 3M6UA 3EC2A 5KEIA 3AVOA 1U04A 3B52X 3WSWA 4FB4A 2PRYA 4BVEA 4OK3A 2RJOA 4K03A 4ZGGA 1G8YA 4RA9A 5F9MA 1O97C 4RVDA 4AYTA 2C82A 3EXIA 3PQ6A 1HT1E 1WVIA 3MTGA 4D41A 3FMFA 5JVDF 4BWFB 3HDTA 4ZTBA 4Z86A 3W0LB 1LFDB 1P61B 3TR5A 3T5BA 1NOJA 2Z8ZA 2R4UA 3Q0TA 4IF6A 2G9ZA 3WYFA 3ZVKA 3MJHA 3OZEA 1E58A 2BEJA 3X1XA 4QQRA 3M83A 4NJOA 3S1AB 1OUMA 2FWMX 3H8VA 3Q3HA 4JA2A 2NO4A 4FKMA 2OHIA 5JC1A 5TPZA 1XPOA 4MUNA 3V3TA 3BZUA 2NU7B 2HLDD 1CUEA 1TPZA 3JQGB 4YJ3B 2QP9X 2Z9BA 4CLEA 1JG4A 3AF5A 3OT4A 5EIEA 3R6DA 1I24A 2ZR8A 3K92A 2C96A 2JGDA 3WGOA 4AFNA 5HE8A 5EESA 3OVMA 1WUJS 3PUIA 4N8DA 4PQRA 4NMWA 5ERXA 3VISA 4DEYA 5K8TA 1G20B 1XTUA 1N5DA 3A04A 5EC8A 3VSDA 2BY4A 4D9IA 1V5WA 1VIMA 1P29A 1U7PA 2WPNA 3TOSA 3JQPA 3VC7A 1DQRA 5IDWA 1N2HA 1A96A 3KPVA 1BCSA 2ZIAA 3K9WA 1Y3IA 3N6VA 4KQGA 4PYOA 4BC1A 1Z73A 3QVTA 4A03A 3ZQJA 1GARA 2NV2B 4HWOA 3RS2A 1BW9B 3F73A 2XVMA 5JSYA 2VCYA 1D2HA 3KAKA 3V7FA 5KPJA 2QAGB 3STHA 3PJRA 1T1JA 3A2MA 2C7PA 1QKJA 4HEQA 5DCUA 5C31A 2WTAA 2H4JA 4HYQA 1KI6B 4IF4A 4OF4A 4L3WA 1FQKA 4UHJA 3VKFA 5CFMA 4ALNA 3TUZC 3ZVLA 2GAAA 5HX7A 1U2GC 1Z8FA 5AKZA 5HDBB 3II6X 4WAUA 5K7SA 2YWFA 1Z25A 2UYHA 2Z6UA 3FYHA 4A7PA 4WOPA 1HM5A 4J7AA 1P7VA 1ULUA 1EWVA 2HMVA 4IIGA 3BULA 1Q19A 5CDFE 1KY4A 1SU7A 1ZH2A 3MK31 4YDRA 3PEWA 3T0GA 3ZWAA 2Y1WA 1QTQA 1Z4KA 2WF8A 5ECYA 4JLWA 3CKLA 4JB2A 2DWUA 1YA8A 2NU9A 3OZBA 4GPD1 5DXAA 2JCVA 3FPGA 1ACMA 2YH2A 3I8OA 4D4MA 1P1IA 5U1PA 4EY7A 4L27A 5IC4A 1QP0A 2OCYC 4XDZA 1FF9A 4ZVKA 5CB4F 3H2YA 1W8DA 3ACBA 4HS9A 2RE8A 5C5EA 1CD5A 2JZOA 2HYDA 2WU8A 4R54A 5FJIA 3ZE0B 3PENA 2V9PA 2Q07A 1U0BB 1FA9A 2WQZA 4IS3A 5DWQA 2XGSA 5AOBA 3WA7A 1I2ZA 3GQVA 3SDBA 5LQRA 3AIOA 1Z2PX 2ZBQA 2QE7D 3R9WA 1NVDA 4DPKA 4TUYF 2XUIA 5CEEA 1PZEA 1LJ8A 3GZ4A 1XZBA 3D0QA 5JSZA 3G7SA 1I01A 1SIUA 1FRVA 4HDKA 3I92A 3SC2A 3SGLA 1NF3A 3I3OA 4D3YA 4YCLA 4ESHA 1ZAKA 1DV1A 2AQHA 1PEYA 2XNSA 4A1FA 3RS4A 1XPRA 2PT6A 4IVNA 3ID6C 3H2ZA 1CFJA 3B2EA 1LJUA 2AFHA 1FDOA 1JG6A 3CISA 3HCWA 3RVSA 4BMSA 3E22B 2ARKA 3EC1A 2GPAA 4C4RA 1JJIA 2CKMA 2FP3A 2ZIXA 4R84A 1R8XA 4C03A 1J9ZA 3H1BA 5EJ8A 2HSGA 1XAGA 4CMEA 3OLYA 4P58A 5EYPA 2AN5A 3WSVA 1B93A 3UG6A 5HW0A 2ZI5A 2G8NA 2J9FB 2ZQZA 4LDAA 1MABB 3EOAI 4NMLA 5DHQA 5KOHB 2BGMA 3OCZA 5JCOC 2DG2A 2IOYA 1PT6A 1RWQA 2Q2NA 3LBAA 2EL9A 2VJKA 4Y6RA 3HBMA 4IGEA 1VOTA 3DTTA 4AN1A 2Q2OA 4DSOA 2VHXA 4YLYA 2E55A 5FOWA 3JWJA 5IMSA 4FGKA 3WYGA 1CUYA 3M6FA 2P9GA 4TQAA 3ZS8A 1E9RA 5HTKA 3UW1A 1BE1A 3A32A 4GX5A 1GG2A 5LQDA 4M9RA 3F5SA 1ADFA 2PGXA 3DLAA 4BNJA 4IUYA 1OX4A 2QEQA 3L4KA 4BTVA 1AT1A 4URZR 4QU0A 1J8YF 1L7PA 1P19A 2GXQA 2IXFA 5FA5A 1LVHA 5HGJA 1J56A 3C4VA 4B32A 1EX9A 4TRRA 4ZO8A 2POCA 1IXKA 1TZMA 4R0NA 2B2CA 2M9MA 4YYEA 4A8HA 3FHCB 1T5TA 3EODA 3ZEIA 4ZN6A 1NN5A 2ZUWA 2RKBA 821PA 3GFSA 3D5TA 1Y4ZA 2FPLA 2JK0A 1G21B 3UAVA 5ABPA 4P4GA 1W52X 5F9FA 2D1FA 1VZ2A 4G5XA 3EXFB 2HIGA 1QOPB 2WJZB 2CCJA 2OZEA 5J5CA 5FWYB 1S0UA 4ASUD 3LG2A 4HR7A 1EZ4A 1CX9B 1KK1A 1UWLA 2X14A 1D07A 5BSGA 1WDKA 4IX9A 3CEPB 4OBWA 2B1QA 5HG0A 3WK5A 4WZ6A 4X85A 3H11A 5AVKA 4IDEA 2NWQA 4PCUA 4MDEA 1P4JA 3NIDB 3AR6A 5EIBC 1LU9A 4M88A 4JZKA 5E0OA 3HZZA 4V0MA 2Q8NA 3EXAA 3HKEA 3K32A 4L9AA 5I7OA 5HRAA 3OU7A 3PI7A 4EBFA 1X9GA 1T5IA 5J2UB 3F6CA 2ZCJA 4ZCTA 3U7HB 2B82A 4MQLA 2QM8A 1BDMA 4B44A 4F2DA 3OT1A 2IXAA 2KX7A 4HFRA 5KTOA 2VXBA 1VSBA 1OY1A 4BUJA 5B3JC 2WWIA 2V7TA 2GQ0A 3A4IA 3LPNA 2BFFB 1CUAA 4UHDA 3NAZA 2C8VA 3D6FA 2DTEA 2H9IA 3RVOA 4C4TA 2MMGA 1FSZA 4TYQA 4WBNA 4R6XA 4XJVA 1GG9A 1YB4A 2BRUA 1CDDA 4U8GA 2P8JA 3B89A 1M0SA 2HLNA 1C2YA 4AURA 3ZDAA 5HSGA 1I14A 1CLUA 2Y9PB 3RTDA 3VO9A 4QOEA 3D2AA 3WFJA 4A91A 3E6AA 1M8JA 3FSRA 5JPCA 1VGQA 1G98A 1MX5A 2UZ4A 3LT4A 4XAQA 3B5IA 1NMYA 4FKZA 4JGIA 3U9SA 1RADA 3TFOA 2YV2A 2B5VA 3ISTA 3QX7A 1P4GA 4CLXA 5F2NA 3U3KA 3WAJA 4PWZA 4Q1VA 2PD4A 3BJEA 1XEFA 1ACJA 3EEYA 3A27A 2H0QA 1KNXA 3H6GA 2IYSA 1AGXA 3Q0IA 5BWBA 2LKDA 4PICA 4Q1AA 2NSLA 5D7BA 4DTIA 1SK8A 1GWNA 1X13A 3A70A 1NVVR 2LGJA 4ZAWA 4E1AA 4XSVA 1K7CA 4DLUA 2AQKA 5JECA 1ST2A 1WXGA 1WJGA 1QNLA 5KKAA 4JENA 1DRUA 4LV6A 4QNNA 4JY7A 3GFRA 1V26A 3LFTA 2X3FA 2QQ5A 4YJ2F 4CCYA 2XDWA 4GZLA 1QVAA 2WVHA 1L4NA 3SHQA 5AH0A 1A4XA 2HJWA 3R3WA 3G5MA 3CV3A 4WK0B 3WYEA 5KYUB 1ZZGA 3PHBE 4FYJA 4Y1RA 4Y0AA 1SWVA 4I5EA 4KUEA 2CD9A 2GF0A 4F21A 2ZB8A 1U9IC 4WZBE 3RR2A 1CQXA 1VFPA 3D7SA 3G2HA 4PBSA 3FRJA 3LC2O 1SVMA 3JW8A 1NNUA 4L9SA 5ALYA 1HMYA 4OQXA 1I5RA 1E6MA 2M6SA 1HFKA 3CRQA 3HL4A 3MFQA 3HB5X 1E5DA 3A31A 4RK4A 1XZEA 1SHTX 1OZGA 3D1JA 4OP3A 3PJFA 1DKMA 3R7NA 4GOMD 2J7PD 1Q83A 4RHEA 2XNDD 4XB2A 1MPTA 2FPRA 1S3SA 3AFGA 3N0WA 1R27A 3AF2A 3DGFC 4KODA 2FZLA 2J3EA 1XYVA 4B7UA 1WUKS 2C54A 3EFEA 5FLYA 4N5IX 1CUIA 2BYTA 2JKZA 2AMVA 3R8CA 4EA9A 3JAKB 4EB6A 5KIAA 5L6LB 1KOGA 2B8NA 1ZK0A 2BBSA 2WP8J 4G23A 2C4HA 4TKMA 3OZIA 1P81A 1SFRA 1VIYA 5CFPA 3SD7A 3NIFB 1OPRA 2UYYA 2NSDA 1OW3B 2O5RA 3PIRA 4PSAA 3WLNA 3JV7A 3KD2A 3R5HA 1CPYA 1IC6A 4U7HA 4CUJA 3AKEA 5C1IA 1S2GA 1JJ7A 2P65A 5EZQA 4BNNA 4YMUA 1RRKA 4WX2B 3EEBA 1Y81A 4FFBA 5AVOA 2HZBA 4O02B 5TGZA 1TF7A 4UPVA 4C7BA 3WIDA 4RETA 2PZFA 3TG8A 2DY0A 4GPTA 3RV3A 3QKIA 3OEYA 2OZPA 1WLSA 2Z83A 1BMQA 1E4YA 2PH7A 1NSTA 2FV8A 4M54A 4O2RA 3GMTA 1HE1C 3A06A 4PXSA 4UAUA 1B8VA 3O47A 2PLFA 3QW4B 3DBHB 4NYIQ 1U98A 1J33A 1JMKC 4RSRA 2AKAB 3IULA 3N8GA 1KWGA 3RIYA 2FPIA 1E2EA 5FT9A 4NH0A 3MMZA 5T4HA 5AVXA 1CUHA 1XCMA 2EFGA 4G67A 1CNEA 2GYVA 3L1UA 3JWPA 4PPFA 2JJQA 3LRTA 3WR5A 1ICEA 1H0KA 1L5WA 4O2AF 2IPLA 5A9SA 1DIOB 2JVKA 3NNDA 2FUKA 4GS5A 2PUEA 3AQ4A 2PXAA 5TNXA 2IDJA 3SVLA 4Z0HO 2ZYTX 4OP1A 2X2FA 5KTTA 1YZYA 1EESA 3LTEA 4OGWA 4B3CA 3I4FA 4Y6SA 1Y4DE 3GYGA 3OP1A 5BR7A 1E2PA 5FHQA 3KALA 3N2IA 4R7ZA 4PS1A 5JDCC 2NYAA 3IC5A 1H2YA 4FUQA 4PRKA 2NT3A 3QBDA 3ZWMA 2OZLA 2WJ4A 3FSGD 4BGVA 5JE8A 3DMTC 3C7CB 2O8BA 3F74A 4RW0A 3JTEA 3IXQA 1BRMA 1Z4JA 3B6MA 4DA8A 1UKEA 4G0ZA 2EF1A 4EMUA 1MMFB 1YOVB 3CO0S 2WG2A 1YL6A 2Z56A 3HCEA 3OH8A 4KDEA 4MI6A 4CIAA 2FSVC 3MVEA 4LHVA 4Q9JA 4YAOA 5J5VA 1E1KA 1ZY2A 2XIQA 3UNXA 4D0RA 1WQ1R 2V65A 4JSRA 1GNRA 4BVFA 3ONFA 1X87A 2CBZA 1P74A 2AB0A 4YQYA 2YBEA 4M49A 5TF4A 3ZBPA 2HFKA 3D8SA 4P0PB 2P9CA 4Y9SA 1Z36A 1NJGA 2PX8A 4PIMA 3QLUA 4EELA 3UA3A 4F4DA 5JIBA 2JASA 4I19A 1X94A 3ROTA 4Z53A 1QQ5A 3K0BA 3ZYCA 4R9NA 3V7YA 2E5LB 2HD4A 2GI4A 2PNFA 3EOBI 3PUYA 4AZVA 2IELA 4DV5B 4Q1BA 2QBYB 1K7YA 1E2MA 1S96A 1ZLYA 3CPEA 3PCRB 5CBPA 1M5TA 4BVJA 1G5TA 5CVCA 1G6HA 3O94A 1P17A 4YMIA 1HLDA 3V1TC 3PGVA 3DVLA 3RT1A 2PGAA 4EZEA 2BMEA 2VJCA 3GLGA 3G9UA 5JSUA 3EGOA 3I1JA 4U4AA 1SCAA 1VZ3A 2HL6A 4G07A 1YS2X 4O4IA 1WF3A 1EX7A 2JHCA 3GJ5A 1H66A 2IF2A 4KXNA 5DYWA 4NABA 1UKCA 3EQZA 3JQ7A 2YBDA 3JQCA 5KNCA 2ZTLA 3PC8C 1SRQA 2BHLA 2O06A 3LAWA 3MBKA 5CDUA 5F7OA 1FYXA 4HT3B 3CUVA 4LZZA 1N1MA 3E7WA 1F4PA 2GD1O 1F17A 4ISCA 4OQFA 5IZCC 2GN6A 3C5VA 3UQYS 2G4LA 1KPIA 4FWIB 3VHXA 3ZIDA 4KWHA 3GPIA 3I12A 1F5SA 1I2CA 1XQ6A 5D86A 2OK7A 4ZVTA 4AXXA 1G5QA 1JQAA 2NTVA 1GGEA 1XTRA 2IPXA 4L4SA 1D2GA 1UP7A 2F3SA 4XYMA 4D80A 1OZFA 1A7AA 1AK1A 4IV5A 1F8YA 1OAKA 2E4YA 1N0IA 1RLUA 3P97A 2ZYHA 4II3A 1GUBA 5IYZA 2PX5A 5FNVA 5IPFA 2JJYA 2NQTA 2QN2A 1R74A 5IJ0B 2NXEA 3NJ4A 3B6JA 4L8YA 1EGMB 3RYCA 3CVJA 2H65A 3PC4A 3W6NA 2IXGA 3IAS6 2QX9A 2ORIA 4O4HB 5CNJA 1EK0A 5JQGF 4RPHA 4QASA 5LDHA 3KSBC 3ZWDA 2W2TA 2WA2A 4X0EA 3K05A 2GJAA 4ZKDA 1JQDA 3UT5B 4IQFA 3L07A 2R7AA 2WZCA 5HQJA 3ZQKA 1IN7A 2W2QA 3KSUA 1I5EA 1H8HD 3E4CA 4I55F 5HJ7A 1Z0SA 2R84A 1H5NA 1Z4MA 3HBJA 4WJLA 2GYYA 5A3JA 2X7HA 2QDXA 1GCOA 4ETIA 2J9ZB 3O83A 3TBKA 1RE0A 3DE4X 5BP7A 4FFNA 4HNSA 1NN3A 3GXBA 3KLOA 4G63A 4LTNA 3AL0C 4JBXA 5F12A 3AL2A 2V0CA 3RC8A 2PFSA 3OJFA 1WXEA 3MHTA 3LV8A 1W4LA 1Z6XA 5GTDA 5LQSA 4CEHA 1ZMBA 4DDUA 1D09A 2F7SA 3HCBA 3ESXA 3OFJA 4GLJA 3IVMA 3PZBA 5FOQA 3WGMA 1F4LA 3QFSA 2WSSD 3AR4A 4BECA 1UJNA 2VAXA 1JKXA 3AEXA 5FEMA 5G3ZA 2GHIA 4I08A 2KPOA 2O2IA 1HFWA 1ZQ9A 2I4TA 2QNIA 4Q3CA 4V24A 1LTQA 3K30A 1YZNA 5HCUA 4LRSB 3SVTA 2F67A 2YZKA 3ZXUB 1JXAA 2B5WA 3VNSA 1C3OB 2VRBA 1KRHA 2ST1A 2A94A 1K7FB 1VBNA 3FLBA 3TRFA 4E11A 2O8FB 3K1AA 1G7SA 1SCJA 3LYLA 3OIGA 3SYRA 4HN4B 1T8PA 2YHIA 1L7QA 3I04A 3M4ZA 4I1UA 1FBNA 4UCFA 3OKPA 2IW3A 3FDXA 1JQBA 4YMLA 4RJ2A 2Q49A 5C4MA 1XVLA 2GR9A 2XTMA 3G79A 3P9RA 5JCZA 2FVXA 4JDPA 1WZ2A 5I5GA 1DCMA 2A5YB 1UZNA 2YN4A 3COYA 5GADl 3G2JA 1LPOA 3FTDA 4IGAA 4HNAA 3KHTA 2VC2B 2B7LA 2Q1TA 1GCIA 3P9NA 5EI5A 3KLNA 3RU2A 3UYLA 1GT6A 4C0QC 5B6JA 1ID8A 3JATA 1NR5A 1X8XA 1FS4A 1UKYA 2W7TA 3EYAA 3FSJX 4JB0A 3T5CA 1Y98A 4EEXA 4R3WA 4CVNA 2J6HA 4L15A 3F47A 1KEUA 4ZK6A 5JR3A 1YFLA 3KK0A 3R7WB 4FE7A 2Y92A 5C0OE 3VKGA 1SCIA 4OFZA 3WOVA 4JJIA 1CUJA 3H0KA 4GR5A 3ACDA 5AI5A 3TDMA 5IUKC 4WY5A 1IRXA 1YQTA 1WMBA 1ZVKA 2G3YA 2WFMA 3NHWA 5TVKA 3NVAA 3VV3A 3UCFA 4IJVA 4DLTA 1UFQA 3T1NA 1M2VA 2YRFA 5G3YA 4MVJG 3WTCA 5EIOA 5HIAA 2H4HA 4ZVSA 1RAHA 5AK4A 3ND9A 4E7PA 5K0CA 4BU1A 2HO5A 3VNQA 1XA3A 1NNLA 3FM9A 4HPXB 4RF3A 4RU1A 4WLUA 5LMCA 4DVGA 1DCTA 1ESNA 1ODIA 2ZRIA 5EWLA 1GPYA 4GVPA 1NZDA 1PWEA 1U2SA 1W9MA 3Q15C 1Z6PA 3D8RA 1J2EA 1ECFA 2IIBA 3V4OA 4LN1A 4BBPA 5KYGA 2IE8A 3AIIA 2V03A 4C05A 3I04M 1KSFX 1MU0A 4RXMA 3K1TA 1HNWB 1VYVA 1Y9ZA 1HFJA 2XHZA 2EW2A 1FDVA 1UJ5A 2P9ZA 3DCNA 1D7AA 1Q3HA 1WL8A 3HHPA 4KDFA 5KMGA 1T36A 4DR3B 3E9QA 1VL0A 3O8OA 3DBRB 3IP3A 3SJZA 3NYQA 4HKTA 2QV0A 5B4UA 3ENZA 2HJRA 3Q85A 3C3EA 1JFTA 2GYUA 3TQOA 2YVQA 3BORA 4EUSA 3FF4A 1PZNA 1O6BA 4G6ZA 4LF8B 1PS0A 2B4TO 3E3OA 2NUAA 1SMKA 1E0DA 1MEJA 3GN2A 4KDCA 4WADA 1NDQA 1QFJA 1NHGA 4L0DA 4B4KA 3OQJA 5C18A 4M99A 2P69A 1ZKDA 3BB3A 4O4LB 1U3UA 3I61A 4W5HA 1IDOA 1D4AA 1M1NA 3GLKA 1VJ0A 1OB5A 3UK7A 2ZJ2A 2C4VA 5E9WA 2NVUB 3U62A 1CVLA 4EATA 2WDPA 1M75A 4G0VA 4TRJA 2QAJA 1L9KA 2YJ4A 5ARCA 4ML3A 1L9XA 4RADA 4YRNA 1AOXA 2CDAA 2FY8A 4M60A 2J6BA 3TGPA 1X39A 1QS0A 2PRJA 3RBZA 1W85B 2XSZD 4H3VA 1DBRA 4HZGA 2JGRA 3M6IA 1KXZA 2C0QA 4TZKA 1UXGA 3IHTA 4KSCA 3MAAC 4G56A 5C9ZA 5A3VA 1Y8AA 2BFNA 2ATEA 1MBZA 2C2KA 4ZO9A 7GPBA 2VTEA 3H84A 3H0CA 2GLUA 1JIKA 1XEWX 3C45A 3G9QA 4I4TB 3AVVA 2AOUB 3EXHB 3SNHA 1DB3A 4OCZA 4CKCB 2X8AA 2AZXA 3RASA 4Y1EA 4MB6A 3P2EA 3LUPA 1IHDA 2CNNA 4UU8A 3G1TA 3UMRA 1SJ9A 2J4FA 4KXMA 2Q5QA 3KHUA 3PPIA 3Q1KA 2F8TA 4KSYA 3QITA 5IAKA 4AG5A 3PC3A 2YMLA 1OI4A 5TT0A 4L4UA 4JJEA 4PTZA 2EJUA 4GAEA 4M1TA 1PU2A 4UHBA 3D4PA 3N8NA 1LDYA 3W5IA 3VYSB 1SCUB 1T9GS 2VRWA 2BV3A 5M34A 1JIVA 2SCUA 3GGSA 3KKZA 4YUZA 3PL1A 1NX6A 5FPQA 1BFUA 1C9YA 2OXEA 1XTVA 4PU0A 4ZCSA 3RF6A 4B6QA 3H75A 5JBNA 3CUYA 3DOFA 3I9KA 3INTA 1RAEA 5EOVA 3V1UA 1BQ3A 4CTJA 4OY3A 5IDQA 1OFGA 4XVUA 1JWLA 4Z4GA 4J76A 1VIAA 1Z6TA 3E9EA 4NENA 3AHCA 3HDJA 1KO1A 3AVQA 5IULC 4LF6B 1UZAA 5LQCA 4MMZB 3ZZMA 3UXMA 3CNEA 2JZNA 4ZVRA 2WTEA 3LUFA 1A4UA 4JGGA 3WHLA 1K3UB 4HX5A 2PJDA 4YJHB 3FCUB 1X1RA 4L8GA 3NP9A 3AT1A 5EP3A 1K7SN 3BC1A 4WLVA 4HDNA 2IRWA 1E32A 4RS4A 3DVRX 4IRMA 3CUSA 3GPCA 3EGWA 3RM3A 1NUQA 1NNI1 1N1GA 3SZRA 5KYNA 4JBIA 2V7XA 3HU1A 4RVFA 5FOSA 3Q8LA 4TWJA 2Q4RA 3SVZA 3NVKI 1TUIA 1SUFA 3P2KA 5IK2D 2BEUB 2IPOA 4JV5B 4OTZA 1W0JA 4KMMA 2Y93A 3A1CA 1YBHA 1O97D 3DVQX 3FMVA 4MUBA 3SX2A 4FU0A 3VYRB 5JASA 5NLLA 1H3FA 1TADA 2AG8A 4E88A 1OKKA 2B4KA 4BVLA 3X2EA 4B6SA 1ENZA 3EZFA 4G0PA 4YRMA 1ZH8A 4FP9A 5GIOE 3TRDA 2GD6A 1XU7A 4H1UA 2DPGA 1PHPA 2GUGA 3BHMA 2CFRA 4I0WB 1JZSA 1RXEA 3D43A 4KDRA 3LA6A 2IP4A 4IXWA 4Q00A 4YACA 5DM1A 3SZGA 3U4GA 2PGJA 1ZZEA 1R9MA 1XTIA 1YR1A 4P3NA 3E0QA 4F8EA 1GA1A 1HO3A 5CYGA 2GM4A 1E5LA 1BWRA 2IVFA 4RVHA 2QN6A 4Z6KA 4DREA 1QO0A 1GQRA 1ZIPA 5CFZA 4Q9NA 1MG5A 3CLVA 4RK6A 3IQEA 1VG8A 3ZUPA 2VS1A 3HXKA 1NQTA 4URYR 4ZMRA 1P2GA 2ZAMA 3MTEA 3CY6A 2BKVA 3SPXA 5I6DA 4C7KA 4DQ0A 4EHNA 2O8BB 2B8TA 1N4AA 1BROA 3ETCA 3HLKA 4E2YA 1IWOA 1J22A 2E37A 3NWBA 3F90A 1VJGA 4YAIA 5B58T 4D96A 4PLZA 3PNPA 1JFSA 2B35A 2GLXA 3A9RA 4IS2A