4LOAA

X-ray structure of the de-novo design amidase at the resolution 1.8a, northeast structural genomics consortium (nesg) target or398
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
158
Chain Sequence
SLAKNIVFIGESGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKASEIWEQYGWNFALEQEQKMADFFSSCEKACIATSGSFVNVSNLEKAGFCIYLKADFEYLKKRLFPLFSDEIKWKKHYNETLSKYEQKANFILNIENKNIDELLSEIKKVIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR398
rcsb
molecule tags De novo protein
molecule keywords De-novo design amidase
total genus 59
structure length 158
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4loaA00
1UKYA 1TUIA 4CW7A 1XMVA 2IHYA 3AKEA 3SNHA 4R71A 1LNZA 4XVUA 4CVNA 4XH9B 2DBYA 1RRPA 2FF7A 3C41J 4JLDA 4WW0A 4ZPXA 1KY3A 3K70C 1WBDA 3A4NA 1CJKC 1D2NA 2Q3HA 3G0HA 4JVNA 4PHHA 4QHYA 1E2JA 2XZOA 3PFIA 1OYYA 4HAZA 3U3RA 2G83A 2V3CC 3L2OB 2FFQA 4HYYA 4OL0A 3PENA 2GILA 2KB0A 4DCSA 2ZU0C 2ODWA 4PPQA 1S1CA 2XNSA 1P60A 1KI7A 1NMXA 3FYHA 1Z2CA 2NIPA 4ZDKA 4UXIA 5CB6A 3KKOA 2RGBA 1JXMA 2AFIE 3AEZA 2G88A 3FKQA 5L8VA 3MD0A 1GP2A 4DDWA 3EAQA 2BWJA 4B3FX 1AS2A 1KO5A 1P3JA 2WKPA 4BFSA 2H1LA 2EU8A 4PC3A 1CRPA 3J81k 4GSYA 3AVTA 4IDOA 5FOUA 1CULC 2GAAA 1HT1E 2IT1A 3L0PA 5JRZA 3CRVA 5FTKA 3VNVA 3LX5A 4FIDA 2WIBA 3X1XA 2NMVA 4U00A 1OV4A 2WIAA 5K8LA 2I4IA 4HB0A 2CEAA 3KDSE 3SBEA 3LDAA 3PJRA 4PQRA 2XITA 4P4SA 1P9RA 3Q8XB 1JBKA 2B6HA 2GVDC 2VHQA 5LB2A 1NMZA 1W36B 5JWRA 2IYQA 2KWIA 5FL7A 2O8CA 5F9FA 3RC3A 2IYVA 2EWVA 4HZIA 1L4UA 3H86A 4AG6A 1AS0A 3T5GA 4BLRA 2X77A 1E94E 5CLLA 1SVMA 1W7AA 1LFDB 2F6RA 1DPFA 4PPGA 4IOMA 3VX4A 2ZRAA 2HJGA 3QKSA 2ZM5A 3EC2A 4M22A 5EE1A 4N3NA 2MSDB 3JVVA 1Z63A 2MMCA 1JAHA 2ZRGA 4B71A 4JLVA 1LS6A 1OW3B 2ZUBA 4GDFA 3I32A 2O8DB 3DZ8A 3U6BA 2AK2A 1P9WA 3K53A 4F92B 2FSIA 4O0MA 2NO7A 1Z6YA 1QHYA 1XD9A 1OIWA 1YHNA 2BHRA 2GCPA 2GK6A 3VR1A 4XWOA 5JS8A 2W6ID 3BGWA 1AA9A 4C0BA 1EXMA 3RS7A 4O3MA 2ERYA 2PL3A 4NYMR 4DDVA 4LZZA 2ZUCA 3LNCA 1E32A 1Z07A 2BEJA 1SHZA 3TQCA 2QBYB 2V6JA 3RANA 1H8HA 1M1YE 4X8LA 1W2HA 5KDDA 4TMTA 1P5ZB 4NCIA 4N0DA 2R62A 1IOZA 1C1YA 4TSFA 3UWKA 3CM0A 3RRMA 4BLPA 3TNFA 4B32A 3R9XA 2DFNA 4NCKA 2W2VA 4P4TA 3SQXA 1E9FA 1SVLA 3OF5A 1VCIA 1FTSA 2BMEA 3QKSB 2ZYWX 4IVPA 4D4KA 3GEEA 5FPTA 4B2LA 3MJHA 4Q4AB 4GT1A 1NBMD 4TL9A 4DSNA 3ZVLA 3W90A 4E5UA 4M9XA 3EIQA 1JPNA 2BIFA 3MSXA 1Y3AA 1NVUQ 2QQ0A 1GOTA 4EPXA 1EFCA 3ZDQA 4Q00A 2JLRA 1IN6A 2C96A 4UNQA 3THXA 3AVPA 5JHGB 4QNMA 3CWQA 4IRUB 2VHCA 2QTFA 2FSFA 4LYFA 3H4MA 1PLJA 3NTUA 2GBLA 1NJFA 1W44A 3HDTA 2OV2A 3MG9A 1KTVA 3C8UA 3LX8A 2NG1A 5CIQA 3IKJA 1G18A 1G4UR 4Q4LA 4FINA 4M1SA 3O8RA 2WOJA 3B13B 3GPLA 2WWFA 4DDTA 3WP1B 2IXEA 3AGPA 2D4HA 4US0R 5FBQB 3QKUA 4LJYA 2VH5R 1QBKC 2YOHA 3QXSA 4R7ZA 2F3RA 3EPHA 3BRWD 5DHAA 1P6XA 1W5SA 1YZNA 2Q9AA 5TARA 1ZINA 4Q7JB 3NDPA 4BASA 2QA5A 3CB4A 1NVWQ 1XEWX 1XPUA 1TPZA 1XJ0A 4IOKA 4DCNA 2J0UA 4YMWA 1ZC3A 4NZYA 4YDSA 1ZM2A 2XTMA 3TRFA 3UKDA 2H5EA 5JI3E 3MGCA 2ZSDA 4FCWA 2AWOA 1AK2A 2AKAB 3QI2A 2ZRNA 4LPKA 2BV3A 2WJYA 3MRSA 1PZNA 1YE8A 1DS6A 1J90A 3X1WA 5AJYA 4GP6A 3W6OA 2OILA 1Z6AA 1GKYA 2ZJOA 1LV7A 4ZDIA 2ZYVX 2ERXA 4BZQA 3QPWA 5JJKA 1G21E 2GRJA 4CEHB 2FMXA 1L7VC 1HQYE 3U44B 4DLRA 2PEZA 3IO5A 2Y8EA 4I1VA 3PQCA 4XOIA 3ZVMA 2GXSA 1OH6A 1E4YA 1JJVA 5JSZB 3P4YA 5FPYA 1XTSA 2O8BB 4LYJA 1Z0AA 1E2PA 1JPJA 4KLZA 5EE5B 2ZS8A 4IDPA 4DCUA 4NCHA 2FSHA 3GLHB 3IHLA 1G291 4RFSA 4PC2A 3WMFA 2CJWB 1XTQA 2FSGA 4HEJA 4QGFA 1E9CA 3PITA 1ZNWA 2DHRA 3AV0B 1E9DA 1E9EA 4QBGB 2F9MA 1E9SA 5HE9A 1E9AA 4MKGA 4AKEA 3AP2A 4A2PA 4BUJA 1U9IA 4M1OA 3A1SA 1U0LA 3TAHA 3KTAB 2ZRBA 1OFUX 3CF0A 4URYR 2PH1A 3K0AB 3NVAA 2J0UB 3BBPA 4DEYA 1WB9A 3KZ1E 4DLSA 2J0QA 1N6OA 1NN5A 4Q66C 5JLJA 3Q9LA 1NN1A 1FMLA 4DKXA 4F91B 1FP7A 1R5OA 1G7SA 4PAOA 4EJSA 3UIEA 3AM1A 4BEBA 1NVVR 5IDVA 3W34A 3ZS8A 3SHFA 3BH6A 1NKTA 3T15A 1BMFA 2WHXA 2RHMA 5LD2B 3IDQA 4E22A 1T91A 2VHUA 1QHIA 1G5RA 3ASZA 2MMGA 5HKKD 2JLXA 4Q5IA 1J8MF 4CEHA 1O87A 3B1VA 1OFIA 2GEUA 4GP7A 1KJWA 1QHHB 1KDRA 4F4JA 5KSOA 3DMDA 4A15A 1RYHA 2OAQ1 3MAAC 1KSFX 3AF0A 1DELA 1II0A 1EG7A 3BD9A 2IS1A 1D9XA 4I1OA 1YZLA 2C8VA 3AVQA 3DL0A 3FDIA 5C1BA 2A3RA 3PG5A 4QBIA 1XD2B 4A92A 2IC5A 4UXJA 4H9GA 1VYUA 4BQSA 1RPZA 1CBUA 4GPTA 3IBGA 3VKWA 3W3AA 1N6NA 3CF6R 4MGYR 5JMTA 2ORIA 3L0SA 5CM8B 5BN5A 1DAMA 3UG6A 2HJVA 2R6CA 3LW7A 3ZVRA 1WBBA 4RCYA 2CBZA 3SE0A 4NH0A 4JL6A 2GK7A 1T0JB 1HTWA 1KDTA 1TU3A 3U6KA 3AVYA 1VPLA 1KI8A 1R0YA 1KO4A 2H8KA 3R8FA 1CR4A 4OI1A 2CLDX 4LSGA 4BLSA 2ZSAA 1ESNA 3LV8A 3GLFA 5FR2A 4QJ3A 1NBME 4HAYA 4AWXA 4M2LA 2IEYA 4MGKR 1DTSA 4OQFA 4D82A 5UKDA 4YMUA 2RMKA 2V1XA 5HR5A 1RKBA 4JLBA 3NXSA 3FHTA 2ONKA 3PIRA 4XVQA 1B23P 3CX6A 4LPSA 1TAGA 5J5CA 2VHJA 3BXZA 2VP5A 1W0JA 1P62B 2BBSA 1F6BA 4MA4A 1A2KC 5KDLA 4URXR 4KFTA 1UBCA 2GDJA 3CRMA 1N6HA 3QJYA 2GEVA 2J1LA 3ADDA 1U2RA 4BECA 2C77A 2ZRLA 3EXAA 1DO0A 4B3BA 3A58B 3ZIAD 4OKSA 3KB2A 5G53C 3LRPA 1VIYA 3RWOA 8OHMA 1SQ5A 2FWRA 1G8PA 1NN0A 4HAVA 4M8NE 4NPHA 4RSGA 1CJTC 4EPYA 5DNYB 2FFHA 5B30A 1XB2A 3I8SA 3ZLJA 1PLKA 1KJZA 2PCLA 4L16A 2GNOA 4RD1A 1HE8B 2Z43A 5CITA 2JATA 1EFRA 1AM4D 3NBFA 1XCGB 5JEDA 1K8RA 1NSTA 2XB4A 4ZCIA 2EYQA 4KVAA 1UDWA 1UEJA 821PA 5J4LA 2WSSD 1FFHA 4PPNA 5KTYA 3WHKA 1VIAA 2AXNA 5B2ZA 3ASYA 2B8WA 3B78A 1S9DA 4D25A 1GRQA 1E2DA 1E2GA 4JBYA 3I5YA 2ZAOA 3DVLA 3EIHA 1JNYA 1Q21A 3VX3A 3O8DA 1R0ZA 1MABB 1E79A 2HF8A 1F2TB 2I1QA 1R8SA 2ZEJA 4DHEA 2BM0A 4AI6A 3FGNA 1F2TA 1E6CA 2FV8A 1YKSA 4TZ6A 1A5TA 4M0LA 1G7CA 1ONBA 1MOZA 4V0MA 4TYYA 1PUIA 3TAUA 2A5YB 1U0HC 1IM2A 3AVXA 3U3MA 3PUZA 1ZM3A 2O0JA 4KXFB 5LBIA 1ZU5A 2PLRA 4W5JA 3ZS9A 4G5OA 2ZE7A 5EE9A 3SFZA 4BE7B 5C2JB 2H92A 3CZPA 3CH4B 4LJ5A 3BE4A 4TQAA 2ZANA 2OXRA 5EUMA 4XD7D 4JBWA 3CNOA 4JVSB 3DZDA 3NHBA 4W9MC 2IYZA 1W1WA 1XPRA 1PUJA 2XJ4A 2JDIA 4MKIA 1P7CA 4Q4AA 1T0HB 2HF9A 1DG1G 1GL6A 1WDTA 5TY0A 3O47A 5KDOA 3NBYC 5J40A 3TW4A 3W5JA 3GLIB 5BW8A 1X3SA 1KSJA 5DLQC 4TWZA 1F48A 1C9KA 5DN6D 4N1AA 1K5DA 1HURA 1JECA 2FFAA 2ZI9A 4BPBA 2X2FA 1QVAA 2JLSA 2K5UA 2PT5A 3O8BA 3IPXA 4DEXA 1R10A 2G77B 4Q9IA 3NH6A 3KQKA 4LUCA 1CEEA 5ANRB 2YNMA 1QDEA 2AK3A 2ZJBA 3IILA 4EFLA 3ZZTA 4EFMA 3SFVA 2VSFA 3TMKA 1ZU4A 3K70D 1JQJC 4DCVA 4ESHA 1RZ3A 2FG5A 4Q4HA 4X8HA 5F3WB 1TUEA 4AKHA 2AD5A 1TF2A 5CJ2A 2OFWA 3U3JA 1FTNA 1GWNA 2C99A 1N5JA 3DDCA 1DVRA 3V9PA 2FZLA 5H8WA 4PZLA 3LQQA 3LAWA 3R7WA 4A1FA 5EP4A 5TV2A 3MLEA 1NLYA 5HKKA 4C0HA 4UQOA 3B82A 2QROA 4JBXA 4KHZA 3MJRA 1DARA 4TLEA 1XEFA 3WMGA 3A1TA 5FFMA 5HCNA 4DLYA 2ZJ8A 2HYIC 1ZUHA 4E07A 2Z6VA 4NKRA 4LYHA 4RFVA 3SOPA 3W6PA 5TVKA 4KCGA 1FZQA 1MV5A 1QHGA 4C0SA 4OHZA 1T3HA 3BFVA 2LKCA 4OQXA 4B6FA 2FEMA 3B9QA 5JJLA 1E0KA 2BM1A 1AGRA 3QG1A 4YDHB 2QPAA 3B85A 5FUXA 1IN8A 2REXB 4KI0A 4RD2A 3IIMA 3KB1A 5FL3A 3HYTA 4LJ8A 1GFIA 4OJQA 1YR8A 4RZXA 4DIEA 5LD2C 3OEEA 2OFXA 3U44A 1TQDA 4Q03A 3U7GA 3VKHA 4B34A 4KJZA 2P6RA 2A78A 1Z2AA 5AJXA 1X1SA 1W48A 1VCOA 3K0FA 4P32A 4CT4B 3D7MA 3LD9A 3GCGA 1P2VA 2REOA 4XWAA 2UZIR 5DH9A 3I5XA 1X6VA 2WBLC 3AQ4A 4IEIA 5KSZA 2BVNA 221PA 2NO9A 3ZYCA 3VR4A 4EKDA 3IQWA 3N2EA 4Q9KA 1KDPA 3NG1A 4FCTA 2WZQA 2R8RA 1M7HA 1E2EA 3LA6A 1KK1A 3WNDA 2J87A 1CKEA 2PMKA 2CCKA 4QBFA 4RCZA 1WMSA 4H1UA 2HYDA 3DPUA 3QENA 4LV8B 2PMDA 2PBRA 4NYMQ 4D4JA 1C4OA 3WNCA 3SI7A 3HR7A 2C04A 4P4UA 1JAIA 2OLJA 4CYMA 1II8A 2HDNB 1ZIOA 2R6FA 2YINC 3KL4A 5J4YA 1G20E 1QG2A 5FUVA 4M4SA 4MYTA 1IXSB 1MO4A 4L5BA 2GAOA 4DT1B 2XXAA 3AF1A 4RD4A 5L3QB 4G5QA 1JQLB 2G6BA 1KMQA 5FPHA 4JKYA 4QM7A 2VSXA 4Q7MB 2CCGA 3OIUA 1CR1A 1E0JA 3X1DA 2V6IA 1J70A 2JLVA 4HUQA 2QY9A 4N0EA 2GZDA 3BERA 4EPRA 3FKSA 1W0JD 5IHPA 3E2IA 1O3YA 4TT3D 1XX6A 3QBTA 4LBVA 1TADA 3Q85A 3EPJA 4A2QA 5JFGA 3CX7A 1OT3A 2NZ8A 4NYIQ 2GA8A 3TUZC 4IDHA 4JVMA 4PANA 2CJWA 4AYTA 5K8TA 1KI9A 2ZVPX 4JT4A 4QJ4A 4U5XA 3NDBB 2ZQ5A 2DFLA 2ATXA 2RGNA 4LCBA 3HYRA 4OQNA 3REGA 4TL6A 5EUQB 3ZQJA 4Q4JA 3HR8A 4QM6A 1R5BA 2RGXA 2B92A 1NLZA 2AR7A 1RFLA 1YR6A 3V4RA 1H8HD 2ZE5A 3X2SA 3I3SR 5KNBA 4AIIA 5E3HA 5JCPA 2DFKB 2CDNA 2ECKA 4PO9A 2OT3B 3K9NA 1UDXA 3R9IA 1FUKA 2GESA 5JHHB 3U7HB 2H18A 1SVKA 1M6NA 3IQXA 3PVSA 2IUTA 3Q5DA 4B3XA 1KSGA 1KZGB 2OBMA 3H84A 2QBYA 3MFYA 4PTLA 1ZVQA 3PEVA 1VG9B 4U02A 1OB2A 3SC3A 4DJTA 3IO3A 3KJEA 1UKVY 2QPOA 1RIFA 2YV5A 3L8ZA 4W7SA 5KU1A 5CLQA 1VCNA 3WMEA 1BIFA 4RKEA 3QF4B 2G9NA 2GEDA 2D2EA 1G7RA 1TF5A 3CRQA 3H2YA 4DLZA 4F4IA 2C5LA 2WWXA 4RD3A 4AK9A 4M1YA 1H65A 2Q21A 3RVBA 4BFZA 3K0EA 4IVRA 3R8CA 1MO5A 3P4XA 2IWRA 4B35A 4BRUA 3T1TA 2ZI4A 4BLOA 3EZFA 1WF3A 4W5WA 1E2MA 4YC7A 4BRWA 1YRAA 2ZI7A 4AYWA 5K8IA 1GRNA 3RHFA 1GUAA 2LKDA 1Z28A 5KPJA 3WBJA 2GCOA 5TB5A 3NH9A 2FE4A 4X8OA 3DM9B 2DPXA 5CDFA 4A82A 2IHBA 1P73A 2OXCA 1HH4A 1TQ6A 5EP1A 4G01B 4PAQA 4G5SA 4ITRC 4LV6A 3T35A 2R65A 4IFEA 3N2IA 3WYAA 2IYSA 5IF9A 1OHHA 1ZCBA 2FEOA 3EASA 1GG2A 1LF5A 2F1JA 4B73A 4I1SA 1SVIA 2ZVQX 2V8OA 2O8EA 3GFTA 1GNRA 4PHTA 1F2UA 1JI0A 5DN6A 3TVTA 1T3LA 1KDOA 2FNAA 3SHWA 4KLNA 1GM5A 1ZCAA 5FBRB 1LF0A 2FU5C 4KODA 2LWIA 3U3KA 4LOAA 3BS4A 2VO1A 5BWMA 1KGDA 2BMDA 4TLBA 3B1YA 3G5UA 1SHKA 2J0SA 4LRWA 3BFKA 2GCNA 5DYIA 3GJ4A 2CNWD 4GNKA 2QAGC 4EQ6B 4LWZA 4ZV4A 4L8GA 2EFDB 3WYFA 4DCTA 5L3SB 1KO1A 4MKFA 3TVDA 3PEYA 4J0QA 1EGAA 4UNSA 1AN0A 1XDBA 1WQ1R 3UANA 1II9A 1E96A 2OFOA 1VG8A 4JZKA 2FDCA 3K09C 1KJYA 4JLOA 5BXQC 1W36D 2ZE8A 2PZEA 5IRCD 4US2R 3VTKA 1OLOA 2ZR7A 3LVRE 2IWHA 4Q9JA 1OF1A 2IW3A 5FI1B 4TN1A 1OJLA 3JVUA 2QTHA 3HPRA 2WKRA 3DO6A 4A9AA 5F9HA 1WXQA 2P6UA 1ETUA 3I8XA 2UKDA 1QHSA 1MABA 4RFSB 4LJ4A 3QPVA 2O8EB 4QXAA 2A5DA 3SZRA 1D2EA 4A0HA 5EP2A 2IYTA 3GEHA 3MWLA 3QEOA 3QY0A 4B33A 2QP4A 3CKLA 1Z6TA 3KTAA 2WPDA 1TNDA 1E1QD 2A2ZA 1GITA 1UEIA 2ODBA 2QENA 2J7PD 2WAYA 2XNDD 3EA5A 5L3RA 3TSWA 2ZREA 4PO1A 1G5TA 4DSOA 2EWWA 2QE7D 3QUSA 2W00A 2OCBA 2YOFA 3FOZA 3FVQA 2R2AA 5JS7A 5E95A 4C30A 3B1WA 1Q1BA 1LW7A 2V1UA 5E7IA 2VPPA 4V02A 4QKQA 3QKRA 2A30A 4B6EA 1NIJA 2CLSA 1I4DD 2IEZA 4JLJA 1D5CA 1FUUA 4K46A 4RD0A 1N0VC 1CS4C 1OXUA 1TEVA 4H1VA 1ZD8A 3OEHA 2WV9A 5D3MB 4PSKA 4FI3C 4AD8A 4D2IA 3CPEA 3KQNA 3VKGA 4FMDF 1EESA 3VU9B 3T1VA 5EE0A 1VECA 3THYA 3T5DA 3U61B 3RS0A 1A7JA 1U81A 3FE2A 4TMZA 2AX4A 3THYB 4FWIB 4IDQA 1D2MA 1VDZA 1P2SA 1XCPA 1OKKA 1W0KD 1XCMA 3KKMA 4Q1EA 1EK0A 4FMBB 2IXGA 3SEAA 1KZ7B 3KXIA 2O8CB 1MRSA 1GIAA 3KJHA 1SVOA 3K0SA 5FBVB 1AKYA 4DB4A 3F8TA 2QSYA 1VG0B 2WJGA 2W6IA 4TLDA 2OG2A 3KXLA 1JEDA 1TU4A 4JLNA 5FOWA 1OIVA 2P2LA 4IW3B 4OHYA 5J4KA 4JJKA 4ARZA 1S0UA 3GLGE 3QNUA 3AP3A 3EPKA 3W5IA 4ARZB 2IUUA 4KU4A 2NO6A 4BLQA 4JKIA 4GL2A 4ZDWA 4F7WA 1AS3A 1ZAKA 721PA 1ANKA 2O8DA 1J8YF 3AUXA 2IS4A 2OAP1 2V55B 3QPUA 1W5TA 2W2XA 1D9ZA 2WOOA 2V4ZA 1XD8A 3TIFA 1DOAA 3NC1C 1WA5A 1JXOA 4NYIR 4V0LA 5GJWC 4D26A 1G64A 5D3MA 5CK4A 2ZXUA 3QOFA 3HU3A 2DWQA 3OESA 4QGGA 2QQEA 1DBSA 1WP9A 4JSYA 1H8ED 4BFVA 1T5LA 3K9HA 2CK3D 1NG1A 2AWNA 2JJ1D 1Z06A 3TH5A 1NF3A 4JT2A 4CRWB 1N6RA 4O2LA 1RRGA 4JLAA 4BFYA 2D7DA 3V00A 5L3QA 3NIBA 1NNEA 4IXMA 2ZYTX 3GQBA 4K8OA 4C4PA 1U94A 1RYFA 3SS8A 1CJVC 3GP8A 3LVQE 3LW8A 3L0IB 4I81A 4PSVA 4YQFA 5HZHA 1TQ4A 4DLUA 1TQ2A 4EFNA 4TL8A 2BBTA 3I61A 5M04A 4KFSA 1T4GA 2YVUA 2QT0A 1XP8A 4POAA 2IS2A 1JR3E 3PUWA 2OO7A 4DLWA 2TMKA 1I2DA 1DO2A 4ABYA 5J47A 3BB4A 2C9YA 1KSHA 3B5JA 3ICQB 1CRQA 3U60B 3MUFA 1QF9A 2NOAA 2O0HA 5FBLB 3I62A 3AVWA 1DEKA 2GXAA 3THWB 3BFXA 2R6DA 5IK2D 4AG5A 1JR3A 4V0NA 5AUOB 3M6AA 1Z0IA 4KYUA 1G8HA 3HP1A 3K09A 1A82A 4B47A 5AUNB 4ZI2A 3GJ6A 1KK2A 4P33A 3ADCA 4CEIA 4OYHA 1IXZA 2ZPTX 1S4QA 3KQUA 1OIXA 1G16A 4WIAA 2OESA 4CZ2A 1PV4A 1XWIA 1KK3A 3LO5A 2PZGA 4HZUB 3TSZA 2OBLA 3LXRA 2C9OA 2FH5B 1IAQA 1Z0DA 4NBSA 3KFXA 2EFCB 5TMPA 1W4CA 4L4UA 4UNNA 2GJ8A 2IF0A 3FFBA 3OEED 4RKFA 3EPLA 1I4LD 4LJ6A 3CONA 2GJSA 2Q3MA 3C5CA 4DUGD 3RC8A 5DI3A 3BH7A 4AKGA 2PLFA 3GEIA 3B1ZA 4YXWA 1FNNA 4URUR 1KI4A 3AP1A 3RS5A 1YJ5A 3MMPA 1G3RA 1W49A 2A9KA 1T8UA 1DAIA 4LBYA 3CO5A 2P67A 2D3WA 4ZI3A 2YJTD 3RDPA 3W3ZB 4FCVA 1MO6A 3CRW1 4Q7KA 1YZKA 4ASUD 2F1IA 3DMNA 2ZJYA 3CZQA 1OXTA 3THXB 4LHXA 1RW4A 4GZMA 1WRBA 5JI2E 3T06B 4HAUA 4KV9A 1Z0JA 3OIYA 1XXHE 3CBQA 1CP2A 3TQFA 1VG1A 1AQYA 1EFUA 1SXJE 1N6IA 3AVOA 5LPNA 3QXCA 1KKMA 1Q57A 3QVVA 1ZM4A 1P75A 3E1SA 3VAAA 2R6AA 2F43B 2VL7A 3EZ6A 1G9XA 4DRZA 2XNDA 3NKVA 4JYCA 2F43A 3C7KA 5DYGA 4MDEA 4Q7LA 1G3UA 4QBHA 2QRZA 4Z51A 4AKIA 1ZNYA 3O8CA 4QJ5A 2DWPA 3QSYA 4CEJB 1PLLA 2WJHA 1AZTA 1EX7A 3DOEA 2ZTSA 3SU8A 3Q72A 5JWOA 4TYWA 1IHUA 3L43A 5DI9A 3UG7A 2QORA 3NWJA 4B2IA 1T8TA 2W6JA 2QZ4A 3AF3A 1G7TA 4Q1BA 5LDDC 3OE7A 1E2QA 4DLVA 1CXZA 3X1YA 3VMFA 1N6PA 3RWMB 4IDNA 1E99A 1NVXQ 2FZ4A 4LI0A 3NEYA 3CLVA 4ZKEA 2B7CA 1NVVQ 4AYXA 4OHVA 2Z4RA 4D80A 4Q1CA 4EQ6A 4KSCA 4M9SA 3A1VA 4EPWA 4S35A 2DY1A 1UBGA 5DISB 2X2EA 3ADBA 5BYJA 5H68A 5FH9A 3B8HA 4AY2A 1E2HA 4OK6A 4ZDJA 4A0FA 2ODNA 3JZMA 2BOVA 2JJ1A 1U98A 3RRZA 1P9NA 3KX2A 4PAMA 1N2CE 4TLCA 3IEVA 1BMFD 4MYUA 1IY1A 5AJZA 4F4CA 1ESMA 4DSUA 2R44A 3K0FB 3GFOA 5DO9A 5JCZA 4PPFA 3Q5EA 5FR1A 1KIMA 2EYUA 2BCJQ 2XSZD 3CF2A 1XTRA 4A2WA 1CIPA 1M34E 4Q19A 1P4SA 3BORA 1COWA 2N1BA 5EQTA 5JECA 3RLFA 1K5GA 4DZZA 4Q47A 4GZLA 3KXKA 2X8AA 4LJAA 2VLIA 4O2RA 3Q3JB 1N0UA 2J45A 4LDJA 4I99A 1Q0UA 2XTZA 4KVGA 4JLMA 5C18A 2G0NA 1RJ9A 2ZE6A 2GBLC 4BGDA 2OEPA 3KJGA 1SGWA 5A4JA 4EIWA 4CGZA 1IY2A 1NMYA 3CR7A 1W46A 2BBWA 2CMKA 2ZRDA 4R2IA 1NL3A 2IYUA 2P0EA 4BFTA 4TMVA 2CL0X 4YMVA 1KI6B 3WHLA 5K8UA 2F9LA 4F93B 2AHOA 1T6NA 1OXVA 4HDOB 2G0TA 4B48A 3GLFB 2D7CA 3BK7A 4QFMA 3RABA 3WBKA 1ZYUA 2CXXA 2WICA 4PZYA 4B3GA 3ND8A 5EZ5A 1KK0A 2CL6X 1SXJD 1X1RA 1VYVA 4FMCF 5CM9C 5C4GB 2RCNA 3DOFA 4NYJR 3RNLA 5KYKA 3GLFE 5BQ5A 1UAAA 2Z83A 4HUQB 2JLQA 2WSSA 1E2IA 2B21A 2HCJB 2RGDA 4HLDA 4LV5B 4B76A 1VHLA 2DB3A 1BO6A 3EIEA 3OZXA 5HE8A 2CE7A 2F1HA 4Z54A 3SJZA 1IN4A 2BMFA 2XAUA 1E0AA 4D81A 3N5CA 2CLCX 3OEHD 4IXNA 5GJBA 2GF9A 4JMPA 5EXTA 3UXMA 4LHVA 4TMWA 2JLWA 4WZBE 1R0XA 5JRJA 3WY9A 5FTLA 2JLUA 1F3OA 4QGAA 1HA3A 4CF7A 3K8YA 1Z6XA 4ACAA 3T61A 1QG4A 3F0TA 3N70A 3TE6A 2ANCA 1N3BA 4OQMA 4PR0A 1RC8A 2VP4A 3MWYW 4HAXA 1U90A 1G41A 4M53A 3SBDA 4A36A 2CVHA 3CR8A 2BJVA 121PA 3SR0A 1X8LA 3K70B 4LHZA 4NDZA 1KNXA 1E98A 3U3OA 1N6KA 2ZROA 4G1UC 2HEIA 4ZIRB 1G4AE 3TUJC 2I3BA 2FPKA 3NC0C 2AL7A 1ZUNB 1G3IA 5B58C 4ZIRA 1FQKA 1XTKA 4Q21A 1DAGA 4C0QC 4RZUA 2AXPA 4HLUC 4PXAA 3T1QA 3EZ2A 2NPFA 3NBZC 2WSMA 4OHWA 5AJVB 1U0JA 2J7KA 2VF7A 4TMXA 1OXXK 2OCPA 3UWOA 2VP9A 5JBQA 3EW9A 1RVDA 2BEKA 3A1WA 3OFND 2NQ2C 3C16C 4QL3A 2V9PA 5EXXA 1EFRD 2GZAA 2H7VA 1XD2A 3U7FB 4Q1DA 2FPLA 1AJEA 2HCBA 1FX0B 3GJXC 2IYRA 2QMOA 5HTKA 4G0NA 4JIMA 1M74A 2JJ2D 3ZD6A 4MUAA 1ZD1A 3LBNA 1GZSA 3H0KA 2QRNA 2WM9B 4HATA 4YONB 1ZM7A 3GJ8A 1P61B 4JJZA 4YXWD 2JLYA 2LCFA 2WWIA 3AVVA 2GJKA 3HU1A 2HUPA 2XOKA 3SDZA 5H70A 3IIKA 4MRRA 2HLDD 4MGIR 2IF2A 5GJVC 1Q3TA 1KNQA 1Z47A 3QF7A 3CPHA 1KI1A 4P3YA 4PSAA 2O5VA 2QUZA 2XZPA 3NEJA 1E2LA 5JWHA 3RS4A 2JJ8A 2H57A 3S1AA 1RE0A 4F38A 1U9IC 3DKPA 1EWRA 1DAKA 4IEEA 2F55A 2HV8A 4C2TA 1IQPA 3QBVA 2GXUA 3QG5A 4CEIB 4D0GA 3R9WA 5KSPA 4FMCB 3LFUA 1OFTA 1Q3HA 4WZ6A 2VBCA 2RGCA 4TQ9A 5EXSA 4EJSC 3PUXA 3ONWA 3FMIA 4IJMA 4XWKA 1T3SA 1NN3A 2ZIAA 2A5JA 2KBEA 2YWGA 3GJ5A 5AUPB 4L9SA 3W6NA 3B7GA 5KHOC 4RY2A 1MT0A 2ZRHA 3IIJA 3AKDA 1DG3A 4XIGS 5G3ZA 2YC4C 2JCSA 1BH2A 3EA0A 5CJPA 4DXAA 5SZHB 2JA1A 5KSYA 4D6PA 4B2PA 4US1R 3K0CC 3UMRA 2C78A 3K0CA 2KJQA 4D4MA 1A4RA 4ILEA 3LBIA 2QMEA 3JZAA 4HLQB 3UK6A 1J2JA 1SKYE 1UADA 4CIDA 2PT7A 4MYCA 3QEJA 4DUGA 3W8NA 3AGQA 2XX3A 3SQWA 3C5HA 4KFRA 4BFXA 2W0MA 1ZP6A 1JALA 2DCUA 3GLHE 3GLGB 2QN6A 1YR7A 1SKYB 2YZ2A 1MO3A 1NKSA 1CTQA 2ASEA 3S1AB 2ZSEA 5JSZA 2IYLD 3D31A 3QVUA 5BN3A 5JJIA 1HV8A 1Z08A 2J59A 1ZC4A 3T12A 2JLZA 1X8KA 4ZKDA 4PQYA 4GFDA 3KKQA 2ORVA 3UMFA 1IONA 1GL9B 4KBFA 4WVFA 4C9BA 1DE0A 4OQLA 2Q0HA 3GLHA 2OCYC 2VTKA 5E4FA 3A4MA 4HZUA 3H1TA 1FL9A 1KY2A 1GAJA 1ZJ6A 2XEXA 5C4MA 3KUCA 3R7WB 1M7GA 4PQFA 2CE2X 4E09A 1IXRC 2CHQA 3WNBA 1KMHA 2GTPA 3BAFA 4XJXA 5CYOA 3IHWA 3OHMA 4XSGA 5TDHA 3TJZA 3GJ0A 4ACBA 1RRCA 1OB5A 3KJIA 4HAWA 3ZVNA 4WXPA 3A8TA 3AUYA 5FUYA 4ASUA 2WTUA 4M9ZA 3CRRA 4LHWA 4EAQA 1EWQA 2ZAMA 4FW9A 2JDID 1OFHA 2BMJA 5D3QA 1NBMA 4KAXA 3IUYA 2D74A 3QE0A 4IFBA 1FOEB 5FOTA 4KSBA 4TQUS 5EE3A 3KQLA 1GKIA 3D6TB 2C98A 1W36C 1AIPA 1HYQA 3I72A 3THOA 4M21A 1KAOA 2E9SA 1ZMXA 2JEOA 2PEYA 3P26A 5A5GA 3EZ9A 3AVUA 1BYUA 3EWSA 4TSFD 4Q9HA 3BB1A 4KBGA 4ON9A 3AB3A 5IT5A 1HEIA 2CNWA 5FI0B 1S3SA 2VEDA 3GJ3A 2ZI6A 1LVGA 2NZJA 1P2TA 2PZFA 3ND9A 5GADl 2ZETA 4Z1MD 1E2FA 4EUNA 3U5ZB 4HLUA 1PVOA 1E79D 1E1QA 1G3MA 2BBOA 3LY5A 3FHCB 4O25A 4M1TA 4Q4HB 4V0ME 1IN7A 2QPTA 1Z8FA 2Z0MA 4JSTA 1GDDA 3DHWC 5DHFA 3D3QA 4TTRA 4KITB 2WWHA 1AZSC 2W83A 3LBHA 4I4LA 3TW8B 4EPTA 3LLMA 1W4AA 3NHAA 4C0LA 4URWR 5B64A 5FPKA 1GTVA 1ODFA 4EPVA 3RAPR 2BDTA 4MKHA 2EVWX 3WRYC 4JYBA 2X19A 1EX6A 4WZAE 3P27A 2PJZA 3ZJYA 1GKUB 1P2UA 4TLAA 2OBNA 2OLKA 2JJ2A 1M2OB 1X8JA 2IK8A 2QP9X 1BS1A 1OHHD 2G1KA 4HI0E 4DIDA 4WA7A 1IBRA 1FP6A 3AF2A 3FMOB 3AKYA 1OYWA 4TYQA 1OXSC 1GVNB 4K81B 1IY0A 2RKOA 1R8QA 5A0FA 3I73A 3TR0A 3OE7D 4HB3A 4IKEA 5AR1A 3MCAA 3PUVA 3FB4A 1SVWA 1S8FA 1M8PA 2ZYUX 1D6JA 2NGRA 2IX3A 4OI2A 1CR0A 2IA5A 2DWOA 4Q1FA 1XEXB 1SVSA 1U8AA 3L82B 2B7BA 4LJ7A 2OZEA 5P21A 3ICEA 2YWEA 1XEXA 2ZI5A 2R6GA 2VF8A 1VCMA 2W0SA 3K9GA 3I92A 4KFUA 2J9RA 3GJ7A 5KOYA 2HT1A 1FQJA 5KNDA 2QEQA 2RGAA 2F7SA 3T1OA 1Z6GA 4JS0A 3PEUA 2ZSFA 2QT1A 3SN6A 2OCAA 2YWFA 4B74A 4IVQA 5JZVA 2QE7A 1BYIA 2C2HA 2IYYA 1WCV1 5FOXA 3VR3A 3THWA 4TZ0A 3IGFA 4B43A 3VHLB 1N5KA 1G8FA 3U4QA 1YZTA 5EJEA 4OK5A 1YZUA 1ZM9A 1GL7A 4U7DA 3M4YA 1S9HA 4PC7A 3U4QB 1I4TD 5KPDA 4HSEA 1JR6A 1Y63A 4DDUA 1KI3A 1E2NA 5G40A 1KI6A 4BFWA 1NJGA 1II8B 2IS6A 4DWJA 2QAGA 4LYAA 1LB1B 1COWD 3M1IA 5J4VA 1G8GA 5FL7D 1Q22A 1G17A 4A6XA 2OE2A 1E1RA 2Z4SA 4OBEA 4MITA 1Z83A 1L4YA 1V5WA 1Z0KA 1ZIPA 4AC9A 3LXXA 5IK2A 2F1RA 4NL4H 2QP3A 5EZ6B 4JLKA 4PZZA 4A8JC 1OKKD 1W0KA 1JJ7A 3P32A 1ELOA 2CVFA 4OHXA 5EXPA 4LJ9A 1E2KA 2CL7X 4Y0VA 2KBFA 1UBFA 2XOKD 4P4SB 2P5TB 4GOKA 3ZZ0A 4M1KA 2QAJA 2YKGA 1Z3IX 4URVR 2NO1A 3UPUA 1G8YA 1HY3A 2DFTA 2X1VA 1NY5A 1U8YA 4MGZR 2W58A 1S2MA 5H1YA 4BLTA 4II7A 4TYPA 4DSTA 5L3SA 1Q1EA 4PFSA 1UPTA 4Z8YA 4ZO4A 3HU2A 2GKSA 1QHNA 2VQSA 2FOLA 5SZKB 1NI3A 2WMNB 2CHGA 3CUEF 3FKSD 1W4RA 4WAUA 4C0AC 3ECCA 4C7OB 2J7PA 3RRNA 3BOSA 1PJRA 3W9YA 4HB4A 4C7OA 3I1FA 2ZRJA 4MRNA 1CLUA 4E03A 4TL7A 3HWSA 4JVLA 2JIZA 3SJCA 4QOSA 2GETA 2XB2A 4NMMA 2UZ3A 4B3CA 2ZU6A 3R20A 1JB1A 2QAGB 2WJJA 2GHIA 4HDCA 5GVRA 2IUSA 2XGJA 1GNPA 2VIIA 2NO0A 2ZUDA 1Z5ZA 1SKQA 1HE1C 3CW2A 5FBWB 3VNUA 4A0GA 5SZIA 1FMJA 2OM2A 1R0WA 2ZRIA 3VR2A 3FFAA 2CHVA 2EFGA 2ORWA 3C4JA 2C95A 2YHSA 3W8RA 1L8QA 2XTNA 2P3SA 3AF4A 1HUQA 1K6MA 1V43A 2IYWA 4GBMA 4DBLC 3PV0A 3FMFA 3SYKA 3RS3A 3RRYA 5JEEA 1KKLA 1Z22A 4NCNA 3UATA 1OH8A 1XZQA 2QTVB 2GVZC 4IOJA 5FTJA 3ZGXA 1HT2E 5KUTA 2KSQA 1H8EA 3GFPA 2FFBA 1GRRA 4Q02A 3U7EB 1G1MA 2OUKA 4MYHA 2YWHA 4MUBA 3QIAA 5DSZA 4TYNA 1UKEA 2EW1A 3ZD7A 4D0LB 3EG5A 1W47A 2HXSA 3VU9A 1DAEA 3PR1A 1GILA 3TKLA 1XXHB 4YLGA 1UM8A 2FGJA 5CIWA 1WE2A 2Q3FA 3OFNA 3V4FA 5KNCA 3A1UA 4LK2A 1XMJA 2AFHE 1CF4A 2IYXA 3TLXA 1NP6A 1XTJA 2J41A 3B6EA 1XZPA 2J0VA 1ZNXA 2PX3A 2D2FA 4GMDA 3MWKA 2VP6A 2BCGY 3A36A 3BC1A 2JASA 1AGPA 2CCJA 1GNQA 2ZJAA 4KYIB 3WP0A 3LH5A 4NONA 2EFHB 1R6BX 3C15C 4FMDB 4YMSA 2I1VB 1EFTA 3KKPA 3KFVA 1E69A 3SYNA 4CT5A 1LS1A 4OI0A 3B9PA 2WPDD 2VYFA 1QVRA 5AK0A 2VSOA 1L2TA 2QU8A 2OSBA 4HUTA 2AKYA 1TMKA 2WJVA 1Z0FA 5G3YA 4S2EA 4QHSA 2J5XA 4WXRA 4ESVA 3EX7C 1X86B 1LTQA 2ATVA 2O0KA 5F98A 4M9QA 2OHFA 4I1UA 1LY1A 1XMSA 3QXXA 5E7MA 2QMUA 1OPXA 4HDQB 3TSOA 2GJAA 3FHOA 3TBKA 2ODEA 4MQBA 3X1ZA 1US8B 3LQRA 3TK1A 4LY6A 2GWHA 4PHFA 2XXAB 4DLXA 2B8TA 5CDFE 3VHXA 1ZD9A 1KO7A 2FA9A 2GXQA 2QM7A 3CIOA 3IBYA 4R98A 1GSIA 4X8MA 5KO2A 3Q7QA 421PA 5B57C 2ZRFA 1SZPA 2ZR9A 3MWJA 4UJ5A 4C0JA 1MR3F 4WOPA 4JL5A 4A8JA 2ANBA 2FJUA 2WWGA 2QNRA 2GF0A 3CWZA 1IJFA 2QM8A 2V54A 2KI5A 1G6HA 5FTNA 1NRJB 1R2QA 4PC6A 3RYTC 3UMSA 1OSNA 4NP6A 4LBWA 2J3EA 4A6PA 2REBA 3F5FA 4ZCLA 3QKTA 1XF9A 3E70C 3SJAA 3I4LA 2FGKA 4MH0R 4QGHA 1R7RA 1XNJA 2WMOB 3OAAA 3EC1A 4V03A 5AUQA 4V0KA 4Q4JB 2DR3A 3DEFA 3B1XA 2MSCB 2VHTA 5AWFC 4RZ3A 3EARA 2ZJZA 4QNRA 2N46A 1F60A 4XD7A 1JEEA 1ZBDA 1BOFA 2J46A 2MSEB 2PCJA 3ZIAA 621PA 1DAHA 1HQCA 1IN5A 3IEUA 3ZH9B 3ETLA 6Q21A 2NTYC 4UJ3A 2RHDA 1KYIA 1SXJC 5BYKA 2ZI3A 4A4DA 4Y0AA 2R9VA 4G5RA 2V7QD 2YYZA 1UKZA 4DT1A 4GI7A 1W2GA 1KOFA 4B44A 2RB4A 2F3TA 2GZHA 4L15A 4PO8A 1YVDA 4G5GA 4L9WA 5TXGA 1E1RD 1Q20A 4RJLA 1FX0A 1Q12A 2CK3A 2QGNA 4XTRA 5DI3B 3LWNA 4BEJA 3A6PC 4GMXA 4ZCMA 2QL6A 3FPAA 4NE2A 4A8JB 1AKEA 2V7QA 1I2MA 2FN4A 4MRVA 1G19A 2ZJ5A 4DVGA 4EDHA 5BN4A 2O8FB 3B60A 4JL8A 4B75A 3M0EA 5C46F 4Q9LA 3RS2A 2O52A 1Q44A 1XEWY 2SHKA 3WYGA 4UXHA 1CJUC 1ZW6A 3VFDA 1VKJA 2VP2A 1FW6A 1E3MA 5AJWA 3HJNA 5CYPA 3B2EA 5L3VA 1VHTA 4M1WA 2RAPA 1U99A 4URZR 2BC9A 4NHOA 4QRHA 3OIWA 4TTPA 2JGNA 2WWWA 2W6JD 4Q18A 1A2BA 4MRPA 2XSZA 5CK5A 2Z5FA 2WWYA 1W4BA 2RGGA 1VMAA 5ELXA 1EFHA 4UKDA 3VR6A 1E9BA 1NIPA 4TMKA 1XJCA 4QHTA 1G6OA 2L0XA 2VP0A 2JIZD 3CH5A 4QG7A 5FOVA 3PCRB 4DC9A 1N5IA 5HPYB 3L0OA 3Q7PA 1TF7A 1ZRHA 1KI2A 2WKQA 1F2UB 4IOLA 1IJEA 5F2EA 3DM5A 4QC2A 1AQUA 3OAAD 1N0WA 4JLPA 2FX3A 2H16A 3KQHA 1S3GA 1NSFA 1T9HA 3BIFA 2WVJA 4TTQA 2ZITA 3KUDA 4C3ZA 1R5NA 1YRBA 2G3YA 2Q6TA 3QXHA 3CNNA 1N25A 2IBMA 1G5PA 2AD1A 1OH5A 1E9RA 2P6NA 4LX0A 3VR5A 1Q1QA 2H17A 1S1MA 1XJQA 3L8YA 4Z8XA 1UF9A 2O8FA 2P5SA 1UFQA 4IHQA 2IL1A 4MRSA 4BZXA 3EZ7A 1NG9A 4ERNA 1UJ2A 1FPMA 1BKDR 3TUIC 1A1VA 2RGEA 4AURA 3P1JA 4FWTA 5DIFA 3E5HA 3WXMA 4BZPA 1XTIA 3SYLA 4P0TA 3GLGA 4Q48A 1E4VA 3BWDD 3DKVA 521PA 4PX9A 3C14C 4XVRA 1YQTA 1YR9A 4C0KA 2HXYA 2GCOB 4R2HA 2GJ9A 1G3QA 1J99A 4PC1A 1TTTA 2PJRA 1CJMA 2KE5A 2YOGA 4NYJQ 5FTMA 1N6LA 2YC2C 2IXFA 5E7JA 1N5LA 3NBXX 2ZSBA 3K9LA 2C03A 4GOXA 3QXJA 3T34A 1KHTA 1XU4A 4NU0A 3ZQ6A 4FD2A 4D4LA 4YMTA 3WRXC 4RD6A 2ZRMA 2RGNC 4RZ2A 4UNPA 1Q1ZA 4HLCA 2E87A 4Q01A 3CX8A 4KO8A 1JR3D 1KMHB 3ADKA 4BWYA 2XZLA 2Q9BA 5EP3A 1OE0A 1QHXA 3FMPB 3QF4A 4DLTA 2VRWA 2P65A 4LBZA 1KO8A 2QMHA 4LC1A 1OH7A 2W2TA 4G3XA 5HCIA 1M7BA 3FTQA 4TT3A 1YU9A 4CDGA 1QRAA 2FPMA 4UNRA 3QQ5A 5GVSA 4W5HA 1P72A 3A37A 3REFA 3RSOA 3FWYA 3D8BA 4A0RA 4DB2A 3TR5A 2N42A 3IPYA 4FN5A 1RRFA 1XFAA 2ZJ2A 2HT6A 3A4LA 3BH0A 4M1MA 2A5FA 2QGZA 3QKRB 4LGMA 1ZNZA 1TX4B 4NCJA 4D0NA 3GLIE 1XBTA 1YZGA 4V0OA 3RSLA 2E1RA 2AN9A 2BKEA 5GJCA 5DGXA 2Q9CA 3EWAA 2QI9C 2ZS7A 3K1JA 3CPJB 2A5GA 3SJBA 1YZQA 2ZRPA 1ZUIA 1QHHA 3HPQA 2A7QA 1CR2A 1D8TA 1SXJB 2PX0A 4GOJA 3GLIA 3VQTA 1VTKA 2O8BA 1TEXA 5FPSA 4R9UC 5HZKA 2QG6A 5G41A 4MDFA 2BKUA 3G82C 3PUYA 1B0UA 4LHYA 3GD7A 5SZJA 1MKYA 2JAQA 1S96A 4NTZA 4CEJA 3AKCA 4OK3A 4P31A 5FUWA 1VYTA 2ZS9A 1T5IA 2EFEB 4PHGA 1FNMA 4HB2A 1CU1A 2HLDA 4Q1AA 4OI4A 4BFUA 1RJ9B 2D06A 4WBSA 3GMTA 3K0AA 3AH8A 3CNLA 1KAGA 1NLFA 1SULA 2D62A 3BJIC 2WAXA 5LB4A 1Z29A 5FOSA 4RVCA 4XTCS 5DE3A 2QSZA 2XJ9A 3PXGA 2EQBA 1MH1A 5J4HA 5CB8A 1MRNA 3KKNA 2ZRKA 4LC0A 4EJSB 3ZZUA 2DYKA 1E0SA 4OJKA 1XMIA 2ZRCA 3BB3A 2UVQA 4FXPA 3P20A 4C2UA 1J7KA 3OIVA 2RH5A 1DADA 2BJWA 1QZXA 1TL7C 4XSHA 1XPOA 3TGPA 4B3DA 2ZR0A 3PEWA 2WJIA 2C9CA 1F5NA 1UBEA 2G1JA 2VA8A 3U2QA 4Z1MA 2NPIA 2ONJA 1R4AA 1DAFA 1XXHA 4GRAA 3F3YA 1XRJA 1US8A 1U8ZA 3LLUA 1SXJA 1NY6A
chains in the Genus database with same CATH superfamily
4FFSA 2IHYA 3AKEA 4YV1A 1LNZA 1GN9A 3H99A 1X2BA 4CVNA 2DBYA 1RRPA 1T5DX 2FF7A 2IGBA 4JLDA 1UMBB 3A6KA 4H18A 4JQZA 2FKAA 3GMSA 3A4NA 4FQ5A 4N0MA 1TUGA 1CJKC 4QHYA 1E2JA 3V34A 2J3QA 3PFIA 1OYYA 2YXEA 2G83A 3UZUA 2FFQA 3CJRA 4HYYA 4LTNA 1F12A 2WZCA 4KQ6A 4M46A 1T8PA 3UWSA 2YMQA 2ZU0C 1XCOA 1FTWA 3BILA 4O4HB 5ICCA 4NARA 3IPRA 3WI7A 5GM2A 1MZVA 4GI3A 3CTMA 4M3NA 4UBNA 4ZDKA 2Z08A 2A9JA 4RJJA 4W9NA 5IC4A 1JG4A 2YHIB 4QQ8A 3ZJVA 3C7DB 1EWKA 4QOJA 1GLNA 2C3YA 3F47A 1U2SA 2BWJA 2XZTA 4E51A 2CKDA 1KO5A 3BTUA 5DNCA 4CMBA 1TZMA 3H9GA 4F6LA 2J09A 4PC3A 1CRPA 4ZAWA 1EVZA 1BRTA 3J81k 2FPPB 3TZEA 1RQXA 1TQ8A 4ID9A 5FOUA 4UUOA 2HNBA 2IT1A 1SC3A 1AV7A 2J9GA 2QTTA 3DLPX 5FTKA 3U5TA 1EA7A 3LX5A 4FIDA 1D4AA 3X1XA 5J3JA 1OV4A 1Z7WA 4U9IS 3TRKA 1H4QA 3NHKA 4ARAA 2Y1LA 3DE0X 3JQGA 3LDAA 5EKSA 2AOUB 2NT4A 1LNSA 3PEFA 4P4SA 3CUSA 3R76A 4JJ6A 1L7EA 1JBKA 4YCMA 1R6DA 2VUUA 2PUCA 1T4MA 3UUEA 2IYQA 1ZD3A 3ESQA 3RC3A 3VYSB 2IYVA 1XJ5A 4QDKA 4V39A 1A9ZA 1F8FA 3G8AA 4AG6A 1E94E 1WUKS 2Y93A 3HH8A 3OETA 4D74A 4IOMA 1D09A 2QRLA 2RK3A 4PLFA 1VB5A 3G23A 2ZM5A 4CR7A 1QAMA 2IDZA 5EE1A 4FS3A 1SXHA 4N3NA 4FZRA 1QQBA 3JVVA 4J1QA 1WXIA 1WCXA 2V65A 4K9QA 2ZRGA 2R5WA 3E7DA 1NGSA 3JPYA 1OW3B 5EWJA 3I2YX 4YP1A 3B3AA 1R0SA 4NBRA 3GHHA 3LBYA 4RQAA 5TMDA 4B31A 3CUYA 2WFAA 1M6HA 2AK2A 2H4XA 4L28A 1VMIA 4ZQEA 4EM6A 2PXHA 1R74A 4F92B 3DV0A 1Z6YA 4A8HA 1U3GA 4EI7A 4YPFA 3OEYA 3DXFA 3ZWKA 2J3DA 3BGWA 4UAGA 1NBEA 5H4HA 4HT3B 4DYDA 4I50F 4LXIA 2PL3A 2ZUCA 4KIFA 2IIBA 4RPCA 4YRTA 2FYTA 3S1SA 2ZIWB 5A4KA 1D1PA 4MO9A 1LRLA 1HDZA 1VIVA 3U3DA 3QVJA 2IEDA 2H1VA 2UYCA 1N2CB 2HPVA 3RANA 4PLVA 4XCQA 2XBMA 4X8LA 1W2HA 4Z9XA 4J7XA 4UOEA 1YQUA 4QUJA 5K8VA 4KR0A 4Q3OA 1YGYA 5KDDA 2B0JA 1YB2A 3LX4A 4NCIA 5LQMA 1KEZA 2JGRA 3TNFA 3RUPA 3R9XA 5DX1A 2WQ7A 4CFYA 2HMVA 4BEVA 4PONA 3WK9A 1YCDA 1IEVA 2AMJA 4G85A 2H5IA 2V7UA 3KTOA 1F9EA 1NBWB 3QKSB 1NF8A 4MUKA 4N9WA 5LOVB 3SWWA 3ERCA 3GEEA 3GNSA 4DR6B 2NUAA 3OC0A 2H54A 3GBSA 1NR1A 1UK8A 2WJWA 3E48A 4GT1A 4Q4AB 4BNFA 4ED9A 5LOVA 4E5UA 5GMOA 3ESRA 2BIFA 3A6EA 1Y3AA 4O2BF 1KYWA 3SKYA 3DDUA 4KQHA 1X1CA 5EFZA 1CIVA 4P84A 3WLPA 3BMNA 4I4IA 2GBPA 3THXA 1IN6A 2C96A 3GJZA 4U5QA 4YUVA 5JHGB 2INGX 4EH1A 3IVCA 4ID3A 2UUAB 4HTFA 3L7NA 1BU8A 3FYCA 1FE8A 1P1IA 2YDXA 3IAM1 3B6ZA 1K97A 1O94C 1JW9B 2EW2A 2Q3LA 4E5PA 5I9SA 3DMFA 4LYFA 1PLJA 1T4CB 4E13A 1QLWA 3KSDO 1CZRA 3HDTA 1ORWA 3D6UA 3JZIA 3PNKA 4WBNA 4QIHA 1YHYA 3E7PA 1M72A 1G18A 2B4KA 4M1SA 3HHPA 5AI9A 4ZAZA 1UUFA 4E88A 2WOJA 3B13B 3R7AA 3WP1B 1SU6A 3AGPA 5LVAA 2O2EA 3AT1A 2XVAA 4CMEA 1NZJA 2QTBA 4I4TB 4B4WA 3NEAA 2BGRA 1QYRA 1RQRA 2H3HA 3GZTB 1QBKC 2YOHA 3QXSA 3RIYA 4DMFA 1A96A 3CUKA 1GZDA 1I10A 5ESXA 3T0FA 5KC9A 2Q9AA 2R8EA 5JDIC 2XF8A 2PSHA 4F8EA 5TARA 3P9SA 3WLHA 1C3JA 4Q7JB 4DL9A 3DCNA 4JA2A 3L9WA 4GPIB 2QRVA 1BNCA 5HUJA 2D0PB 2QA5A 5TPWA 3RARA 1NVWQ 3IUMA 3SIPA 2HEGA 3T3EA 1OGIA 4BGVA 1PSZA 1XJ0A 2QRVB 1L5HB 3E9MA 4DF3A 4O63O 2Q2WA 2P1DA 2ERCA 2IDKA 1QTIA 2XEDA 2IYOA 2XTMA 1L5HA 1O0CA 1UDRA 3OX4A 4FFPA 3AJAA 3CZRA 3EEBA 2XECA 5B4VA 1AK2A 2FPSA 2X7XA 3K1YA 2JHFA 3HFJA 2GRUA 1K66A 4FFMA 1C81A 4S12A 1JA9A 1Y7LA 2H85A 3MRSA 4MQ4A 2HJHA 3A1DA 5LYYA 3DJFA 3PLAE 3EXG2 2IJGX 1JG3A 3C6BA 3CC8A 4GP6A 4HEQA 5ED0A 4Y2TA 1GKYA 5B53A 4I8XA 3S68A 2ZYVX 3WLFA 4D3ZA 4PWYA 4R7TA 3O4GA 3UTDA 3ROKA 5JJKA 3EVBA 4OU5A 1ZGZA 3V4OA 3WRWA 1NOIA 5DYTA 4ZCTA 1OC4A 1X38A 3MF4A 4G9EA 3PRKE 4QECA 4AXBA 3LUDA 1SXIA 1GPDG 2I4RA 4KXQA 4NHEA 4RA9B 1LWOA 1IDN1 1U1DA 2AJDA 2A1IA 2VJOA 4HNGA 3HDJA 1XXLA 1Z0AA 4LYJA 4N7RA 1G9TA 1JPJA 3OWXA 4KLZA 1ISRA 2JJYA 2WIDA 4IIJB 5EE5B 4XI9A 3U26A 4IDPA 2XCRB 4EHKA 2FSHA 1EDEA 2MR6A 1G291 1YMVA 3GLHB 3IHLA 4KUGA 4PC2A 4RFSA 3WMFA 2CJWB 2FSGA 4YLEA 1T9CA 1E9CA 4U9UA 4WKNA 3G2KA 3AV0B 5HE9A 1E9DA 1E9EA 4QBGB 2F9MA 4R2LA 3PL5A 2ODAA 1LNQA 3AW9A 1MAUA 2BFBA 3IDOA 4BUJA 1EXDA 4JI7B 3TAHA 3GH1A 2PAAA 2XUDA 2NZVG 4P4GA 1IPHA 5D01A 2OORA 1U3CA 3NVAA 1FU8A 1TMGE 2AJ8A 1O6CA 2ORED 1NVAA 2OV1A 4J43A 1PFVA 5IUNC 5K8CA 3LOUA 3TRDA 2E4YA 1YC5A 2BFCB 3N0VA 5D85A 5E9JA 4YRAA 2J0QA 2RC6A 4P83A 3Q9LA 2IIQA 3UJDA 4DADA 1QPGA 1GV0A 1MJ5A 3UIEA 2O57A 3L7AA 2HWYA 4RZHA 5DK6A 5K6RA 1DTWA 3MT0A 1RLUA 3EMVA 4ITUA 3AEKA 4IVNA 4MP3A 2AC4A 3T15A 1EJ2A 1ZUNA 5LD2B 2YDYA 4E94A 2IX9A 2PGOA 2GZ3A 5HKKD 1H0HA 1QHIA 1G5RA 3ASZA 2JLXA 2AIRA 3OLXA 2BFDA 4Q5IA 2Q6VA 4W1RA 4CEHA 1ILEA 3B1VA 3N53A 2OB1A 1C14A 1QHHB 5KSOA 3PQ4A 3D4BA 4Y6PA 3C3PA 3WB2A 3WIOA 1B00A 3MAAC 2JEZA 1DELA 5K7SA 4KPYA 1ENYA 1T13A 3E0QA 1ZO8A 4C0WA 1D9XA 1GAQA 1UMDA 3DHEA 2C8VA 1G8AA 1TKRA 4DIFA 2D5LA 3PG5A 4RXMA 1TM7E 2XDQA 4ARIA 4XIIA 4C03A 4YRCA 1KH3A 2XVYA 1ZCFA 2ZQYA 3D4LA 5K99A 3FBTA 9GPBA 4O4JA 3GIDA 2B98A 5AW6A 3TM5A 1JH9A 1CBUA 2CLKB 3Q3HA 3VKWA 2VTVA 2WQZA 2M6LA 2GO1A 5KNLA 4MGYR 2ALJA 5JMTA 4KMMA 1DAMA 1JHVA 3UG6A 2HJVA 3GD5A 1A69A 3DBVO 1OI7A 1QNLA 3D3NA 3LW7A 4G1VA 2JFGA 3TOCA 3R7NA 4BATA 2P91A 2XDAA 1TYAE 4OXIA 4E32A 1WZUA 1YUMA 3WJ2A 1HTWA 1KDTA 4PN7A 4RCVA 3U6KA 1ZLYA 3C3MA 1KI8A 4UUQA 2CVQA 3EB9A 3O91A 1KO4A 1H4VB 1ZSYA 1WVIA 2IEAA 3EEQA 3DMTC 3KYDB 3QFTA 1MB0A 2WABA 3BJMA 4DNOA 1V71A 1IIRA 2X8WA 1ADYA 3UGQA 3UQYS 2ZSAA 3WQSB 4QJ3A 2O23A 4FJ1A 4HAYA 4QUBA 1X1QA 2AF3C 4FK8A 4WBXC 4DMCA 1Q11A 4N9QA 1BD3A 5J9FA 3QELB 4RHTA 1KP3A 4JLBA 1XZLA 2AQ8A 4D3YA 2ONKA 2V59A 2XYPA 3TTVA 4IGIA 2FXIA 2JGLA 5J5CA 1GG8A 3GNLA 5JCOA 3BKXA 3UXHA 5CLFA 2ZB3A 4H6XA 1U3VA 1EHYA 1ZVMA 1XIVA 4XFDA 1MJFA 1V1MA 1JIXA 3RO7A 2UXDB 3Q41A 2Y0BA 3C1OA 4MA4A 4URXR 2XNCA 1UBCA 1J09A 3CRMA 1EBUA 1N6HA 4Z6KA 4BO3A 2YWRA 4N7BA 1CQIA 1JFVA 1U2RA 3E3LA 3B1KA 2ZB7A 2H2AA 3EXAA 4AMUA 1CZNA 2H1RA 5BVHA 3JY6A 4Q3BA 3NT5A 1VIYA 1XL1A 3K6JA 1YE5A 3RWOA 2HREA 2FWRA 1P1RA 1G8PA 1NN0A 3CH7A 4HAVA 4RSGA 5M5BA 1CJTC 3PXXA 3UBMA 4RIIA 5D84A 4P5PA 1KJZA 2G5PA 1PFQA 2GNOA 4L16A 4L6AA 1AF7A 2VPYA 2XT6A 5CITA 5C8DA 4X3OA 3RNOA 2FWBA 2YNMC 2H4YA 4MVJA 5HJ7A 3BF8A 1K8RA 2XB4A 5BT9A 4G41A 5BN1A 1SVNA 4JX8A 4YJ3F 4EYSA 3OFJA 1J1IA 5J4LA 1I1HA 2WSSD 3U7QB 1FFHA 1CVRA 3DTNA 1Q16A 3MWDB 1H6BA 2YYSA 1W59A 2NUPB 5FAKA 4IMPA 1UOEA 3VZQA 2AN1A 2P2NA 2DY0A 4Z0NA 1IXYA 3VPBA 4P22A 2VDWB 1S9DA 1SFRA 4WZAA 4BJ1A 1GRQA 3UBTA 1T0UA 2PO7A 4C88A 4WLOA 1ZXLA 4R54A 2JFQA 4PGFA 5I7HA 1VQ1A 5JAQA 1J8DA 4L50A 3O8DA 4PRLA 3LE8A 3R5FA 2DKNA 1E79A 1S2OA 3BUSA 1THMA 3DNMA 3KHTA 5DBEX 3F6EX 1R8SA 2ZEJA 3G2HA 1YS4A 4KTTE 1WY5A 2HD4A 2XCSB 3FGNA 4NICA 1E6CA 2NAFA 1L8OA 2BRUC 5IJZA 4GZ5A 1QMGA 3DB2A 2QX8A 2EAUA 4N4AA 1ONBA 1I5EA 2W6NA 4UCXA 5D1NA 5KYXA 5FNVB 2LTAA 3UCFA 1PUIA 3OJ0A 4X1YA 5C32A 3TAUA 2A5YB 3PC6A 5IT4A 1A7AA 3DBOB 1T1GA 3KLNA 4V3BA 4ZQIA 3W9BA 4CG3A 4EJ6A 3UJCA 3BT7A 5SYAA 1FY2A 1I1NA 3IEMA 3AVXA 1Y0BA 4LC9A 4QJIA 3DVSX 3Q15C 2O0JA 5LBIA 1ZU5A 5C9ZA 4W5JA 4S1NA 5EE9A 4CR6A 4BE7B 3KEQA 3IYLW 1GFWA 1WEKA 3DP9A 1SA0A 1ZSNA 3NHRA 1FFWA 3T9DA 3PQ5A 1IZYA 3CZPA 4LJ5A 3WGTA 1R6UA 3E5RA 4TQAA 1EWVA 4QODA 4Z0TA 4HWKA 2X0JA 1P2GA 3WX0A 4D9MA 1SKBA 3AOGA 2VZ8A 2GKOA 4TZTA 1PR4A 1T3TA 1CJSA 2W7TA 3CNOA 4ZD6A 4B5KA 1PUJA 2YZGA 3T9AA 5CEEA 1DQZA 2QDXA 5MFZA 3JQAB 2N1MA 4GRIA 1A3CA 4ZANA 3BGSA 7ADHA 1YJAA 2HF9A 1WDTA 1IMOA 4FHEA 3TEFA 5FUMA 2QBYA 1EFVA 5ICFA 3O47A 5TY0A 3TW4A 5J40A 1AQLA 3W5JA 4F2HA 4DLPA 4MWOA 2W93A 5DLQC 1I5RA 3H9EO 3VHXB 1WOMA 4UUNA 5I01A 4N1AA 2VCEA 4DLLA 3KQQA 1JECA 2FFAA 2VDNB 2ZR8A 3ZK9A 2QLMA 3P2EA 4KR9A 1PVVA 3L04A 2G77B 5BSKA 3HUDA 3NH6A 3QNWA 2VUIB 1LU9A 5AW1A 5FBHA 3P2JA 1M1NB 4EFLA 3QWHA 1ZKDA 4OQEA 4BV3A 3K70D 3KFLA 1YIAA 1JQJC 3R1IA 1ZJ5A 2HM7A 1P5HA 4HNAA 4Q4HA 4ZAYA 4D41A 2VT6A 3GIWA 3AIKA 4U4AA 4DQDA 5JZOA 1TUEA 1AA6A 2ONCA 4WN9A 3RVMA 3UF0A 2OFWA 3E1GA 3NKLA 4F1WA 4C1NA 2Q3DA 1EFPB 1JG7A 4B81A 2C3OA 2FZLA 3IS3A 3LAWA 1RC0A 3U7RA 1XVVA 2ZYDA 3M9WA 1N1MA 4XLLA 1PD1A 3G9ZA 4LMBA 5CT6A 4YHBA 2G7MC 2NV2B 4ZQFA 5E0KB 1C7JA 4M0MA 4C0HA 4BMVA 3ZDZB 1DKUA 1MX3A 3ILSA 1BJRE 4C2AA 4EB3A 2QROA 1KFJB 3URMA 1Z74A 4DMRA 1O4VA 3MJVA 1XEFA 3ETGA 3NV9A 4DM3A 3P2OA 5KOIA 4O1HA 3U09A 4PFKA 3UJ7A 1V3QE 1YZ3A 4MUXA 1GUBA 1NATA 1MV5A 3VU8A 1SHTX 1UJBA 4N6OA 3A0UA 1T3HA 4OQXA 3CSSA 4MO2A 3DZKA 4GUAA 3RC1A 4FR0A 3RGWS 2FW8A 1E0KA 1U9CA 2BM1A 1UC4B 1JEOA 2QL9A 3M6MD 5THQA 3ETJA 3QG1A 3NGLA 3ZQUA 4YDHB 1SKMA 4I6JA 2QPAA 3B85A 2QLTA 1IN8A 1EGQA 1VDMA 1Y7HA 2F59A 4V38A 4MIYA 3ZE7A 5DTMA 4JA0A 1OVMA 1HGXA 1YR8A 2IOFK 3DBHA 5LD2C 4H7IA 1T4CA 2B36A 4ZHQA 4I8DA 1EWTA 1GQQA 3F4LA 2PX6A 3TS1A 4AJHA 4ARVA 5AI0A 3V4SA 4HX9A 2A78A 1ODJA 3JWHA 1KJ8A 3K2BA 1O57A 5CT4A 4UHJA 2C1ZA 2OCGA 3CNBA 1MLDA 2O2ZA 3FYUA 2XVMA 3L7JA 4LSWA 1ONOA 2A1TS 3DO8A 2REOA 1Q2XA 2UZIR 5DH9A 3DEYX 5BV1A 1Y81A 3I5XA 4J9UE 1B7GO 4JQOA 1X6VA 4UM8B 3T3GA 2Q1WA 3AQ4A 3ZK7A 3E9NA 3N58A 3VR4A 2Z5GA 3E2PA 4EKDA 1N34B 1SWVA 4R1UA 3D59A 4Q9KA 4E3ZA 1KDPA 3KOYA 4FCTA 1M7HA 1E2EA 3EXG1 1CK4A 3L7DA 1KK1A 3F9IA 3P4UA 4ITVA 4FM9A 4DA4A 4M83A 2J87A 1ZH4A 3LL7A 4QBFA 1HDIA 4LJLA 5FULA 5LZ7A 2GK3A 2HYDA 3AR6A 3DPUA 3QENA 1J9ZA 1FFXB 1NFFA 3FFTA 4H1UA 3W8EA 5HJ5A 5I7UA 4NYMQ 2PBRA 3A1EA 3ICVA 3RFTA 4D4JA 1MB2A 3EYWA 4LZJA 3WNCA 1VJ1A 4RH0A 3L46A 3DCIA 3V2UA 3SI7A 4MIOA 5BR4A 2OHJA 4WLEA 3WFJA 4BLVA 4EEXA 2GD1O 4QA9A 1JNXX 4AB1A 4MVJM 4AO7A 2I4TA 1U0EA 1ES9A 2AX3A 2V7EA 1KOGA 3PICA 1YS9A 3D4PA 3T5PA 3ELDA 1AVTA 4EUKA 2Y2UA 5C80A 5LKAA 1U4OA 4MULA 3WE7A 3WWYA 4C06A 3GVHA 2AN5A 2YASA 3R41A 5KHAA 4DT1B 1AH2A 1YB5A 1DT5A 1P1BA 4RD4A 4D9FA 2WE7A 2JH3A 3NJ4A 5L3QB 1IVSA 4FR2A 3AYZB 3C3CA 4JKYA 4E6EA 1QP0A 2C4NA 4QM7A 3LWDA 2ZBQA 3U48A 1JPVA 5E6UA 1E0JA 1GO2A 2V6IA 1ZUWA 5KJCA 4EYQA 1PS8A 3K9QO 3SSAA 2GZDA 2B3TA 3EHEA 4BJHB 1H93A 5ED4A 1E1CB 3F96A 4TT3D 5IS2A 3RVDA 3QBTA 4ENQA 1DDIA 1ND5A 2AJTA 4JQSA 3WMXA 4BJ5A 4DAOA 4CN8A 4CDMA 4BQFA 3CX7A 2KM1A 5JFGA 3JRWA 4DMLA 1OWOA 3UYLA 2GA8A 2Q5IA 1Z12A 1KJJA 3KLMX 5AM5A 2KLBA 2CJWA 4H16A 4CJXA 4DJFC 1GTMA 4KK4A 4B8ZA 4GR4A 4NVRA 1OAKA 1JUDA 1USKA 1DAOA 1B15A 2C8KA 2ZVPX 2OENG 3BCSA 3EGVA 3PZBA 5K3OA 2QRHA 2VN8A 2ATXA 1KQNA 2A1UB 3PX2A 3M81A 2QGFA 4LCBA 3D1JA 1MAAA 3KETA 1QHEA 2Z2JA 1FFAA 5BSEA 3IV9A 4EZEA 4Q4JA 3KQWA 3GDOA 2RGXA 5CW2A 1JTFA 4IILA 4RWZA 4WL0A 1WL8A 1V26A 4MS4A 1X1AA 4PX3A 1AV6A 5JSQA 5HOEA 5KNBA 2PGDA 5L9AA 4PO9A 2ECKA 4I9FA 2BGWA 2D0DA 2QJOA 1UDXA 3K9NA 2VJLA 4IJUA 3RFUA 3CLTC 3V80A 2H18A 4EB8A 5JHHB 1CY0A 4J0FA 3T3PB 3UEOA 1M6NA 3PVSA 1RXIA 2IUTA 4TKUB 3BDAA 1U2DC 3DLCA 4B3XA 4TTTS 3WGKA 2AE1A 2VHZA 3B36A 4H1TA 3MFYA 3DBRA 4PTLA 5AVRA 3NYIA 3JQ9A 4MVWA 1Z35A 1WHTB 3KJEA 1UKVY 5ADHA 2YV5A 3RHTA 3NXKA 3ZWYA 5G0TA 2H5LA 2PKWA 3L8ZA 4EG8A 2BRUA 1SKUA 3S55A 1BIFA 1OFGA 1QK3A 1XCJA 2FN7A 3KJFA 3QF4B 3C1AA 3DBIA 1DJNA 1QG0A 2D2EA 3DF7A 1K7CA 1ZVJA 2QTCA 3QYFA 5KYNA 2C2ZA 1TF5A 4LSZA 1TA9A 3CRQA 3H2YA 3IQEA 4GWKA 2OQIA 4IH1A 4F4IA 3IAXA 4BO4A 4AK9A 4M1QA 3UENA 2UYGA 4PXSA 2Q21A 4J4BA 3D6NB 4KLCA 1ULSA 3PXAA 5HIMA 1FU7A 5ILGA 3Q1LA 2V4UA 3NTVA 2V97A 4FXOA 5F7JA 1KRHA 3W2FA 4AZTA 3ZH2A 2ZYGA 1LK5A 3GZJA 4Q3LA 4MHSA 3TJRA 4BLOA 1JIVA 1KARA 3EIXA 5BP7A 1YTLA 3ABZA 1E2MA 4W5WA 4BRWA 5CXUA 4LRUA 4AYWA 2JGKA 3D1LA 3C3WA 1BXKA 2A9PA 5IMSA 3SF8A 3BTVA 1AZWA 1BVYF 2A9QA 4YVFA 5D1HA 3NH9A 2FE4A 5DCYA 4JP8A 1GTSA 2EC5A 2ZAGA 3ZNNA 1H9CA 3DM9B 5T3UA 2DUJA 4PRZA 1E5LA 4K26A 1TQ6A 4BNUA 1Q0TA 3KQTA 4PAQA 4QOEA 1KY5A 1UDBA 4K6OA 4PTYA 1ADBA 3IHKA 4ZVOA 3OM9A 3GL9A 1ZCZA 4IV0A 5HBGA 3T35A 3WYAA 3LZDA 5BR7A 5MGBA 2GPWA 4IRXA 2IYSA 1U2DA 5IF9A 1OHHA 1ZCBA 4X1OA 3S6JA 1RLJA 1T6XA 4L5IA 3IX7A 4B73A 2F1JA 3WSTA 5DGDA 1SVIA 2CLOB 2V8OA 3PS9A 4B17A 3GFTA 2ILVA 2PXCA 4XDHA 4PHTA 2HNKA 3KO8A 4CKBB 4TTIA 3LIIA 1KGSA 4UU7A 2FSSA 1LW6E 1CB0A 1SOVA 2VAMA 3GUYA 3NASA 4KODA 1JG6A 4R6XA 2LWIA 4YRZA 1QQAA 1J06A 3O94A 2VDKB 2VO1A 2M2IA 3BWVA 4RVHA 4YUYA 1N9GA 5ES4B 1Q7GA 3ABOB 4TLBA 4FZJA 2DH5A 2J0SA 4F0JA 3WYBA 2E5LB 5AICA 4DABA 1P7WA 3GNQA 3DPIA 2XRFA 1C9YA 3DNFA 4M99A 3N3BC 1PL6A 4BKMA 1WB5A 2CNWD 4NFYA 1RXUA 1U11A 4GNKA 4MPJA 4B6PA 4L8GA 5KKAA 2IOFA 1PBNA 1DIHA 4YRRA 3TQRA 1CETA 2F00A 3TVDA 3V4LA 4AVYA 3A10A 2QRQA 1Z4MA 1XDBA 1BOOA 3G5TA 4D02A 1TM5E 2VPTA 3QV2A 3S0JA 3M8KA 3W5UA 2AVNA 4JZKA 2ONYA 4QRIA 2X5JO 4X94A 3DLTA 3SG0A 5BXQC 1RM4A 1W36D 3HC7A 2PZEA 4UBMA 3MJDA 4J1SA 5KIAA 3KUUA 3VTKA 3TSCA 2NUPA 2ZR7A 2I1WA 1H5NA 7ABPA 1AHIA 1W1IA 2IW3A 4AQYB 1ZJWA 1OJLA 1P5FA 2N0SA 1YD7A 5CLHA 2WKRA 3DO6A 2JB9A 3M5WA 1W30A 3VVMA 2GEFA 3AR9A 4GBGA 4QLOA 3R3ZA 4EYKA 3ANYB 1UMBA 3UUWA 2CJFA 1JDNA 2R1VB 4QXAA 3FWHA 4CQLA 2CVPA 2IYTA 4HNVA 3NU1A 2VUHB 5JH7A 4L73A 2Q8PA 3MWLA 3PE6A 4HS4A 4OEHA 3I37X 4QASA 3QY0A 1LQTA 5KYXB 1J20A 4G63A 5CVVA 2WWVD 5AHRA 2CMHA 4YEDA 4QOGA 2BSQA 1CQPA 1TNDA 1GITA 2HA2A 2HSJA 4LKOA 5AXAA 4RU1A 4R84A 3NATA 2LDBA 2EWWA 4H7JA 4H77A 3R7SA 1X77A 2Q4DA 1SRRA 1QQ5A 1V3UA 2QX4A 4O4IF 2LZ0A 1LW7A 2I34A 3AOEA 3ZV3A 4GKJB 2IZ6A 1UBUS 5I4CA 3CEHA 3LP8A 2VDUE 1FFGA 1W85A 2Q8NA 4XPIB 3BWBA 4K46A 2YN2A 1WD7A 1CS4C 4U7WA 1TEVA 3R6GA 4H1VA 4L75A 4CDNA 5CBPB 2WV9A 5D3MB 1KEEA 4AD8A 4C21A 1GA1A 2LDXA 4FMDF 3D3WB 1ITZA 1D2RA 1EESA 3KL2A 1CY7A 5ECWA 3ZV6A 3VNQA 1KQFA 2Z2KA 3T3MB 1A7JA 4HNQA 1F6DA 1CE8A 1S01A 2AX4A 3TLCA 1NV8A 2X4IA 3IOEA 5BSHA 3FLBA 1R12A 1I8TA 3DEJA 3HNPA 1L5FA 1XCPA 1NNLA 1EK0A 3SHQA 2QVXX 2O7QA 2WM3A 1NW8A 2YJGA 3MBOA 4FMBB 1AHPA 1V5GA 3KXIA 1RMQA 1UK9A 4RV5A 4UMEA 5I9NA 2O8CB 1MRSA 3RRXA 2J3MA 5I9MA 4QSHA 3KK0A 1J0EA 4O33A 5JIBA 4DB4A 3F8TA 4K1XA 2YV4A 3EQ8A 3ZWPA 3CNEA 2YR0A 2VF2A 1PR1A 1FMCA 3RAGA 5DIZA 1Y8AA 3PWZA 3ELYA 3HY6A 3QPDA 3H18A 1EG2A 2J3IA 2OG2A 2WYUA 4FLEA 1T15A 1JVBA 4JLNA 1H2AS 4WV3A 2C0QA 3ELWA 5GGXA 4IW3B 4ZOLF 4JJKA 1NA5A 1M6VB 2IHJA 2ZULA 1OBCA 3NM6B 4ARZA 2OOKA 4MVJD 3ONVA 4DOMA 2HX1A 1BE0A 2OGWA 4ARZB 3OQJA 4BLQA 2NO6A 4GL2A 4F7WA 1AS3A 1GAWA 721PA 1EUCB 1CYEA 1J8YF 2JKZA 2IS4A 2OAP1 2IP4A 2V55B 1RYMA 1XA4A 3HCAA 2W2XA 3OD1A 4G0PA 5FI3A 3R74A 3G3EA 2R79A 4C4RA 1H0KA 3TJMA 3F6RA 3OZRA 4NZNA 4RQBA 5A0VA 2FCRA 5DLYA 1DOAA 4ETIA 8GPBA 1JXOA 2ZDQA 4G5HA 1SEVA 4E7PA 4YX9A 2R84A 3GN1A 3HU3A 4ND8B 2DWQA 3OESA 4G5XA 4UDYX 1H2YA 1QTNA 3EZYA 3ESAA 3MOGA 4RW0A 1T5LA 5GONA 4ZO9A 1WAMA 3AO0B 4QYTA 5JDCC 2AWNA 2JJ1D 4C14A 1SXGA 1ZMRA 3ZEIA 3W9UA 1N6RA 4I36A 3ITEA 3T0IA 4BFYA 2D7DA 2J07A 1SBTA 2DR0A 3CWCA 4YPOA 4IXMA 4U2KA 2GFHA 3GQBA 1TUBB 2A9RA 2O19A 3BMCB 3G9XA 1SBIA 4EFDA 1RYFA 1BW9A 4G5FA 5EZQA 2CSUA 4H7DA 4HWRA 3NUQA 5FWXB 3F3SA 5ALTA 4DFDA 3LW8A 4CL8A 4YRIA 2C94A 3FYUB 4NU5A 3PGJA 5JH7F 3FPCA 5ILQA 4L5YA 4XGQA 5JYEA 4TL8A 4KE6A 3I61A 3I5MA 4HMOA 3ZDRA 5DEIA 3C3DA 1H2WA 4DREA 1T4GA 4R2JA 2D2IA 3SY8A 2G5GX 3F98A 3I0NA 2OO7A 2RCYA 2JFOA 4IICA 3WLKX 4DLWA 1I2DA 3K2EA 1DO2A 1ESZA 4CKCB 1LCIA 1YBVA 2ECOA 2HY7A 3NHPA 4A16A 2WF7A 4PGHA 1H2ZA 3NIDB 2H52A 2C9YA 1BZYA 2WM2A 4GE3A 4MUFA 1C41A 5HKOA 5CRIA 3PHJA 3U60B 2NOAA 3I62A 4KPUB 5A3RA 4JXKA 2FK8A 1FMFA 1VOTA 1T24A 5DHPA 1XNRB 3L41A 1H05A 1C7QA 4D0NA 1JEAA 2BR5A 4YFVA 4AG5A 2Z5LA 5AUOB 4M1ZA 3M6AA 4UUPA 4KYUA 1GYRA 5EI5A 4F86A 1LPNA 4B47A 3ADCA 3F78A 4CEIA 4N76A 4OHBA 5ALHA 4JI0B 3EMKA 1VE5A 3E03A 1OIXA 4I6EA 1MORA 1OWPA 4CZ2A 1PV4A 3IFSA 4HSGA 1KK3A 2C8JA 3DYBA 3KKLA 2PZGA 3NJRA 3OM1A 2OBLA 5TMPA 3AESB 1W4CA 3P9YA 4QPCA 1HDRA 2Q0QA 4G09A 3D3EA 4AF8A 5DM4A 2Q27A 3FLAA 1U7DA 3C5CA 3RC8A 1TAHA 5I7FA 2GN1A 5G02A 3TG8A 1V9LA 3L6BA 1LJ8A 3GEIA 3TQIA 1FNNA 2H7CA 4URUR 1QIMA 3CVVA 3AP1A 3ET4A 5C8YA 4G26A 4PIPA 1VGVA 2RGUA 1W49A 2RBGA 1BGWA 2MINA 2XTJA 3H2HA 4LBYA 1ESCA 2YQ4A 3CO5A 4ML3A 3C8DA 1BC5A 5EHIA 4EMBA 4PRKA 1G98A 3LY7A 1J0AA 1M8GA 5L3ZA 3R5SA 4FBGA 3N8GA 2Q49A 4ASUD 4CG0A 3I58A 2F1IA 1OXTA 3H11A 3WLIA 2BZSA 3AERB 4GZMA 3LPLA 1NBIA 3STXA 5JI2E 3EOBI 5KTTA 5LDHA 1VIMA 2A4KA 3H11B 3PDUA 4KV9A 1GQYA 3O5AA 1CZHA 4OQYA 4OTZA 4BQPA 2J3JA 1YDMA 1K89A 5LPNA 3CLUC 1U9JA 1Q57A 1U2PA 1ZM4A 2V3WA 3OZCA 4HUJA 1LBSA 2VJAA 4YFYA 5ER6A 1BQ4A 3UICA 4DARA 2NV6A 1EUDA 2IPNA 4UHBA 4XYBA 3IP9A 3C7KA 1U4NA 4P81A 5AJTA 4U7JA 4Q7LA 4I3FA 1RCTE 1FFEA 5B6PA 1BQ3A 1NE2A 2O3QA 3LPDA 2QRZA 4W5TA 3J7AC 3O8CA 3NW9A 1MOSA 5K0BA 1D1SA 4DQXA 1VHQA 1ZK4A 3F97A 2QJFA 2WJHA 3GFSA 1EVKA 2A7XA 3LYAA 4HADA 4L78A 4TVKA 4CEJB 1USWA 2ZTSA 1HNZB 3Q72A 1XYYA 4DQKA 2X5KO 1K7FB 1X70A 5DHQA 2C54A 3NWJA 4X5OA 1T8TA 1G7TA 2I33A 1E2QA 3QEAZ 1U0FA 1CXZA 3DMGA 4I14A 3A3PA 2AZXA 5HCUA 3E8MA 4CG1A 1AG9A 3CY6A 4IDNA 4KPFC 1YI0A 3LOQA 4Y67A 3ZWVA 4BGEA 3NEYA 2V9ZA 3HDHA 2C82A 3TLAA 4H15A 3TNDA 2XDYA 3NRJA 5DTJA 3FDJA 3NANA 1CB7A 1EX1A 2M98A 3OI7A 1QP7A 4DLAA 4KSCA 1QDLB 3LF1A 4ZC1A 4S35A 2DY1A 1L7PA 1ZESA 4DWWA 1UBGA 3Q3IA 3N39C 3NHMA 3T5CA 5DISB 4C08A 4BNGA 4FC7A 3EAGA 1KDZA 1EEHA 5FH9A 2AFVA 2A14A 3B8HA 3H8JA 4CCWA 4AY2A 4A0FA 3JZMA 5LZ9A 2FUG1 2G06A 3CLSC 3LRTA 3RRZA 1P9NA 2ESRA 3KX2A 2EBHX 4Q24A 4X7BA 4TLCA 5E2IA 4COKA 2HWKA 1MC4A 3G5LA 3N2LA 4MYUA 4P34A 4N47A 3L8HA 4HXEB 4MUMA 5AJZA 3UN1A 4IIFA 2K87A 1ESMA 3HVUA 5KX5B 2Q99A 5KWVA 4HQKA 4MLDA 1KIMA 1GPAA 2R87A 4ZVVA 2C7QA 5HQJA 1HK7A 3N75A 2XSZD 4KNVA 4U6NA 4A2WA 2H11A 3BORA 2YBDA 5F2NA 3FR7A 1XDWA 4WEOA 1EK2A 3HYLA 3RLFA 3B38A 1Q0RA 1IEXA 2YV1A 1IWOA 1BEEA 1MX5A 3EC7A 4Q3NA 5M2QA 3VNBA 2VLIA 1XDUA 2XRMA 4NBLA 2ZVJA 1N0UA 2X3UA 2J45A 3HCCA 4P93A 4RTRA 1Q0UA 1W19A 4KNWA 4D9IA 2X9LA 1RZRD 1O0SA 3WBFA 2G0NA 4K9RA 4PG7A 1V6AA 3ROQA 3V8MA 1LPOA 1DCFA 1SGWA 3HUTA 1M0TA 4Y98A 5JY1A 5AESA 1OX5A 4KQXA 5IAJA 1E1DA 1KPHA 3ZCTA 1EFDN 4EIWA 4INPA 2Q62A 5AO9A 4X00A 4X6LA 4R1MA 3RYCB 4QYIB 4E4TA 4AY6A 3QBEA 1NL3A 5DTRA 2ZB2A 1GD1O 3L05A 4XIJA 4YAKA 2EF0A 2HIHA 1RC1A 1SIUA 3V33A 5HRUA 5K8UA 5LYJB 3LQYA 2AHOA 2NU8B 1RI3A 4HDOB 2G0TA 4QSMA 5DMXA 1L3IA 4PYJA 3WBKA 1C4WA 2WICA 4C6TA 4ZMSA 4MW9A 5B3JC 2CL6X 1SXJD 1XHLA 1VYVA 3Q2IA 4UVIA 2E4AA 4NYJR 1W5BA 5B2FA 5I4KA 5HBRA 4WXYB 5LP6C 4CUJA 2ZBRA 3PJEA 3N59A 5KYKA 1NX6A 4GZ3A 5MFPA 2X4LA 2RHJA 1N8KA 1X14A 1E2IA 2LW7A 3IC5A 2RGDA 4L6CA 1G1AA 4X93A 1HFJA 3S2ZA 4B76A 2PX4A 3PKJA 5WRFA 4E14A 3IAHA 3OCZA 3NHUA 4Z54A 3LCRA 1VBFA 2BMFA 1KJQA 5IC5A 1SCBA 3N5CA 5EIBD 4CMAA 5T4BA 2A33A 4JMPA 1EIZA 1UMKA 2H1CA 4TMWA 5EXTA 3TFQA 1WCIB 1MEJA