4LOAA

X-ray structure of the de-novo design amidase at the resolution 1.8a, northeast structural genomics consortium (nesg) target or398
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
158
Chain Sequence
SLAKNIVFIGESGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKASEIWEQYGWNFALEQEQKMADFFSSCEKACIATSGSFVNVSNLEKAGFCIYLKADFEYLKKRLFPLFSDEIKWKKHYNETLSKYEQKANFILNIENKNIDELLSEIKKVIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR398
rcsb
molecule tags De novo protein
molecule keywords De-novo design amidase
total genus 59
structure length 158
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4loaA00
4KFTA 5C18A 3QXXA 4LJ8A 4DB4A 2WSSD 4NKRA 2NPIA 1PLKA 4RD4A 1SULA 1J70A 2ZJZA 4YQFA 3ICQB 1N5IA 4AWXA 2ZROA 2ERYA 5E7IA 3EPJA 2FFBA 5AJWA 5EZ5A 2VP2A 1EX7A 5JI3E 2JLZA 3I3SR 4B44A 3K9LA 4IEIA 2ZI7A 3KL4A 1W2GA 4JLOA 2YWHA 4YMWA 4EPRA 2XXAA 3EIEA 2H92A 3N5CA 2AK3A 2GTPA 5FPTA 2HXYA 4HUQB 4MYUA 1ZM3A 1R0YA 4XWAA 4HZIA 4V0OA 2QP4A 2R9VA 3LW8A 1AGRA 2EWVA 3LVRE 1UM8A 4JSTA 1MABA 4ZPXA 1DO0A 4QGFA 4LBWA 5KSPA 2DY1A 1II8A 1UAAA 4JL5A 4RVCA 4JLNA 2QEQA 8OHMA 4RD0A 2ATXA 2VQSA 1QF9A 3HR8A 1G5RA 1GDDA 1Z5ZA 2XJ9A 5HE8A 3ZS8A 3GFPA 2G3YA 1GNPA 1W5TA 5F9FA 3C14C 4B34A 3U7HB 2GCPA 3UG7A 2W6JA 3DVLA 1W7AA 5LPNA 3BGWA 4MH0R 1OKKD 1D8TA 1VIYA 3M0EA 4P4SA 2FZLA 2QNRA 3W3ZB 1XJ0A 2F3RA 4D0LB 3QQ5A 2KE5A 1ZNXA 4QNRA 3FTQA 2F6RA 3AGPA 4NU0A 5H68A 1HA3A 2AK2A 5AR1A 2C04A 1J8MF 2GVZC 4XJXA 5JECA 2VP5A 4TTRA 1B23P 3DDCA 4G5QA 4C9BA 3RS7A 2PBRA 3IGFA 1NVXQ 4WXPA 1DAIA 4R2IA 3EZ7A 5FI0B 2GKSA 4TMZA 4BRUA 2YHSA 3LDAA 5G3ZA 2V1UA 1R10A 2WWFA 2W2XA 2A5GA 1G291 3QXJA 1S4QA 2J5XA 1G4AE 1K6MA 1PVOA 2ZRDA 2Q9BA 3ZGXA 5B30A 3HPRA 4QGHA 1GL9B 2QROA 3GLFB 3N2IA 2HJGA 4M1KA 3OE7D 2P65A 1OH6A 5JI2E 2BEJA 3DEFA 2BDTA 2R6AA 3CH4B 2PLRA 1P72A 2BJWA 4C0HA 2JLXA 4B33A 5BW8A 4ERNA 3VR1A 1U81A 3CNNA 4RD2A 4KBGA 3VKGA 4Q66C 4U02A 2D3WA 1UBCA 2ANCA 1M2OB 4B48A 1KYIA 2CLCX 4LJ4A 3L82B 1U0HC 4PC6A 4OK3A 2AXPA 1Z8FA 3UWKA 2WAYA 1LW7A 3S1AA 5J4KA 4TT3A 1JAHA 1XEXA 1ONBA 1XDBA 2P2LA 5EQTA 1SXJC 4KLZA 4DC9A 5JS7A 3EASA 1COWD 3AKDA 1XTKA 2RHDA 1GOTA 1IONA 2ODWA 4HUQA 4CW7A 1G41A 4PQRA 2KBEA 2A78A 3N2EA 4GDFA 2YOFA 1M6NA 1JQJC 1Q3TA 1DAEA 3PR1A 4MRPA 2GJKA 1KO1A 1XMIA 1XCPA 3N70A 1XTSA 2ZU6A 1P9RA 3FYHA 3PUZA 3V4RA 3IIMA 4HLCA 2IYTA 3D3QA 3GFTA 2FFAA 2REXB 1N0VC 3MWKA 2JIZA 1NN5A 2MSEB 1NIJA 2FSGA 1A4RA 1G4UR 2XOKD 2QI9C 3SFZA 4C30A 4RZ3A 2ZU0C 4RJLA 2OE2A 4M1TA 3TJZA 3V00A 1ZNYA 2GF0A 2FWRA 2WHXA 4W7SA 2VA8A 2IWRA 2IYLD 1NMXA 2Z5FA 2CLDX 2ZI5A 3U3KA 3PCRB 1TQ6A 1MT0A 3W5IA 3QUSA 2I4IA 3K70B 4URYR 4JLMA 3K09C 1N6PA 4ZCLA 2P6UA 1X8KA 2ZPTX 3U3OA 4DUGD 4C2TA 1KK1A 4QBIA 1NBMA 2LWIA 3MG9A 2ZRAA 3SN6A 2IA5A 3TUIC 3SU8A 3IEVA 1Q21A 3GQBA 3IDQA 1G3MA 1KMHB 2BIFA 3NBFA 3TMKA 1NL3A 1L2TA 5KSZA 1OIXA 4DBLC 3SHWA 2ZITA 3WY9A 2H7VA 3CNOA 5BYKA 1KJZA 4O2LA 2ZJ8A 2PJZA 3KKOA 2ZRMA 1E0SA 1JQLB 1U99A 3CONA 4KYUA 1LS1A 1GSIA 2BC9A 2ZETA 5J4VA 1ZYUA 3X1XA 3CBQA 2HJVA 4PO1A 3B82A 2GAAA 1YRBA 1SHKA 4NBSA 3VR5A 2DWQA 4EDHA 4ZI3A 3CRW1 2QG6A 1M7HA 5CB8A 4GPTA 4TMKA 1D5CA 1T3LA 4Q47A 1U8AA 1Q12A 4D25A 2HLDD 1F2UB 1IXZA 1KNQA 2JAQA 5EP3A 4UNRA 2W58A 3LBIA 4M9SA 4GMDA 1KAOA 4P0TA 2NO6A 2VIIA 4GSYA 3LQQA 4NYIQ 5EE3A 4B3FX 5D3MA 2J45A 2IYZA 4PAQA 4TLBA 4B3BA 1U8YA 2J7PA 3QKUA 4TYPA 3VX3A 5IK2A 3EPHA 2OT3B 1JB1A 1FL9A 1OPXA 2BBSA 4KVAA 3KXLA 1TQ4A 3M4YA 1NVUQ 3LV8A 2MSCB 2HYDA 5KO2A 2D2FA 3T1VA 1N6NA 2GBLA 4TL6A 1E98A 1HEIA 1HQCA 4LJ9A 3S1AB 4A8JB 1ZC3A 3LNCA 4LJ7A 2O52A 1W0KA 1VHTA 1P2SA 2VRWA 2V8OA 4O3MA 5FL3A 5K8UA 3KKNA 1GNQA 4KVGA 3Q8XB 2WWWA 3UK6A 1J8YF 4F91B 1SKYE 3IIKA 3B13B 1XXHA 1V43A 2L0XA 1S9HA 1KDOA 4HATA 1EGAA 2C03A 4WA7A 2W0SA 5FPKA 3C15C 5FBQB 4CYMA 3AV0B 1G7CA 3AKCA 4YMSA 2ZR0A 1VG1A 3B7GA 5LD2C 2H16A 4LSGA 3CRRA 4GRAA 4MUAA 3PENA 4OQXA 4PFSA 4B3XA 1U9IA 1GL6A 5JJKA 4Q1AA 4NE2A 3KKPA 3KDSE 4HAZA 1TUIA 2QENA 5L8VA 5C4GB 4DLSA 3BAFA 2WKRA 4R71A 2IUTA 4GL2A 4ACBA 1ZRHA 4LHYA 1W36C 4Z1MD 3R9IA 5TMPA 5KSOA 4YXWA 4II7A 2QMEA 1KKMA 2NOAA 5M04A 2QAGB 1CJTC 3AF0A 1YZUA 4DIDA 2ODEA 2IS4A 3T61A 4EFMA 1XRJA 5KPDA 3NWJA 2VH5R 2FN4A 3C7KA 2EW1A 2OFOA 3VR4A 3SJBA 5JFGA 3EW9A 2ZRFA 4RD6A 1P60A 2W6ID 5CM9C 2V55B 1B0UA 3RWOA 3T1QA 3AKYA 2A5FA 4IVPA 4JBWA 4NYMQ 4URZR 4F93B 1S3SA 4MDEA 4TLDA 2WWHA 3RRYA 2BKUA 2QSYA 3LWNA 1ZU5A 3NBYC 3B1XA 4XVRA 3NBZC 1K5DA 3MRSA 2EFEB 2F9LA 5IDVA 2FF7A 2RGAA 1KI6B 1EFRA 1F2UA 1JPNA 1RJ9B 1T4GA 1ZCAA 3AVQA 3BJIC 1Z2AA 4JLDA 4Z8XA 621PA 3T5GA 1FP6A 1NVVQ 2OLKA 3G82C 4L4UA 2CE7A 3RVBA 4AD8A 3DKPA 2ZRIA 2JGNA 3AVTA 2AKYA 2ZSAA 4H1VA 3Q5EA 4Z54A 5KDOA 3SDZA 1NKTA 2IXEA 2DCUA 1IN7A 1S9DA 4GOJA 1XTJA 4I1UA 2V3CC 3KJIA 2ODBA 4M1YA 4O25A 1NI3A 3BC1A 4MKHA 2G1KA 1RVDA 1W47A 3HYTA 5ELXA 4A8JA 3GJ7A 2Q3FA 4BASA 4EAQA 4PHFA 3GLIA 1OT3A 1AQUA 3VKHA 1FUKA 1P4SA 2ERXA 2WSSA 3RRMA 2YC4C 1P62B 1AKYA 2AD5A 2VL7A 2WMNB 4GOKA 2UZ3A 4BE7B 2VTKA 5DGXA 1BO6A 3LXXA 2FZ4A 4RD1A 3C5HA 3QF7A 4Q1CA 4HAUA 4EPWA 1N6OA 5A0FA 3MJHA 4IDQA 2JLRA 5CK5A 4BECA 421PA 5J4LA 3PUYA 3ADDA 2FPMA 1RRGA 1G16A 2GCOA 1XX6A 4RZUA 4JLKA 3U6KA 4XTCS 3GEHA 1KOFA 2IEYA 2QP3A 1AGPA 3BERA 4P3YA 4PR0A 3A4NA 4C4PA 3TGPA 1OLOA 1YQTA 4EQ6B 2P3SA 1OE0A 2ZXUA 3L2OB 3NH9A 4FXPA 1ZCBA 1NLYA 1M1YE 4DZZA 3QXCA 3UWOA 1U9IC 5EP1A 2CL0X 4KFRA 4N0DA 2O0HA 3RS4A 1DAHA 2OM2A 3OEEA 4IJMA 2FNAA 4WW0A 4Q03A 3LX8A 4M4SA 4Q1DA 3SBDA 3PEVA 2O8BB 4A2QA 2I3BA 2J46A 2WJJA 3UKDA 3ZZTA 1Z28A 3RRNA 1YR8A 4C0AC 2WSMA 1LTQA 1CR2A 1E9EA 4Q01A 1G7RA 2IYUA 5AK0A 2HT6A 1C1YA 2XX3A 4JKIA 1KK3A 5CJPA 5DE3A 2JLQA 3VQTA 1YRAA 4QJ4A 5HZKA 2XTNA 4GFDA 1I4TD 1TF2A 4LV5B 2CEAA 2ZR7A 4QOSA 4Q4AA 2V9PA 1DE0A 4BEJA 5G40A 4ABYA 3KX2A 5F2EA 3SEAA 1SXJA 3FHOA 3UATA 4DT1A 2ZREA 1WBDA 4UJ3A 1UEJA 2CNWA 4ITRC 3ZH9B 4CEIA 2XTMA 3CZQA 5LDDC 3WYFA 1E2FA 1CRPA 2EQBA 1JEEA 2FFQA 4PHTA 3SQWA 1RJ9A 2ZJOA 3EZFA 3QPVA 1ZIPA 5TB5A 3R9XA 4XWOA 4M9XA 1Q44A 5EE1A 4A6PA 1UBFA 4O0MA 2BMDA 1ODFA 1HQYE 2AR7A 2IEZA 3K1JA 2HLDA 3B1ZA 5CK4A 5B64A 1FTSA 4JVNA 2BM0A 1AIPA 3Q7QA 5EE0A 3HYRA 1G9XA 4TTQA 4URXR 4DLUA 1NRJB 1XJCA 1GNRA 4BGDA 3AVWA 4FMDF 1E99A 1YZGA 1KO5A 4B3DA 1E2PA 1RPZA 2HYIC 2VYFA 3LQRA 3OFND 3FWYA 2GETA 1VCMA 4G5GA 3TQCA 4MGZR 1BYUA 4E5UA 3R7WB 2JLSA 3Q72A 4TZ0A 1ZIOA 2C98A 4XD7D 2GK6A 3WXMA 5FOTA 2OLJA 1XFAA 1UBEA 3AGQA 5B57C 4LBVA 4G5SA 5C2JB 1R7RA 3AVVA 5E7JA 3UXMA 1SZPA 5G3YA 4I1VA 4NMMA 5DN6D 4FN5A 1FOEB 1Z6YA 3WHLA 5E3HA 2NO0A 5J4YA 1SXJD 1RE0A 3RRZA 3C41J 2ZVPX 1YZNA 2HCBA 1O3YA 4DVGA 2N42A 2FSFA 1F60A 1SVLA 4IDNA 3GLGB 4OI0A 2ZJ2A 5E7MA 5UKDA 2GJ9A 3EPKA 3AVYA 4NCIA 4PO9A 4L8GA 1GITA 1XMVA 2ZI3A 3PFIA 1LVGA 2ANBA 3QSYA 4J0QA 4ASUD 5GJVC 5KUTA 3O8DA 4QXAA 4M9QA 3CIOA 2O8BA 3B5JA 5L3SA 4LJYA 5C4MA 2B21A 4LOAA 4M53A 1KO4A 3K0AB 4CT5A 1UKVY 2ZSFA 2YC2C 2PCLA 1JJ7A 5TARA 4IDHA 4U00A 4A4DA 1IJFA 1BMFA 2YZ2A 5DHFA 1W2HA 4ACAA 4C0SA 4P4SB 2EYUA 2ZE6A 3GLHA 3HU3A 2VHQA 2O8FB 2IS6A 3ZVLA 2R2AA 2GXUA 3NEYA 1MKYA 2OSBA 4Q4AB 2C9YA 2OBMA 4AURA 1EFHA 4XOIA 4OQFA 1KZ7B 1NN0A 2NIPA 1GFIA 1ZP6A 4DT1B 4Q00A 3RANA 2Z0MA 4IOLA 2FU5C 2RCNA 2FA9A 3DO6A 3CM0A 1EXMA 2W6IA 2EFHB 3FE2A 5DN6A 1U98A 2IBMA 5AJZA 2WJHA 1UDWA 5CLQA 2BV3A 4JKYA 4AIIA 4ZCMA 3K0CA 4ON9A 2ZE7A 1G8GA 1F3OA 2QPOA 4BFTA 2A5JA 1H8ED 5H70A 1T6NA 4HLUC 5P21A 1GKUB 1ZU4A 5J47A 4P32A 2ZSBA 5FPHA 1NN1A 4NZYA 4LDJA 1G7SA 4AG6A 5EE5B 1VG9B 2AX4A 3PG5A 1US8A 2OFXA 1KK0A 2BOVA 5JHHB 5F98A 4ZDJA 2J0VA 2VP4A 1G8HA 4QM6A 1DAFA 1DELA 1ESMA 2WWYA 2CCJA 3NH6A 2IYQA 2XB2A 5CDFE 3MWLA 3VFDA 3I8SA 1OB2A 1W46A 3TAHA 4DSOA 2SHKA 3L0OA 2XZOA 3KKMA 4FI3C 2PCJA 4LGMA 1FFHA 2ZUBA 3BE4A 1P75A 1KSHA 2XNDD 1U8ZA 5FUYA 2XJ4A 4KI0A 1JXMA 5JRJA 5KDLA 1VYTA 4KO8A 5L3VA 3AB3A 5CITA 1ZNZA 5J4HA 3GCGA 3VTKA 3GLGA 4OJQA 3MFYA 1RRCA 3P4XA 1Z83A 5GADl 4AYXA 3WYGA 2RGEA 1L4YA 2XZPA 4KSCA 2HCJB 4BFVA 4B76A 3DZ8A 4V0KA 1TUEA 2RB4A 3SJCA 4TSFD 1TF7A 2J7KA 4LHXA 1SVWA 3ADBA 2ZQ5A 2CBZA 1FNMA 2BMFA 2ZSDA 3HWSA 5TXGA 4MYHA 2VO1A 1P2VA 2W2VA 2O8CB 2OBNA 1UKZA 2GJSA 4X8OA 4XVQA 1QVRA 3FGNA 5L3SB 2YNMA 4OJKA 1V5WA 3U3JA 3K0AA 2WZQA 3QI2A 3F5FA 3TH5A 1ZAKA 1HT2E 4GT1A 3AQ4A 1OFUX 2QMOA 3U60B 1PUIA 3GLHB 1E9AA 3SNHA 2B7CA 2OO7A 3T06B 3RDPA 4D80A 3NKVA 4B3CA 4D2IA 4XWKA 3DPUA 1XD9A 4Q9IA 2F7SA 1T3HA 4AC9A 3SC3A 3DHWC 1OXTA 1OYYA 1TQ2A 2VP6A 4HDQB 1M7GA 1XZPA 4Q9JA 3HR7A 2GZDA 2ZS7A 2JLUA 2JDIA 3F8TA 1DTSA 3MWYW 4NCNA 1PZNA 4X8LA 3AKEA 5FBLB 2WJYA 4QGAA 5JCZA 1EFUA 3LAWA 1KI1A 4QG7A 2WWGA 1CR4A 2D7CA 2LKDA 5FFMA 5KSYA 4L16A 5JJIA 2QMHA 3VHLB 3OEHD 1W5SA 4Q5IA 1N5LA 4PX9A 3Q5DA 4EJSA 1ZW6A 3I92A 1JEDA 1RZ3A 4LK2A 1XBTA 3NTUA 1US8B 3CPHA 1X86B 4NYJR 3EC2A 1P3JA 5HCNA 2PL3A 3ND8A 1D9ZA 4OHXA 3U4QA 1TU4A 1X6VA 2GK7A 1XF9A 4DCSA 4OI4A 4HZUA 1BKDR 2PZFA 4B2PA 3FFAA 5FTKA 5ANRB 4KCGA 1G20E 1AZTA 1DADA 1EWQA 2DR3A 4B73A 4A15A 1RKBA 3CKLA 2ZUDA 2D2EA 5J5CA 1XP8A 2GWHA 1AS0A 1UF9A 3B1WA 3SR0A 2OILA 5GVRA 3IBGA 2QMUA 3QY0A 4NHOA 4TWZA 4W5JA 3IQXA 2EVWX 3W6PA 1E9SA 1KK2A 4A0FA 1OIWA 3QKRA 5TDHA 2ORWA 4PPFA 2ZRNA 1KSFX 3PIRA 1VTKA 3TLXA 3VR3A 1DAMA 2N46A 2NO1A 2HXSA 1VYVA 3LXRA 3ZVRA 5AUOB 3U44B 1SVIA 4G5OA 3KQHA 3BFVA 4JLPA 2IF2A 3WNCA 1P7CA 3SZRA 4B43A 4F4CA 2Q21A 3EA0A 4CIDA 4L9WA 2ZRCA 3T1OA 3LO5A 1SHZA 2O8CA 1ZUNB 2F1IA 3MMPA 2IYXA 3FMIA 4UXHA 4A0RA 5IRCD 4Y0AA 2GXAA 1I2DA 4UQOA 4ZIRB 2O8EB 2IXFA 1KJWA 3HU2A 2JIZD 3CO5A 4G01B 4F4IA 1T5IA 4TQAA 4JS0A 3ZLJA 1FTNA 3TSWA 2RH5A 3C4JA 1DAGA 1HUQA 2QAGA 2XNSA 4TMXA 4OKSA 4A9AA 5SZIA 5JBQA 5JS8A 4D82A 3B9QA 3IEUA 4MKIA 2OZEA 5A4JA 4BZPA 5JMTA 2QGNA 4IVQA 3W34A 2H57A 2C9OA 2XTZA 4XSGA 4EFLA 1FZQA 1ZUIA 4FD2A 1NMZA 2GNOA 4GNKA 5B58C 2R65A 2RGDA 1G3IA 4RZXA 1E0AA 1TF5A 3MJRA 4DEYA 1Z6TA 1L7VC 1SVSA 2QA5A 1OFHA 3AUYA 1WE2A 1IXSB 4K8OA 3NBXX 1OXSC 4O2RA 1KTVA 2F1HA 3OIVA 1PLLA 2FH5B 2Q3MA 3W9YA 4EJSB 2VPPA 2QAJA 3A1UA 1YE8A 5FOVA 1U0LA 1C9KA 2BBTA 1D2NA 4MYTA 3SFVA 3U4QB 4BZXA 5CIWA 4AYWA 1W36D 4TYWA 1F48A 1XMSA 2QRNA 4HDCA 5TV2A 1MRNA 2OG2A 2ZAMA 1AJEA 4JIMA 5HTKA 4B6EA 1OYWA 1W1WA 4LJ6A 2ZI9A 1YKSA 4LRWA 2VP9A 3OEED 3L8ZA 1Z47A 1CKEA 1VCOA 4PZZA 2ZEJA 5HPYB 4YXWD 4Q02A 2WWXA 3A1SA 2D7DA 1I4DD 1LV7A 3MD0A 2PT5A 4LI0A 3P26A 3PEYA 1S1MA 3THOA 2DWPA 5K8LA 2PZEA 4LY6A 2OUKA 2ZJAA 1LFDB 4JT2A 2C99A 5DISB 5B2ZA 3TSOA 3V4FA 2E9SA 2R6FA 3ZJYA 1CR1A 1F2TB 2BKEA 1YZQA 2G0TA 4A82A 3CPJB 4GP6A 2C9CA 4IOMA 1ANKA 4UNSA 5CB6A 2JATA 4TLAA 2KI5A 4PZYA 1G8FA 2YYZA 2J9RA 3WMFA 4Q9HA 1E4VA 1ZM2A 3W90A 4JJZA 3ASZA 4U5XA 1GZSA 1N3BA 3BB3A 4LCBA 3LX5A 4MKGA 4DCNA 1E2QA 4CT4B 4P31A 4KAXA 3R9WA 3G0HA 3EIHA 2CHVA 3VNVA 4F4JA 2QM8A 1AN0A 2G6BA 1Q1ZA 4PAMA 1TL7C 3I4LA 3EXAA 3W3AA 4Q4LA 3U2QA 3NVAA 4CGZA 2ZVQX 2CL6X 4Q19A 1N5KA 1NLZA 3IQWA 2WJIA 2V6IA 4Q1FA 1E9FA 1KSGA 4OQNA 2QGZA 4ARZB 3RLFA 1E32A 1G6OA 1W0JA 5EE9A 2ORIA 3UANA 3GLFE 4DSUA 4DSTA 4F38A 4MGIR 3PQCA 4BLOA 1Z0JA 3E5HA 1G3QA 1E2EA 4BUJA 3BWDD 4NDZA 4BFZA 4JL8A 2ZM5A 4P33A 4UNNA 4AKGA 3G5UA 4KXFB 4PSAA 3TRFA 2YVUA 4BEBA 3MSXA 4PANA 5FOSA 4C3ZA 4UNPA 2VHJA 4TQ9A 4Z8YA 4D4JA 2WKQA 4JVLA 1TMKA 2YV5A 4QM7A 2P6RA 4ZDWA 3TVTA 4CEIB 3GMTA 4FCWA 1WQ1R 5CJ2A 1CLUA 5A5GA 5EXPA 3KQLA 5F3WB 1ZD1A 2EFGA 3GJ5A 3NC1C 4RCZA 4A6XA 4E03A 2FMXA 4ZV4A 1XJQA 2FV8A 5AUPB 1XTQA 5CM8B 3BB1A 2UZIR 1RW4A 1GILA 4C2UA 3B78A 4KSBA 4OI2A 1VHLA 1XZQA 1HTWA 1R2QA 1EFRD 1ESNA 2GAOA 4HB4A 1YR6A 4DCTA 1HV8A 4UNQA 1KZGB 1SVOA 1TADA 3AEZA 2ZYTX 4DEXA 2D06A 4M1WA 2J0QA 5FTJA 2WKPA 1E3MA 2EFDB 1CS4C 5AJXA 2JCSA 1OH5A 1Z29A 3DOEA 3IPXA 2GXQA 1EG7A 3OZXA 4IXNA 1U2RA 1N6RA 1NSFA 4FMCB 4FW9A 3R7WA 3GLIE 2RAPA 1E2NA 4URVR 2GA8A 5AJVB 3SBEA 1F2TA 121PA 3EG5A 5KHOC 2R6DA 3K0FB 2E87A 1VDZA 2WPDD 2NMVA 3DMNA 3MGCA 2NO9A 4PPGA 1YJ5A 4XSHA 3PEWA 3U5ZB 1RRPA 3BK7A 1U94A 2H17A 3C16C 4HAYA 3LH5A 1A82A 4NCKA 4NYMR 3OIUA 2DPXA 4TYQA 5DYGA 3NDBB 3LLMA 2F9MA 4URUR 5HE9A 3KTAB 4V0LA 2A5DA 3L8YA 1S8FA 4LZZA 3FMOB 3AP3A 4F92B 1JR3D 3LW7A 3IPYA 3AVOA 3OHMA 3BB4A 1TNDA 3REFA 5KNCA 3P32A 2IT1A 2J87A 1C4OA 2JASA 5DI9A 3SYLA 3CNLA 2AL7A 4OYHA 4V0NA 3TUZC 3H1TA 3EIQA 5EXSA 2FGKA 1KI7A 2OBLA 1XD8A 4D4KA 1YZKA 1Z0IA 1I4LD 4FIDA 3MWJA 2KB0A 1Z0KA 4E22A 3UG6A 4C0KA 3T35A 4Z51A 2O8FA 2AN9A 4M1SA 1GRRA 1T9HA 4P4UA 1X1RA 1ZUHA 3B85A 4OQLA 2VSOA 1II0A 4QL3A 5TY0A 2WWIA 1TQDA 4RD3A 1XD2A 1R6BX 1DG3A 2CLSA 2C78A 2D4HA 1QG4A 2V7QD 3FKSA 1Z22A 4YMTA 4BLSA 3U3RA 1VG8A 1A7JA 1IY1A 1E1RA 1VIAA 2ZRGA 2PX3A 2F3TA 3CX7A 5JRZA 1A2BA 5DI3B 3I73A 5GJWC 2JLWA 1COWA 2ZR9A 1JNYA 1GTVA 3KQKA 2WIBA 4KYIB 2BJVA 3OEHA 4CDGA 5AJYA 1Y63A 2VEDA 4CEHB 2P0EA 4QBGB 2RHMA 1QHHB 3AVPA 1U0JA 3H86A 1R8QA 1QRAA 4LBYA 4GZLA 3LBNA 5KU1A 2QTHA 1GKIA 1PJRA 3U7EB 1J7KA 2Z83A 1YU9A 2QZ4A 4RCYA 3I5XA 3U7GA 4ZI2A 1DOAA 2AHOA 3SE0A 5FPYA 3ECCA 1NVVR 3CR8A 5BN4A 4JJKA 2IYRA 1AZSC 1SVKA 3BXZA 3GJ4A 1EK0A 5IF9A 1M7BA 1AQYA 1XCMA 3IIJA 1DS6A 4OQMA 4TYYA 4HEJA 3AF1A 2C2HA 4JT4A 2A5YB 1S96A 2J41A 3FDIA 3K0FA 4PC7A 1MO3A 3AF4A 1Q1EA 4A2PA 1CP2A 3RSLA 4DJTA 4CF7A 5FBRB 4MKFA 3ASYA 1MV5A 2HV8A 3KUDA 1Z6AA 1G17A 1KI8A 1GM5A 1FW6A 2YWGA 2C77A 4DWJA 4LV6A 3M1IA 1JXOA 1KI4A 1MO5A 1G21E 1E1RD 1IJEA 1HE1C 2GDJA 3KJEA 3CB4A 3QKSB 3X1WA 3TW4A 4B47A 1WB9A 3RHFA 2H5EA 1X8JA 5DLQC 2FG5A 2JLVA 2DFNA 4S35A 3I8XA 1BS1A 1KI2A 1TU3A 2VHTA 1FX0A 2NTYC 4JMPA 4DRZA 2QP9X 3P27A 3KQNA 4EIWA 3B9PA 5K8TA 1FUUA 3TIFA 2IW3A 4HSEA 1N6HA 4C0QC 4TL8A 2ZRBA 3QJYA 3P4YA 4DLYA 4FWTA 3AVUA 4ESVA 3OIWA 4Q1EA 4I1OA 2W83A 2Q3HA 3QVUA 5FL7A 4D6PA 3ZVMA 1GRQA 4RFSB 3FOZA 3W6NA 4KU4A 3KXIA 4NTZA 3RC8A 1KY3A 4US0R 2DBYA 2ZSEA 2KSQA 4E07A 1MRSA 1E2GA 2X8AA 3TNFA 4WZBE 4IW3B 2QRZA 4NONA 3KQUA 1LY1A 4Q9KA 1VMAA 1WXQA 1CR0A 2CL7X 4JLVA 4IDPA 1D6JA 4A0HA 1UBGA 3I5YA 2BMEA 4NCHA 1IN4A 4YONB 3TUJC 3MLEA 1XWIA 3PV0A 2CMKA 3VMFA 1OF1A 3TKLA 5KTYA 1G3UA 1GUAA 4EPYA 3VX4A 1IY2A 3BD9A 3U61B 1P73A 3AF3A 2Z6VA 1QDEA 4TT3D 3RS3A 3WBKA 1D2MA 4CEHA 3BBPA 2BVNA 1WDTA 3GEIA 4LHVA 1CRQA 4XIGS 5E95A 2QE7A 3CF2A 3SYKA 3IHWA 4QGGA 5JZVA 3UMFA 1Q57A 5FH9A 4AKHA 3EAQA 1JR6A 2CK3A 1UFQA 1Z06A 1OIVA 2W00A 3D31A 3P20A 3L0PA 4FMCF 4LYJA 4PC1A 1IN6A 3QG1A 1E1QA 4HYYA 2VF7A 3ZS9A 1H8EA 5J40A 4IKEA 5BN3A 2QUZA 2IYSA 2GESA 3JVVA 5HCIA 1E79A 4LYHA 2R8RA 3GP8A 3SHFA 3FMFA 3IO3A 1W4CA 4HZUB 3X1ZA 5K8IA 3A8TA 2RGNA 2XZLA 2YJTD 1EESA 3KJHA 4DCUA 1BIFA 3QBVA 2A2ZA 2ZJ5A 4I81A 3FKQA 1NIPA 2RMKA 3RABA 3NIBA 721PA 1P9WA 1FQJA 5EXTA 2EWWA 5FOWA 3UPUA 1KI9A 1G19A 1Q20A 4PHHA 2GRJA 2PLFA 4N3NA 4FCTA 4N0EA 4DDWA 1NG9A 3W8RA 1E9DA 3QKSA 3QKRB 2OESA 4RZ2A 2GCNA 3EWSA 2OCPA 5AUNB 4EJSC 1T8UA 1VECA 2R6GA 3U44A 3GJXC 4TLEA 3QENA 4OHWA 1RC8A 1KO7A 1R0XA 2RGGA 4QJ3A 4K46A 2QE7D 2QAGC 1A2KC 1QBKC 4LC1A 4A2WA 2XGJA 2AKAB 2KBFA 4LWZA 4P4TA 4JLBA 2CK3D 2NGRA 2ZYWX 1ZD8A 3OF5A 1CJMA 1EFCA 5JEEA 4HLQB 4ZIRA 2O8EA 2A30A 3KZ1E 1GP2A 2A7QA 3CRQA 2XEXA 4LBZA 3A1VA 1OFTA 2QPTA 1G6HA 3B1VA 1X8LA 1MH1A 3AP1A 3NDPA 2NZ8A 5FUXA 1T5LA 2RGCA 3K53A 4M21A 821PA 3QPUA 4YDSA 1FQKA 5EZ6B 3BORA 2BEKA 2K5UA 1G7TA 4LHZA 3Q7PA 4M1OA 5CLLA 3F3YA 4KLNA 4KJZA 2D74A 3BH6A 3FMPB 4Q18A 4WVFA 2OEPA 2O0JA 1L4UA 1KO8A 2HF8A 1E2LA 5JSZA 3D8BA 1OKKA 3K9GA 1TTTA 5EJEA 1IN8A 4GZMA 3GEEA 3K70D 2DWOA 2IK8A 3K9NA 3NEJA 4B2LA 2GZAA 2Z43A 5JWHA 1VG0B 3WBJA 5JWOA 1VKJA 4E09A 4QRHA 1L8QA 2QQEA 1N0WA 1N0UA 1Z0FA 3VNUA 5EUQB 4BFSA 4A8JC 1Q3HA 1XB2A 1YR7A 1ZM9A 4FMDB 3O8BA 5BN5A 1MO4A 4TL9A 4D4LA 4XTRA 1GG2A 2DFTA 2UVQA 3GJ6A 4ZDIA 5CIQA 2B7BA 1XPUA 2G0NA 2NO7A 5FR2A 1ZD9A 2ZYVX 3JZMA 4QHTA 1DEKA 2PX0A 4A0GA 2HF9A 4UJ5A 4DLWA 1E9CA 3B6EA 2GJ8A 3H2YA 2LKCA 2ZJYA 4R7ZA 1NSTA 2IHYA 1MOZA 3KKQA 4Q9LA 3ND9A 3PJRA 2Z4RA 5BWMA 3EZ2A 1CU1A 1TX4B 1RRFA 4RKFA 2FDCA 3KB2A 2AFHE 1E4YA 3CWQA 3I1FA 4TN1A 4GMXA 4DSNA 3PITA 1KSJA 4QC2A 1IHUA 3QEOA 2A3RA 2BBOA 1G3RA 1BYIA 2ONKA 1E2MA 3QKTA 3FHCB 1AK2A 3ZD6A 2OV2A 2YINC 2J1LA 1P6XA 1Z63A 2DFLA 1XPOA 1T91A 4LC0A 4TTPA 1BOFA 1N5JA 3NHAA 4XVUA 3ICEA 3AP2A 1HE8B 4R98A 1KNXA 5CYPA 1UKYA 1OXXK 2IS2A 5CYOA 4NP6A 1SKYB 4G5RA 4EPVA 2GF9A 3CX8A 3TK1A 4IRUB 4QJ5A 4B75A 1DO2A 2CCGA 5DH9A 2QL6A 1P2UA 2WVJA 2ZJBA 1Q0UA 4OHYA 5D3QA 3AH8A 3RS2A 4OBEA 3ZIAD 1GAJA 1NVWQ 2DYKA 3B60A 4URWR 1KJYA 1XCGB 2ZRHA 2CJWA 5AWFC 4PSKA 3QXSA 1CJKC 1KI3A 1WRBA 3L0SA 4QHSA 2YWEA 4IEEA 3ZQ6A 4F7WA 1JI0A 1A5TA 5KDDA 1GWNA 3RSOA 4ARZA 2IYWA 5HR5A 1NNEA 2CHQA 3CF6R 2XSZA 3K09A 4WBSA 5EXXA 1XXHE 3NHBA 4LPSA 3O47A 1N6KA 2QM7A 5FL7D 1BH2A 2QPAA 3F0TA 4L15A 1M34E 4D0NA 3CRMA 4WZAE 1P9NA 3AUXA 4UXJA 2WICA 1H8HD 2P67A 2F43B 5FTLA 5FI1B 1QHYA 4KFSA 3WP1B 2AFIE 5JSZB 2OCYC 2VHCA 1WBBA 3CPEA 1M8PA 4HLDA 4Q1BA 4Q7MB 3ZVNA 2ZRKA 3T5DA 2JDID 1AS2A 3THYA 2ODNA 3A58B 3BIFA 1CJVC 4MUBA 2GVDC 3AM1A 1P5ZB 3QBTA 1A1VA 3WMGA 2IYYA 2IYVA 2C8VA 2XAUA 3SS8A 1UEIA 2P6NA 2FEOA 2B8WA 5SZJA 2WMOB 1F5NA 1MR3F 4WZ6A 1PLJA 2A9KA 4IFBA 5EP4A 2EYQA 1IY0A 1XEWX 2CHGA 2ZI4A 4ASUA 1W48A 3J81k 3LA6A 3CZPA 3QF4A 3UMSA 5IT5A 4WAUA 3M6AA 4TMWA 5DIFA 4LJAA 1E1QD 3EWAA 3GFOA 1GVNB 4GBMA 4DDTA 4C0BA 3V9PA 3CRVA 1E79D 2BM1A 1QHIA 2G88A 2Q9AA 2AD1A 3QPWA 4US2R 4HB0A 2VF8A 3WYAA 4JL6A 4MA4A 4C0LA 3IBYA 4K81B 4DDUA 4ZCIA 4QNMA 2WBLC 3K0CC 3QG5A 3MAAC 1OH7A 4AI6A 3RC3A 2OFWA 4Q7LA 1E9RA 1G5TA 2JJ2A 3K70C 2RGBA 4H9GA 3VU9A 1EWRA 4OHVA 1W4BA 4D81A 1NF3A 4HAWA 3HP1A 1NBME 5FR1A 1JJVA 1NJGA 2O8DB 3ZZUA 1OSNA 4B2IA 2GILA 1Y3AA 2QBYA 4MRSA 2HUPA 5C1BA 3GJ3A 1E2DA 2ZTSA 3HDTA 3X2SA 4Q4JB 3KTAA 3LLUA 5H8WA 4KV9A 3PUVA 4EUNA 4OL0A 2H18A 4IVRA 1II9A 2VBCA 4LYFA 4ZKDA 5BXQC 2V54A 1W49A 3A4MA 2CJWB 2CNWD 2D62A 3CUEF 4OK6A 1LB1B 2ZRJA 1ZMXA 1KMQA 3JZAA 2EFCB 3VKWA 1OFIA 3I62A 2KJQA 4IOJA 4LHWA 1NKSA 1Z6GA 4ZDKA 1UPTA 1RYHA 3SJAA 1YZTA 1W44A 5DO9A 3PVSA 5FTMA 3GPLA 2ZRLA 4NPHA 3NXSA 4ZO4A 6Q21A 1Z0DA 3ZDQA 3GJ8A 1AA9A 1OHHA 1J90A 1QHNA 1E2IA 2LCFA 3VR2A 2XOKA 1UKEA 1RYFA 4MDFA 2FJUA 1AM4D 1KHTA 5KYKA 2Z4SA 3A36A 4BFWA 1ZJ6A 2CE2X 3GJ0A 3K8YA 4DIEA 4I4LA 5HKKD 2RGXA 3TBKA 3HPQA 1W0JD 4JBYA 1OW3B 3PEUA 4Z1MA 2BWJA 2MSDB 4CRWB 1XD2B 4XH9B 1LF5A 4I1SA 3LFUA 4EKDA 2JJ8A 2NZJA 3IILA 4PXAA 1HY3A 2ZANA 1N6IA 1O87A 3LY5A 5GVSA 2BCJQ 3H0KA 2XNDA 1R8SA 4XD7A 1LNZA 1E96A 1G64A 4PPNA 5DI3A 3THWA 5DSZA 2AWNA 3LD9A 5G41A 1KDRA 1G1MA 4TL7A 2FPKA 2GEDA 5GJCA 2NPFA 2ATVA 2X19A 2PJRA 4GOXA 4A36A 3WRXC 1N25A 1QHHA 3DM9B 4IOKA 3DKVA 3GLHE 3NG1A 2JLYA 1IXRC 3AF2A 1YR9A 1ZVQA 5FOUA 2QT0A 1G5PA 1X1SA 2GJAA 2OXRA 1T3SA 3ADCA 2PEYA 2ZAOA 5G53C 4B32A 1XNJA 4MRVA 2IUUA 4M9ZA 5SZHB 4DCVA 3A1WA 2FSIA 2J3EA 4OHZA 3FHTA 5FOXA 3QVVA 4QBFA 3WMEA 5JHGB 4GP7A 3DOFA 4NYJQ 1OXVA 1F6BA 4YMVA 2I1QA 2IC5A 1D9XA 1T8TA 1JECA 4RSGA 1YZLA 1OJLA 4DB2A 4KFUA 3KB1A 4BPBA 4WIAA 2H1LA 1R0WA 2ZYUX 2IX3A 4OK5A 4DHEA 1WF3A 3K9HA 2JEOA 3BH0A 1HYQA 1QZXA 2X77A 3BRWD 4IFEA 4Q7KA 2ONJA 4HB3A 3VU9B 3TR5A 2GEUA 5DHAA 2O8DA 2OXCA 4QFMA 2G1JA 2VLIA 2WOJA 3W8NA 4PC2A 2G83A 2QBYB 1JAIA 2VSXA 1DG1G 1DPFA 3TSZA 3EPLA 2IS1A 2OAQ1 4LPKA 4MGKR 1T0HB 2C96A 2J0UA 1PV4A 3TR0A 4PZLA 4DUGA 2FFHA 2WPDA 4Q4JA 5LB4A 1J99A 2X2EA 3C8UA 1OXUA 2O0KA 4Y0VA 3ZYCA 1S0UA 3KFVA 1TEXA 3D6TB 1QHSA 3CR7A 3FPAA 4IXMA 3R8FA 3BH7A 3K0EA 4BLQA 1FX0B 1E6CA 1VYUA 1XEXB 1G8YA 4B6FA 1K8RA 1R4AA 1ZINA 3W5JA 1IOZA 3QNUA 4MGYR 3QIAA 1E2JA 5BYJA 1ZC4A 3T34A 5JEDA 5F9HA 4WOPA 2RGNC 4BZQA 2YOGA 3RAPR 1TAGA 3I61A 4YDHB 1M74A 1KY2A 3I32A 4BRWA 4BQSA 2ZS9A 3CX6A 3I72A 3VR6A 1FNNA 1CXZA 4A92A 4C7OB 3QXHA 1FMJA 1TPZA 2J59A 4RFSA 2V1XA 4IDOA 2Q6TA 1NJFA 4EPTA 3LBHA 3VHXA 3MCAA 3CLVA 3T12A 1JALA 3OESA 4B3GA 1E9BA 3EX7C 1ETUA 4AK9A 3EZ9A 2F55A 1SQ5A 4YMUA 3JVUA 2J7PD 1R5NA 1CULC 2BHRA 1Z3IX 3A37A 3BFXA 4DKXA 1N6LA 2VHUA 3OAAA 1E94E 1Q22A 2W6JD 4NYIR 1ZM7A 1SXJE 1YVDA 2YWFA 4V03A 3T15A 4LUCA 3THWB 1DBSA 5JWRA 3A4LA 1I2MA 4AKIA 3AVXA 5E4FA 2V7QA 3FKSD 3BOSA 3UMRA 5FTNA 1W0KD 4BWYA 1ELOA 3KJGA 3R20A 2I1VB 3PUWA 3DZDA 3Q9LA 1CEEA 1KMHA 4BLPA 2AXNA 3KFXA 1S1CA 4LV8B 2OHFA 2H8KA 1UADA 3IO5A 4PPQA 5AUQA 1Z2CA 1MO6A 1XTRA 4DLVA 2TMKA 2IL1A 3B8HA 4N1AA 4Q4HB 4HUTA 1DARA 4PQYA 4D26A 1CIPA 3E70C 2QU8A 2WJVA 4TSFA 1TEVA 2G77B 3U7FB 2JA1A 2N1BA 3EZ6A 2ORVA 1IN5A 4LX0A 3CH5A 4YLGA 1JR3E 5FPSA 5C46F 4B74A 1XPRA 3ZZ0A 5LBIA 2ZIAA 4ZKEA 1XU4A 1NMYA 4MRRA 3C5CA 3REGA 3OE7A 3ONWA 5KOYA 5JCPA 3L0IB 3EARA 5D3MB 5GJBA 5EUMA 2B8TA 4JLJA 4ESHA 4ILEA 4TLCA 3EC1A 5H1YA 2WTUA 2B92A 2ECKA 2J0UB 2PZGA 1JPJA 2CVFA 1NBMD 3OAAD 3H84A 1CJUC 1UJ2A 3O8RA 4G3XA 4JZKA 4WXRA 4RFVA 4AG5A 2QT1A 1NG1A 2UKDA 1KIMA 3SI7A 3GD7A 2REBA 3H4MA 4JLAA 2HDNB 2Y8EA 1NLFA 3DL0A 3D7MA 2FE4A 2NG1A 2OCBA 1NP6A 4PHGA 1NN3A 3ZIAA 4JSYA 1NY5A 5L3QA 2E1RA 1J2JA 4M22A 1Z08A 2WM9B 1XXHB 2X1VA 2F1JA 1QHXA 4L5BA 1G18A 2R6CA 2WAXA 4C7OA 4V02A 2XITA 4BFXA 3RS5A 4FMBB 2VP0A 2IHBA 5KPJA 4HAVA 2X2FA 2YOHA 4MYCA 1OHHD 2V6JA 4PO8A 3WHKA 4OI1A 2IUSA 2QQ0A 4KBFA 1WMSA 4NH0A 4Q7JB 4W5WA 3Q3JB 1VPLA 2YKGA 1VCNA 3MUFA 4R2HA 1W36B 2J0SA 2V4ZA 4L9SA 4TMTA 1FPMA 3CF0A 2MMGA 2IXGA 1W4RA 4HI0E 3RS0A 4FCVA 1LS6A 4IHQA 5FUVA 4R9UC 2GHIA 4TQUS 4AY2A 2KWIA 1ZM4A 2DHRA 4HDOB 5KNDA 4CEJB 3FFBA 4UXIA 3QOFA 4M2LA 4DLZA 3FB4A 5LD2B 1KDPA 3THXB 1S3GA 1QVAA 3T1TA 4M0LA 521PA 2NQ2C 4V0ME 5DYIA 5KNBA 4US1R 4S2EA 2QY9A 1Q1BA 1GRNA 4B71A 1W4AA 4PSVA 1Z07A 3Q85A 4Q4HA 1P2TA 2F1RA 5JJLA 2ZI6A 4Q48A 4W9MC 4MITA 1GIAA 1IQPA 1XEFA 2OAP1 2HEIA 2P5TB 5SZKB 4U7DA 2OCAA 1Z0AA 3U3MA 3WRYC 3RWMB 5HZHA 4KHZA 1FMLA 1CF4A 2REOA 4FINA 3A6PC 1CBUA 2Q9CA 3TE6A 3OIYA 3VAAA 4BLRA 3WP0A 4AKEA 4QHYA 1VCIA 4RKEA 3A1TA 2ZUCA 2FPLA 1KI6A 3PUXA 3SJZA 1XMJA 2WIAA 1E0JA 4G0NA 3KUCA 3X1YA 2QORA 3DMDA 2XSZD 1CTQA 1X3SA 1T0JB 2WOOA 1K5GA 2JJ2D 1IBRA 3NC0C 1R5OA 2JJ1D 4TZ6A 4V0MA 3IUYA 2Q0HA 2W0MA 3KXKA 1OV4A 2GZHA 1H8HA 4FWIB 3U6BA 5EP2A 2GBLC 2ASEA 4JBXA 4PAOA 3SQXA 3DM5A 1Q1QA 4CVNA 1RFLA 4NL4H 3W6OA 3CW2A 3GLIB 2P5SA 4DLXA 2BMJA 4JVMA 4W5HA 1EX6A 4JYCA 3HU1A 3R8CA 3BS4A 2O5VA 4KITB 4QBHA 5L3QB 2PMKA 2PMDA 2QN6A 1KKLA 2IWHA 4PQFA 4DXAA 2FGJA 1E0KA 2ZE8A 4GI7A 2WJGA 4DDVA 4BFYA 3BFKA 2FSHA 3HJNA 5JLJA 3PXGA 3GLGE 4PC3A 4UKDA 1QG2A 2XXAB 1S2MA 2GCOB 4JYBA 4CZ2A 5DNYB 2R62A 2DB3A 2QSZA 1XTIA 1NY6A 1OB5A 2FOLA 1R5BA 4EPXA 1WP9A 4H1UA 1IM2A 1DVRA 2FEMA 4EQ6A 1E2HA 221PA 4LYAA 4X8HA 4JVSB 4DLTA 2QTFA 5BQ5A 1MABB 2ZS8A 2PEZA 1WCV1 1KDTA 4HB2A 3ADKA 3ETLA 2AWOA 2G9NA 1ZBDA 3SYNA 5LB2A 1II8B 4G1UC 5CDFA 3LVQE 3TAUA 5HKKA 2C95A 2F43A 3QEJA 1YHNA 4MRNA 1BMFD 1WA5A 2JJ1A 4RY2A 1GKYA 4TMVA 4CEJA 2B6HA 1KGDA 2BCGY 4C0JA 4LJ5A 3OFNA 1Z6XA 1E2KA 1GL7A 4BFUA 3THXA 3QE0A 3THYB 5TVKA 4AYTA 1IAQA 4DLRA 1SGWA 2DFKB 4I99A 3WNBA 3P1JA 4QKQA 1P61B 3ZD7A 1U90A 3RNLA 4NCJA 1HH4A 3E2IA 4D0GA 2PT7A 1HT1E 2MMCA 2EU8A 2ZRPA 2GEVA 2CXXA 2QTVB 2CCKA 4PTLA 5IHPA 1HURA 1LF0A 2ZE5A 4EFNA 1SKQA 4D4MA 1SXJB 1D2EA 1JR3A 3X1DA 1H65A 3UIEA 1E69A 4HLUA 4TYNA 1QHGA 3IKJA 3QF4B 1FP7A 4Q21A 2BBWA 2CDNA 1KAGA 1JBKA 3TW8B 2GXSA 1OH8A 1SVMA 5FBWB 3CWZA 3SOPA 2RKOA 3LRPA 3FVQA 1XEWY 3O8CA 1UDXA 4KODA 2W2TA 2CVHA 3K0SA 2HT1A 3WNDA 2R44A 1DAKA 2IF0A 4POAA 1AKEA 4HAXA 4YC7A 3B1YA 1ZNWA 1G8PA 1R0ZA 1AS3A 4A1FA 4M8NE 2WV9A 3IHLA 2VSFA 4MQBA 3E1SA 4BLTA 5IK2D 3GLFA 3ZQJA 3TQFA 1N2CE 2XB4A 4M1MA 2C5LA 1EFTA 5L3RA 1PUJA 5FUWA 4X8MA 1RIFA 3RYTC 3EA5A 2FX3A 4B35A 5FBVB 2PH1A 3L43A 3B2EA 3TVDA
chains in the Genus database with same CATH superfamily
1KEVA 4KFTA 2V4UA 1GTMA 3ANYB 3KR2A 1AUQA 4LJ8A 3DEAA 2XLBA 1YVPA 1SULA 1A8QA 1SG6A 5E7QA 4HNGA 1N5IA 1EDEA 1ZA1A 1UBLS 3ZDAA 5AJWA 4J0KA 2VP2A 5JI3E 4BMXA 4HDNA 2IXTA 1F20A 1LJ8A 2Y68A 3K9LA 5KAMA 1O6ZA 3LCMA 3LWBA 3JYOA 2KW5A 2H65A 3ORHA 5CMLA 3ZCXA 2XXAA 2JFXA 1KPHA 4WNAA 5IN5A 3N74A 3G68A 2YRXA 2GTPA 4BPRA 4D96A 1KARA 3A10A 3GUUA 3QWIA 4QOHA 1ZQ1A 1RI1A 5GOZA 1R0YA 2YJZA 2VJLA 4IYJA 4EX6A 3ELDA 4KOEC 3PQ4A 3GB9A 3TLYA 1UBHS 2OECA 1MIOB 4YP9A 4QJBA 1QE3A 2PKQO 1ZJYA 2GARA 4AJKA 4ZPXA 5LM3A 4JFRA 4PM4A 3QBJA 1M0EA 2FW1A 1II8A 1P1RA 5JDCC 1KF0A 1MX9A 3PL5A 2H1VA 3NI2A 4RX1A 4JLNA 4BFCA 1IBCA 2PSJA 1NT2A 1XRLA 3CGWA 3PHIA 4RD0A 3VPGA 1QIHA 1OI4A 5BMVF 3HR8A 5K0GA 1TA9A 1B8OA 2QTAA 1OFUA 2XJ9A 4B7ZA 4RZIA 1RAHA 5TPZD 4I9GA 3VOTA 1KQGA 2YVAA 1XAHA 5F9FA 3C14C 4E7PA 4AUKA 2EQAA 4TV9B 3FCAA 3FDZA 3T4XA 1UZLA 3UG7A 3JTMA 5LPNA 3BGWA 2OCKA 1P81A 5IM4A 2ZUUA 1VE7A 4KIJA 1XJ0A 1F17A 1OWOA 2WHQA 2RONA 1DQNA 4OP3A 1AKWA 3DVSX 3H1FA 2PTGA 5DM2A 3M82A 1ECGA 2F6RA 3L5OA 1B6TA 5AR1A 2AK2A 3RODA 2X58A 3LWDA 4AULA 4IDFA 3HRHA 2WF6A 3JD1A 4GIBA 4QGSA 4CMEC 4PX2A 5BN1A 4H3VA 4IV5A 4O4LF 3GRZA 4IZ6A 3PIDA 4BQPA 1G59A 1T13A 2QU7A 4DIFA 1PRYA 2Q0QA 1RQ7A 3BXEA 3D8NA 4I6GA 4BTEA 3TOCA 5EIWA 4RIIA 4J75A 4O4JA 1JFSA 3KVYA 2WD8A 5JQWA 1R10A 1AA6A 3OQBA 2ZOSA 4HQNA 2A5GA 1TO2E 2IU0A 3RQIA 2P1RA 5ECGC 1S4QA 2BFFB 2APJA 1NNLA 2J0EA 4NFSA 4QECA 5HK8A 3RVNA 5HKBA 3EHDA 2WD7A 3K6SA 5D1NA 3K5IA 5EZQA 4LFCB 4X24A 1PYGA 2P65A 1OXKB 3ADOA 5A1TA 2JI7A 2QQFA 2W2KA 2JK1A 2DKNA 3A04A 4EY5A 1J5XA 3CH4B 4GBJA 1M6VB 1P72A 5ER6A 4C0HA 1D4ZA 2X1MA 5F1OA 1DP4A 1MB9A 2IPMA 1AXGA 4S1VA 4DIMA 5BW5A 3M9LA 2BGJA 1KJNA 3CPSA 4W5OA 4KBGA 4ARCA 3PNKA 2D3WA 2W5UA 1UBCA 4NK5A 4ENSA 3WB0A 4RXUA 2EF1A 5I7VA 1M1YA 3T5TA 1PIWA 4FLFA 4C0WA 3L82B 4K9DA 4MUGA 2Q5CA 2OY0A 2FVYA 4PC6A 2JZCA 3R23A 2AG0A 1H85A 1BGVA 2P9TA 4RIFA 5AI0A 4HDNB 4TT3A 4LMAA 3T0GA 3RYFB 4UUMA 2NVUA 5A7FA 4U7TB 1WXGA 3UTDA 5EQTA 1B14A 3GVPA 1D7OA 3S7ZA 3PWTA 2B83A 1L5VA 1XTKA 3ND7A 2M2IA 4Q3NA 1G41A 1XZBA 4PQRA 4PG8A 2KBEA 2R4UA 2A78A 4RACA 3V4ZA 4MAMA 2C2KA 2XDQB 1M6NA 1JQJC 3ZW8A 1F51E 3L46A 2IXAA 2ATCA 3BA6A 4H7HA 1XMIA 3A4IA 1FIUA 3AEQB 1XTSA 2ACKA 5LUBA 1P9RA 3GROA 2IDJA 3DV2A 3P9RA 4FFRA 5EWLB 2FFAA 3LGSA 3TAXA 1JWLA 3GOHA 3ITNA 4FKMA 5GONB 1CUEA 3WB2A 4DV2B 2FSGA 2QI9C 1WZNA 2WNHA 2O1EA 5EKXA 2D2XA 2ZU0C 1UQTA 4PZPA 3ZJ4A 3ZCTA 2UXCB 3CURA 1PT8A 3SF0A 2FWRA 1UDAA 4W7SA 1Z6PA 2HBQA 1V16A 1T0UA 3NTXA 3ZK7A 4RIEA 2IPAB 4GM4A 3AR4A 2XIQA 4BO8A 2PZ8A 1JVBA 3BZBA 3U3KA 4HEA6 3CW9A 4LRQA 1H4TA 1GZ4A 4IQGA 4Y2TA 3F98A 3W5IA 5BR8B 4PVDA 3DQZA 4TLMB 4D9BA 5B55A 1Q0LA 1F1BA 3G1UA 3ZV7A 3IP5A 4OU5A 1PFKA 4I6EA 4LHSA 4MO9A 5DJ5A 3U3OA 2IZ6A 3Q7EA 1R8JA 2VXBA 3HXMA 4QBIA 3B1JA 2MIIA 3SN6A 3C8DA 1K1EA 3GPBA 3OCWA 2WKWA 1Q21A 3IDQA 3WA6A 2DX7A 5EN4A 1G3MA 5A71A 3LBAA 4E5PA 4EUSA 1RQLA 3H2JA 1L2TA 3ZDXB 1VLLA 2FQ1A 4J6EA 3A1FA 5FPPA 1B3BA 3WY9A 2H7VA 1VBMA 4O2LA 1ENYA 2BGWA 1EZZA 1OQAA 1U99A 2ZRMA 3UJ8A 1B6SA 1K6EA 5BV0A 4I8DA 4K6FA 3WNQA 4HXFB 2CNDA 1GZUA 3SYMA 3EUAA 5KNCH 4O4JB 4IIBA 1XT6A 1Q7TA 1WV1A 3B82A 4F4FA 3Q3IA 5CAEB 3DDWA 4GL4A 1BCRB 1O94D 5AI8A 1H2ZA 4AN4A 4CKZA 2O2DA 1SHKA 2BFFA 2NSDA 2DWQA 1H66A 4ZI3A 4I46A 1PWHA 4GPTA 5JBIA 4TMKA 1D5CA 2EJUA 4LWOA 1T3LA 1U0OC 2EW2A 1U8AA 4O3FA 2EIHA 4LX8A 5EP3A 4F7DA 2CNLA 1O0CA 4UNRA 4X44A 5DT2A 4YRCA 3OKCA 2PX4A 5AW1A 1KAOA 2W2KB 4XB2A 4MUYA 4B3FX 1CUYA 5CLIA 2J45A 1OZHA 1BFKA 1TOAA 2Y0BA 1QOQB 5HG0A 5LLTA 2E0IA 1PW7A 3O9VA 5EKTA 1RXEA 1AO0A 1RLMA 2JBWA 4Q12A 2FW9A 3CO0S 4ND8A 3TLJA 4UEKA 3ZK9A 1OPXA 3KPJA 4RF2A 2R1VB 3KXLA 1HNXB 4DIDA 1NVUQ 3LV8A 4IMIB 4PCVA 2MSCB 1X38A 4R31A 3MTGA 1XOIA 3OZWA 1G2QA 4IDBA 5G1NA 1UPCA 3UW1A 4D02A 1E98A 2B99A 4YQZA 2BEWB 3VDMA 4F0JA 1ZD3A 5AVVA 4A8JB 4ML3A 1ZH4A 4LJ7A 3DW3X 2O52A 2UVPB 1W0KA 4JJ6A 4OLAA 5AVXA 1OWNA 2IEAA 5C35A 5KTTA 1QNLA 3TLEA 1E6LA 1JHQA 3T0FA 5K8UA 2QRVB 1IXKA 3Q3CA 2YBEA 1J8YF 1EYZA 3JD4A 4UAJA 1L5GB 4JA0A 1PWEA 4F91B 3OPYB 5DKFA 3ZI4A 1LSSA 2COUA 4E3WA 3LBYA 3NASA 1G8AA 4NE7A 1EGAA 3UFXB 3RRFA 4OX9B 3I6BA 1JIXA 4O1IA 5GGYA 2YYYA 1HM5A 3OMWA 4M1QA 5JSFA 5EHQA 1TUGA 3TTSA 2TECE 4WY5A 2WJAA 3ZHCA 5LQJA 3AKCA 1CHDA 4YMSA 3WYEA 3B7GA 4LNUA 1HRDA 1PUXA 3U4DA 3GMIA 3PENA 2ISSD 4DFDA 5L3SA 2NM0A 4S3MA 1U9IA 4CLDA 4Y3UA 5JJKA 2NYAA 3A2LA 4JEUA 4KWIA 1UFKA 1VJGA 2JIOA 5H82A 3KKPA 4JQSA 3VR6D 4EGQA 1ML4A 2J48A 1TUIA 2P9JA 2QENA 2H4YA 2VT6A 2XLCA 2XECA 5L8VA 3Q6IA 5G1OA 5C4GB 4DLSA 1CF9A 3ZCVA 7GPBA 3BWYA 1P1HA 2XT9A 1I10A 2OZKA 2PSSA 2IUTA 5KWVA 4GL2A 3LUGA 4ACBA 4JYMA 3R9IA 1HDZA 1U1IA 4G0MA 4ZQFA 4YXWA 4II7A 1NW9B 1BOOA 5G0VA 1O0SA 1XMPA 2PYZA 3A3PA 4YUYA 4L6IA 2QAGB 1CJTC 3KPYA 1TRHA 2IS4A 2ODEA 1X7GA 3FVWA 3T61A 4R51A 2VDMB 4ZGGA 4YUWA 5CVUA 5JMPA 3PFWO 1CUAA 1QGOA 2O3RA 3W5DA 4AZ3B 2FN4A 2WHYA 3MUEA 3DV9A 2OFOA 5TIIA 2Z98A 1FMTA 1QNFA 3QEAZ 2ZRFA 5B2FA 4HTFB 5CM9C 3E15A 3T1QA 1NRWA 7REQB 4LF7B 1W87A 2HI0A 4IVPA 1REQA 2WWHA 1OI2A 2GNAA 3O8NA 3P0HA 3LWNA 3PDIA 5K1ZA 3USES 5CAEA 2FJ0A 1TGYA 4LCJA 1BCRA 1C3EA 1Z18A 1H9BA 3B1XA 3ICOA 2COEA 1VPTA 2O05A 1K5DA 3MRSA 1ZGGA 3IJ5A 1Q7CA 4IIJF 5GP1A 3HA7A 2EFEB 3PTAA 1DX4A 1QFSA 4NH4A 1E7YA 4BNVA 1YA8A 2FF7A 4CU5A 5FDFA 1RR6A 2YIDA 3ELUA 1I2CA 4IV0A 4N8SA 3VV2A 2EJTA 3B89A 3T5GA 4G0WA 3QE2A 2BY4A 2E37A 2CE7A 4YI3A 1OTXA 2DZDA 4KB5A 1GG8A 2ZSAA 4EHBA 4H1VA 1P1IA 1T29A 3Q5EA 4Z54A 5KDOA 1H05A 4I4TA 3SDZA 1JT2A 1YHZA 4GOJA 2O2HA 4DNXA 4MGEA 1DTEA 2DWCA 3SXJA 4M1YA 4O25A 4F11A 1NI3A 2DOKA 2I80A 3BC1A 3EQ9A 3FJYA 4DCJA 2C7OA 2Q1YA 2G4CA 1UOPA 1V37A 4C7KA 5ALRA 3EQ7A 3EB9A 3HYTA 4A8JA 5ELXA 3OJCA 4LJLA 5BV8A 5IJ9A 2Q3FA 2UVPA 1C3XA 4PHFA 1AQUA 1ZJWA 1NUHA 2AF4C 2CXRA 2PVPA 3BFJA 3KV1A 2QR5A 5M29A 4DOMA 3ZLBA 4N76A 2A94A 2XNKA 2Q29A 1CB0A 2QRVA 2PKRA 4PO3X 1PWYE 1FRQA 3FBGA 1F7UA 4IICA 2FZ4A 4XLTA 1EFAA 3OPYA 2AUTA 3C5HA 1AKUA 3QF7A 2GAIA 5TRTA 4EPWA 3BILA 1I51A 4HNUA 3CW8X 4DABA 1DXOA 1J0BA 3T5MA 1K97A 1Z12A 2Q8NA 3MYRA 2OO3A 4GU5A 4NDNE 4C7VA 1YTUA 2FRXA 4MW9A 1G16A 1TTPB 2GCOA 3JS5A 3M6WA 4WBNF 4RPCA 2VNKA 1P0CA 4LRYA 1ODIA 1PN3A 1XZJA 2VA9A 4ENRA 3NWPA 1DMSA 3GEHA 4MJLA 1BWPA 1KMIY 1AGPA 5DTRA 2FZ5A 2V96A 1XZAA 3TGPA 1OLOA 2MHCA 2PL1A 4EQ6B 2BR4A 2NXCA 3RGGA 5BOVA 2QTTA 4H6WA 4UBOA 4AF7A 2H4WA 2ZXUA 3NH9A 3CVWA 2UUCB 1NLYA 3AEYA 2AJDA 1U9IC 2G9QA 4FXOA 4I2NA 4MQ6A 1Z39A 5EQFA 3ZPXA 3RS4A 3R5XA 4J7XA 3OEEA 3PNSA 3HB4X 3CLTC 4WW0A 2G7ZA 1O08A 3AW8A 4AJ1A 3SBDA 2D8AA 4A2QA 2WJJA 3UKDA 1T1SA 4YAJA 2CBGA 4MVJP 2D1SA 4BWVA 4G8JA 2R11A 2QB5A 1LTQA 2VHVA 4FBGA 4G4IA 2COKA 3OFSA 3QPCA 2ZB7A 4QWWA 4U39A 3UHAA 4X94A 4EEKA 3FDJA 1EK1A 4E88A 2YHIA 5A4IS 1SBIA 5AK0A 2GEKA 3L1KA 3ZHRA 3IR6A 2HMSA 3OQNA 1KK3A 1NI4A 4OHMA 1AQLA 5I7HA 3ZDYB 1TF2A 4CKCB 3IKMB 2CEAA 1DUSA 2M32A 1K2WA 7REQA 1RZRA 5JBNA 1P7PA 2O54A 4Q4AA 5K9ZA 2V9PA 3RG8A 4BEJA 1ZEMA 1H2BA 1M54A 2OXFA 3KX2A 3PDIB 3RK4A 5ALEA 2VRNA 3UATA 3WTCA 1PFWA 4ITRC 5HM8A 4TYWA 4C01A 1KAEA 1XZIA 1EBFA 3V34A 2OHOA 3ILVA 1GTG1 3RU7A 5MN4A 3D59A 4QFBA 3SQWA 4PHTA 5D86A 3Q7IA 3W5AA 3DT6A 3EFEA 4KG7A 1XV5A 1Z8NA 1UJ5A 2H9YA 3ENZA 4RK1A 1YB1A 4LYGA 4YP0A 3JQ7B 4X60A 3GC6A 2BMDA 3JVEA 3CUKA 4BNWA 4EJ2A 2IEZA 3LVFO 4I4TB 1I13A 4XR9A 1K3TA 4HGYA 1OZ0A 3E3OA 3PHCA 2BM0A 3FWNA 3HBFA 3VPDA 3WWDA 1M6HA 4GKJB 1DRVA 1YIAA 1NSYA 3HYRA 2FEPA 5J2TB 2EKBA 3WB9A 2QYTA 3AVWA 2X9LA 3B2QA 3UAOA 1YZGA 3FPHA 5G1PA 1EGQA 2HYIC 1Z8HA 2Y76A 3DMYA 3OFND 1JQ3A 4G5GA 1SRQA 1BDBA 2PA3A 1WY5A 3FVRA 1SZJG 1T2DA 3R7WB 4PN3A 1NVTA 3WLMA 5EIEA 4XD7D 3WSTA 5MN6A 4FK8A 5FOTA 1HDRA 1XFAA 2OLJA 3GVXA 1UBEA 5CPFA 3UEOA 4CLRA 1HX7A 2JRCA 3QYFA 1DLJA 2FN3A 1N9KA 1RJEA 1SOUA 3FX2A 4WZBA 2FF5A 5C2JB 3AVVA 4TKLA 2DULA 3IDOA 4FOTA 1DEHA 1ZA2A 4N0PA 4NMMA 4B7CA 5JYDA 1D4AA 1SUDA 1Z7BA 3ABRB 3EIUA 3WK9A 4FN5A 1FOEB 1Z6YA 3C85A 4RU1A 5T67A 3RWBA 1HLPA 3O2JA 3SFTA 2ZVPX 2YY6A 3F5MA 3M33A 3LXMA 1NRXA 2N42A 3BMXA 3FPEA 5JAQA 4DVGA 1AN9A 5A3RA 4EHLA 2YY7A 3AIKA 3R41A 4HWKA 2ZJ2A 5E7MA 4HWRA 4M7OA 3TJMA 4DNFA 2GJ9A 3EPKA 1F7VA 4PO9A 1K5HA 1U2QA 4BO1A 2ANBA 4AKSA 3EUEA 3PGLA 4NRDA 4OD0A 5G0WA 5JOQA 5LWQA 2XRFA 1WD7A 4G26A 4RULA 4O08A 3KT0A 2WINI 3AR5A 3R0JA 2PGJA 3CIOA 2PS9A 3NWOA 1XNGA 2BI4A 4UVIA 5T8KC 4QPDA 3BXXA 4XI9A 1CW2B 3X1JA 3O1JC 4JK3A 1KO4A 3PHLA 3HFSA 3K0AB 5KOJB 1GO2A 2GYVA 5AM1A 1GU0A 1TCAA 4JGIA 2YHIB 3CNBA 2IBSA 1MW8X 1JJ7A 3LT1A 3ZWYA 2HJ9A 4YRPA 4KPYA 1IJFA 4C0SA 1M73E 5A04A 1J6UA 1NI4B 2ZE6A 2VHQA 1Y6ZA 2GPJA 1E66A 1L5HA 1GQOA 5DF1A 4Z9AA 2IS6A 2BSXA 2GXUA 4QBKA 4ER3A 3OT1A 3M4JA 4TM7A 1QTRA 2OSBA 1DFIA 4Q4AB 2P78A 1EFHA 1KBZA 4AURA 4C4YA 5IXYA 2VYQA 1NN0A 1Y37A 3RSQA 5CCDA 1P9LA 4ME6A 3CHYA 2FU5C 2WZBA 2FA9A 2PV0A 3CM0A 3MQ4A 5LVAA 3H42B 5J1SB 1TKBA 4WADA 2HFKA 2LE0A 1T34A 3CZ4A 3FOEC 4J91A 5JSYA 5AJZA 1IBLB 4ALJA 5IG2A 3STVA 2BV3A 2ZJ7A 1O58A 3PDUA 3HDHA 4GO1A 4ZN6A 4RESA 2IITA 2TYSB 1D7AA 1N75A 4ON9A 2OQVA 1DDOA 4P4LA 1MDBA 4H60A 1Z5NA 2ZE7A 1KDVA 1OMOA 3L1UA 2F3PA 2QPOA 3H87A 4WUVA 1H8ED 2QUJA 3Q9SA 1T6NA 2FPPB 2IW1A 3ZXUB 1GKUB 1JLLB 3CWCA 3H2BA 3K1TA 4HGZA 4P32A 4UMDA 3ACBA 2ZSBA 2BMVA 4WXYB 3PG5A 4J76A 3ROEA 1XZDA 1QB7A 2OHXA 4KQ2A 1MQAA 2BOVA 1AQ6A 3BF7A 4QWMA 5F98A 3NANA 2B2NA 4QM6A 1X7WA 3H4TA 4TROA 3D9QX 3KCQA 4KIGA 4LDZA 3QUQA 2OUIA 4CG3A 5DMHA 3NH6A 4RANA 4ZT5A 4J94A 1AGYA 3NBMA 1XF1A 3MWLA 2J3KA 2FUKA 4MCIA 1FP2A 2SHKA 3L0OA 2O8VA 3VZCA 3KKMA 1U3CA 4LGVA 4FI3C 1OI3A 2XHEA 1GAQA 1QIEA 3K8ZA 4LGMA 3W4IA 4FEYA 2C9MA 4WZBB 4EHHA 4C22A 1G38A 1N57A 2ZUBA 3EZNA 4FHCA 1U3UA 2X5XA 3C3XA 3OQHA 2XNDD 3SZ3A 2O5CA 4ISCA 4MWEA 5FUYA 2RHCA 3JR7A 3SQOA 1IEQA 1FJXA 2ZVDA 5TEVA 3V4OA 4F72A 5KWJA 5K45A 3EZGA 1ZNZA 2LXNA 3IERA 3O95A 3GCGA 2VSYA 5ALUA 2BEUB 2D1RA 2F3QA 1N34B 3K4PA 3W5VA 5AHKA 4JA2A 5TSDA 1RRCA 1IG3A 2DUMA 4AYXA 3MSCA 3WYGA 1KS9A 1L4YA 2FMTA 5JQGA 4BFVA 4B76A 1K7CA 3SJCA 1YOVA 4WX2B 3T95A 2H0RA 1SVWA 2Y6VA 3OA2A 1J06A 3RUEA 2CFTA 2ZQ5A 3E6AA 1XDZA 2CBZA 1E8DA 3WMXA 2BMFA 3A0RB 1M67A 3FSRA 4Q3CA 2V7XA 3B48A 4DJJA 1O0BA 1UKZA 1A72A 1LKZA 2Q2OA 4XVQA 1ZH2A 3R7AA 2OCLA 1KRXA 3K0AA 5KOJA 1G42A 1ZRSA 2FOIA 1L5ZA 4L9AA 4UTZA 4EYQA 3N05A 4QICA 4PNZA 1OFUX 2QMOA 4HYQA 1E9AA 2NZWA 4ZOEA 2B82A 3RDPA 2ONZA 4J0EA 3NKVA 4D80A 4BV2A 3O3NB 3OT1B 2PPLA 1I3LA 4DLLA 2NPOA 4IY1A 1EI9A 4IHJF 1W581 1U28A 2VS1A 4L8LA 5H02A 4AC9A 3G8BA 1VKZA 1DDGA 3EPRA 4QQFA 4OP1A 4A3SA 4HQ0A 2BFDB 1S2DA 1TPYA 4Y2HA 1WUIS 4RXTA 1GRCA 2DH6A 4L73A 5HA5A 1T0IA 2PU5A 2PZMA 4WNIA 4GX2A 1JDSA 5JFOA 4QGAA 4WCFB 2JL1A 2ZBGA 5CXUA 2IZZA 1BGXT 5KYYB 1TUBB 1RXYA 2LKDA 2D7CA 2JBHA 3CXUA 3G02A 4UNIA 3ZNNA 2B5WA 3TTVA 4C4XA 2KX7A 3EXHB 2P1ZA 1EP2B 1CQIB 3ZY3A 2NX2A 1A7UA 2CZQA 1N5LA 4Q5IA 2NQTA 2FR8C 1NVKA 4L76A 4EG1A 2PQ6A 4DAOA 1KZ9A 1RZ3A 4E6EA 2HHCA 4OFZA 5AI6A 3TI9A 1JZQA 1AMUA 3WL3A 2XQKA 3CPHA 1E77A 2AZ4A 3GG2A 4XCXA 2ADMA 3EC2A 4TKUA 3GUCA 3KEMA 1YKFA 5CRIA 3P0JA 1D9ZA 2O3UA 3O82A 5HCNA 1QRSA 3ORQA 2EX0A 4CM4A 5AYVA 4YPVA 2XEDA 4NMWA 3TZQA 1B1CA 1X77A 3OLWA 4MPRA 3IEXA 4JYZA 3D43A 2GEFA 4PBSA 1PO7A 4JJEA 1U2GC 3LGAA 3CC8A 3S2UA 1M75A 1F8XA 3FJOA 4G09A 4QEDA 4BYMA 1PJ3A 5KMGB 4EI2A 3LO8A 4WKBA 2KYRA 4B6SA 1UPUA 1XQYA 2D2EA 5J5CA 1XP8A 4QIHA 1FSZA 4R1TA 1CWUA 1E7MA 3B1WA 3ULKA 3UAGA 2OILA 3WJ1A 4ARVA 5KZMB 2QMUA 3QY0A 4E11A 2XOEA 5BSWA 2YV4A 4TWZA 2G1PA 3G9UA 4W5JA 1IRIA 3UTCA 1TZ2A 2W4MA 1NZDA 2GS9A 4XGIA 1E3MA 3BWXA 4CLXA 1KK2A 4HGQA 4ZCQA 1WB5A 2Q6KA 5JJCA 4A0FA 3ECAA 5JSQA 1PT6A 4D45A 2HJRA 2D3TA 5TJHA 5KKNB 3BCHA 5JQGB 3H2IA 3PIRA 1J21A 2P3LA 3DZFA 2IJGX 3BGSA 3B2NA 1QO7A 1E8MA 1EU1A 1QR6A 4MMZB 4DV5B 4G5OA 3T9AA 1UWLA 3PE6A 5I7UA 5HOQA 1L4LA 5F64A 3UOWA 2Q21A 3B9RA 4OB7A 4AAYA 1CRLA 1EVZA 1WXIA 5TMBA 3T1OA 1U0GA 1ZUNB 2F1IA 3HDQA 3BQ9A 5I4KA 1JPUA 3QNMA 1D2HA 4IIJA 5FJIA 3GCDA 2B0CA 5IRCD 3OOSA 3U39A 3BSWA 1HPLA 4Y0AA 2NXJA 1I2DA 2C29D 3DVQX 5AVYA 1HQDA 2IXFA 1KJWA 2W2OA 4M86A 1H9AA 1IB6A 3HU2A 3PQ8A 3PD1A 5PNTA 1ODKA 1KDZA 4G01B 5J59A 3DAGA 4TQAA 5CCEA 4P36A 5LQAA 1NKVA 3TL6A 1FTNA 2GKOA 3TSWA 1KGSA 2PJUA 1GPJA 2R79A 2WLSA 2ZZKA 3ILHA 3TBFA 1HUQA 4TMXA 5TR9A 4ZYTA 1NVAA 3DWIA 1A2OA 4E08A 1M2HA 4E4RA 2Y9MB 4R0NA 2E1PA 2QN7A 1SCUB 2V4MA 4D82A 3IEUA 2OZEA 2H48A 2PMCA 2W22A 3IT1A 1E0DA 4IVQA 4S0ZA 1T4CA 2H57A 4NR0A 5FNVB 1GYQA 1WMBA 3I9OA 2QIPA 5EIAA 3PJEA 4ZVPA 4YT4A 4EFLA 5LYJF 1ZXLA 1UZMA 1S89A 1Y8RA 2RGDA 4HADA 3ELYA 2DC1A 3DLTA 2YN4A 1TF5A 1TUBA 4I50F 2O2JA 2Q5OA 4DEYA 1L7VC 2FTKE 1O6BA 5HHTA 4QD3A 3L1HA 1O8BA 3GW8A 3P97A 4NAUA 1KQNA 3EXHA 1QE5A 2A0KA 2O2YA 2WMYA 2JFWA 3OLCX 4TXNA 2PUFA 2Z2YA 3MMZA 4Q15A 3T9EA 3IDFA 5EFZA 3T1NA 2X9VA 2FH5B 3O94A 1CZOA 3DVAA 3GJTA 2QAJA 1XROA 3M4ZA 3CJRA 3T9FA 4X97A 3U81A 4RUKA 1YB7A 2DJIA 3EVCA 1D2NA 2Q1TA 4MYTA 2XUJA 3RASA 3SFVA 5BW6B 2BFBA 1W36D 3QV1A 5FV7A 2V03A 4CXMA 3G0DA 4JIMA 1VL2A 5HTKA 1W1WA 1MF7A 3RV3A 1RRVA 1JSXA 1Q7RA 3ZTTA 2N1MA 3PBKA 2P4EA 1ZUD1 4Q02A 3VVBA 5H3HA 5ESDA 1KJIA 1DIBA 1XHEA 2PT5A 3KSZO 3OJLA 3P26A 3LQ1A 4R3NA 5JZ9A 2DWPA 1XVLA 3GH3A 5ULLA 1YS7A 2A14A 4JQCA 4WVLA 4LY6A 2OUKA 3G1WA 5DISB 5K8LA 4Z53A 3VKGA 4M60A 4IJUA 1FVFA 2G8LA 4PF1A 4UMVA 1FQOA 4LOJA 1T24A 3AIMA 2WM8A 1F2TB 4GP6A 3JARA 1OVGA 3F8SA 4FOPA 4UNSA 5CB6A 4F2WA 3OE5A 2YVQA 2GD0A 5JV5A 1Y3IA 4MPTA 2E7ZA 1S2OA 4ZXFA 3EDMA 3TO5A 3SVLA 3CT6A 4DWOA 4ND2A 2DFVA 2PZAA 3MTQA 3TIGA 4DR1B 3ISJA 2FWAA 3F3MA 3S8YA 4YX9A 4LCBA 1A76A 4E13A 1Y0BA 4RVDA 5LDHA 3TMYA 4QLBA 3RUPA 1E2QA 1EG2A 1M1ZA 3AFNA 1ZUNA 4K86A 1P7VA 1BKSB 3LF2A 4L3WA 1WUKS 2AR0A 4IIJB 3HWX1 4PINA 2ZBVA 4G1CA 1Q1ZA 1WPXA 3I4LA 3W3AA 4Q4LA 2Q1UA 5C1DA 1M5RA 1MG5A 5JCJD 5DWQA 4KMOA 4Q19A 5EIBC 5JH7A 4WACA 4UW9A 2FEKA 2V6IA 4Q1FA 1TK3A 2WYVA 5KOHA 3BE6A 4ARZB 4ZJPA 2C94A 2G08A 1JLRA 4L02A 1ZOSA 2R5FA 4KPUB 2WVGA 2VRBA 3L18A 3R7DA 2Y71A 4KMMA 1RNLA 1BQ3A 1LX6A 1SQGA 2ORIA 5A7HA 2QLMA 4WV3A 2HK7A 3N53A 1WCXA 1RKVA 2AE2A 4DSUA 4DSTA 1HKUA 2JKVA 4JOSA 4HEA1 4F38A 1V11A 1FXWA 1N36B 3ZDDA 4XA8A 1WKBA 3AETA 1MC5A 5FI5A 3NGLA 3CF4A 2W42A 1MAAA 1U9CA 2WA2A 3CB2A 4OQDA 3FN4A 4PSAA 5AK4A 3ZGNA 4PANA 2ZK7A 2JGJA 2ZT5A 2VHJA 1OFGA 3LLSA 2GBIA 3VR4D 1Y81A 2HJHA 2P4QA 1W4ZA 2VZ0A 3LP6A 3AHIA 3MJ4A 2DMRA 1TZMA 3UAYA 4JBGA 2YV5A 4CEIB 1JDNA 5HW0A 3QFTA 2A9PA 4YAUA 5CJ2A 1CLUA 4KQWA 4BJ3A 5EXPA 3B3QA 3EGEA 1ZD1A 3KQLA 4L85A 2GJ4A 1XJQA 4OH7A 2CZCA 3AIIA 2G76A 2FG6C 2UZIR 3LC1O 3Q98A 4LWPA 5E1BA 3TM5A 3U40A 4O33A 4UTVA 2G9ZA 5K4GA 4RETA 4BOYA 1R2QA 1SUSA 1ESNA 2GAOA 1OGYA 2W2LD 2YVLA 4HB4A 3BWVA 4LTDA 4FZRA 1YR6A 2VCYA 1SWWA 4DCTA 5I7SA 4UNQA 4RVUA 3F71A 4B8YA 2JKZA 1R4ZA 2ZYTX 4P22A 4A5SA 4N0MA 1TM1E 1CIJA 1YS4A 2XUDA 2EFDB 3KJZA 1CS4C 1PJQA 4GMGA 4OUDA 5KCMA 2QAIA 3REQA 4ETWA 1EG7A 2GXQA 2HY7A 3RIMA 1NAIA 4WZAB 2BTOA 3QYPA 1SAYA 5GAJA 2GA8A 3K16A 3SBEA 1Q0TA 1F2TA 3MJVA 121PA 5BSVA 5KHOC 1QRDA 1ZCFA 2PBLA 2R6DA 3JARB 3HCCA 2WPDD 3BL5A 4MV7A 3FOCA 3DMNA 4XB6B 5JD6A 5J3JA 5KOIA 5ESWA 4PPGA 4JB0A 2QJOA 2FMHA 2UYOA 3VC1A 4BX0A 3IUBA 4PFKA 5DXAA 5IJXA 4YRKA 3U5ZB 2WTAA 1NW6A 5DNDA 3FZNA 3GT3A 2W4IA 5DYGA 3WL6A 3LLMA 5HE9A 2XBMA 1QZ3A 1NF8A 3KTOA 3KXPA 4RPJA 3I2FA 2GLUA 1S8FA 2YDYA 4LZZA 2Z2ZA 4H77A 3HNRA 5FT9A 1NVFA 1UEXC 2B30A 2VWGA 2VAWA 3MPOA 3IHTA 2ILTA 2PUEA 1A5AB 1AC5A 5THXA 2ET6A 4M49A 2WU0A 2Y1CA 5LXTF 4HWOA 1J9EA 1IOLA 1Z88A 3V46A 2J30A 3K1YA 4BMCA 1E64A 4EGJA 3D64A 2J87A 3EDRA 4M87A 1FUYB 2BUBA 4YRAA 1C4OA 3MM4A 3ABOB 3PWKA 4CF3A 1PSDA 4I4IA 3TUZC 2KM1A 1F8GA 2QJTA 1DQPA 2FR0A 3GVHA 3H1TA 3PGMA 2EZ8A 4KPUA 3F6RA 5AHOA 1MJ5A 3LOPA 3WIDA 4YEDA 2AG6A 5ERXA 1Z0IA 1FK8A 1I4LD 3MWJA 1GV0A 1WUTA 2OORA 1Z0KA 4E22A 4LKOA 1VL0A 3T35A 2OVFA 2O8FA 3DTNA 1AZWA 2BZ1A 4KR3A 3VYSB 4MW5A 1RADA 4B8WA 5AXAA 1II0A 3DCIA 2DUWA 1ZHHA 1XRRA 1Y1RA 4RD3A 4YJ3A 3O31A 3KQVA 3QWHA 4CIXA 3H83A 1G20B 3IJPA 4J4BA 4EA6A 3R3HA 1XDGA 5B3JC 1LBQA 2R5WA 2GCIA 2V7QD 1KFJB 1V2GA 4DRXB 1VG8A 1Y8QB 4YRNA 5JUWA 4AN1A 1PSZA 4B3HA 4RHCA 2F3TA 1TA0A 3NYQA 5C32A 3MMSA 2DPYA 1A2BA 3WK4A 3HJTA 4OL9A 1WU7A 2MTBA 3G17A 2QGFA 1JNYA 1GTVA 2YCBA 3KQKA 3ZCUA 3TNJA 5LA6F 5KBYA 1A9SA 1LLDA 1PT7A 3AXTA 4UARA 2OOKA 2FLWA 4OLHA 3RFUA 3RK0A 2P0EA 4C3VA 1NYLA 2RHMA 1QHHB 3NWEA 2UYGA 3WMGA 2WC1A 1QRAA 4EYEA 1ZHOA 5GV8A 3UW3A 3O3OB 4HY3A 4IDEA 3AESA 1EIWA 3RJZA 1Y6JA 5IUJC 1WLYA 1J7KA 1XQ1A 1SCAA 2Z83A 3MEQA 3D2CA 3BL6A 2CYCA 2VPYA 3MT8A 3Q41A 4I5FA 4KZPA 3UXHA 4AY6A 5A7GA 2Q4RA 5LNK6 2DHQA 1NJ5A 2C2BA 3O83A 4J49A 5IUKC 1GJRA 3E1GA 2AHOA 3PFGA 1VKHA 3ECCA 1NVVR 2IQIA 4F1WA 5BN4A 4JJKA 4R5HA 3LT5A 1PEKE 3IODA 2FVXA 2PUTA 4OUDB 2CNBA 1EK0A 2W8BA 2QTBA 1WKVA 1HZJA 1AQYA 1GADO 1HG1A 3ID6C 2VF2A 3MLBA 3TD6A 4I55F 4BWGA 5EJ9A 3DL4A 1YZYA 5B12A 3VNAA 2ZB4A 3K94A 5LZ4A 1QRRA 5EGSA 3DCNA 1S96A 3TFQA 3VTAA 2DFDA 2J41A 1VPWA 3N0VA 3T3GA 4N9QA 4FKZA 3F9CA 1B7GO 3NPAA 3RSLA 1QGZA 4HPXB 4EFKA 5JSUA 4XYEA 3I34X 4GEKA 3A25A 2BW0A 2Y93A 4ZICA 3PJGA 2FAXA 1WSDA 3WLIA 4DWJA 5HGXA 5B1EA 1QWOA 4LV6A 2Q4DA 3EVZA 1KI4A 1WHSB 2R1TA 3X1WA 4WCVA 3QH4A 4ZI7B 2IUYA 4EHDA 3R3WA 3DFUA 1XNRB 2FG5A 3ORFA 4R8RA 3T7TA 4QG3A 2JLVA 3Q7SA 4L4RA 1Z0UA 4D9GA 1TU3A 2VHTA 3TXAA 3ZWVA 3P27A 4OOEA 4J7CA 2XD4A 4WOBA 3B9PA 5K8TA 4HSEA 1G5QA 5FLEX 5DHUA 1WABA 4EJ6A 3ZG6A 4GMKA 3LT0A 2H4HA 3AVUA 2GWRA 1XDWA 4NJEB 3RU9A 1JU9A 1QJ4A 1VRCA 3FTPA 3Q0EA 4WK0B 5TX7A 3UT0A 4N12A 5H9WA 3GRYA 4Q1EA 1YE3A 1MIHA 2ZDGA 5ICCA 1FZTA 1Z2PX 2W83A 3DGEC 3JRWA 1GRQA 2BGLA 1BXRA 3NALA 1KVSA 4CIWA 1XYGA 4NTZA 3RFFA 4US0R 2VYND 5G02A 4W1SA 4F3TA 2D7JA 2X8AA 1E2GA 1C0KA 2FY8A 4BBJA 4MDHA 2CLIB 4IW3B 3CJQA 1D0VA 3R75A 4BKPA 3KQUA 4EUHA 1FFYA 3V7NA 5JSKA 1CR0A 1YKGA 3IXQA 5ER9A 4IDPA 1DX6A 3R3SA 4QSMA 1IWOA 5JG7A 3FSGD 1EKXA 3I5YA 4N5NA 4X6YA 2B0JA 4NCHA 2H51A 4AXBA 2RHHA 4YONB 1RZRD 2HGZA 4ZODA 1W35A 3TKLA 5KTYA 3U9LA 1G3UA 2FSUA 3L84A 4NENA 1AGXA 3BD9A 3KU1A 4RPGA 1P73A 3F6CA 3KJQA 4H7IA 3NUZA 3MGBA 4LAFA 4IIUA 3UB3A 6AT1A 1QDEA 2C7BA 4TT3D 4TXLA 3RKRA 4CEHA 3A9VA 3GEIA 1WDTA 1CRQA 1O77A 5E95A 4P93A 2ZAGA 2O9JA 2UYYA 3C1TA 3I2YX 2IHJA 1WP4A 4CMHA