4LOAA

X-ray structure of the de-novo design amidase at the resolution 1.8a, northeast structural genomics consortium (nesg) target or398
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
158
Chain Sequence
SLAKNIVFIGESGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKASEIWEQYGWNFALEQEQKMADFFSSCEKACIATSGSFVNVSNLEKAGFCIYLKADFEYLKKRLFPLFSDEIKWKKHYNETLSKYEQKANFILNIENKNIDELLSEIKKVIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords De-novo design amidase
publication title Northeast Structural Genomics Consortium Target OR398
rcsb
total genus 59
structure length 158
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4loaA00
1FMLA 4EUNA 5JWHA 2CK3A 1ZC3A 1A1VA 3B2EA 4O0MA 2ZU0C 3ONWA 1DG1G 2FA9A 2HV8A 4FINA 1NVVQ 4IRUB 3I5YA 2IEYA 2BV3A 1PLKA 3BB1A 3WYFA 2WIAA 3CNLA 4P33A 1IN4A 2XGJA 3CB4A 2PMKA 2CNWA 1KZ7B 1Z0FA 4HZUB 2XSZD 4MKHA 5EE1A 2IYZA 2W2XA 1X1SA 1XEWY 3EASA 4M1KA 4C0KA 1M7GA 4D80A 5FR1A 3SN6A 5GJCA 3OAAA 3IPXA 3W5IA 3MG9A 3TJZA 1Z3IX 2ZPTX 3LVRE 4OQXA 2XZOA 1OXTA 1W0KA 2F1IA 3GJ8A 1S1MA 3ZH9B 2FFBA 4PAQA 3K0FA 2GAAA 3NC1C 4ABYA 5CITA 5F9FA 2R2AA 1W5TA 2F6RA 2VO1A 3BBPA 2ZJZA 5SZHB 2ZYTX 4ZCLA 1FL9A 1Z28A 1SVKA 2XEXA 4A0HA 5KYKA 3MJRA 2CNWD 2PL3A 4TTQA 221PA 3TQFA 1XMIA 1N2CE 1EK0A 1KDRA 3OAAD 3DKPA 5AJVB 1YU9A 3TKLA 4TMZA 4WW0A 4R2HA 4JLVA 2BVNA 2RCNA 5SZJA 4BLOA 1TUIA 1MR3F 3AH8A 4LC0A 4ON9A 3X1ZA 4IOMA 1AZTA 3BWDD 4QHYA 1OH6A 4URYR 1UDXA 4BRUA 2RAPA 2WIBA 3QXCA 4BLPA 5FBLB 2BHRA 2GK7A 1NMXA 4RD6A 1R8SA 1T3SA 1P61B 4M1OA 421PA 4A8JA 2GETA 1JJVA 3IEVA 1YE8A 3Q72A 2OT3B 2N42A 1NN3A 4L4UA 1K5DA 1EG7A 5CIWA 1IY0A 1JR3E 3EIQA 1TMKA 1H65A 3RAPR 1TQDA 4UNRA 3OESA 2IX3A 4B3FX 3K0EA 1N5IA 4C3ZA 1XP8A 3OE7D 2JLWA 2V4ZA 1XMVA 1I2DA 3W8NA 2YVUA 4QJ3A 1LS6A 2D2EA 4JLBA 4FMCF 3SE0A 3R9XA 1OKKA 4JSYA 1E2EA 1HQYE 4TWZA 3WP1B 1R5NA 5FPTA 3SHWA 1R0YA 1DAMA 1P62B 1ZD8A 3QF4B 3SYKA 4KYUA 3B9QA 3VR4A 4A4DA 4DLYA 1Q3TA 3NBXX 5IK2A 1ANKA 5EE3A 1TADA 5LD2C 2WSSA 2QP9X 1TNDA 2WAYA 5FL7D 3T1TA 1TF2A 1UKEA 4HLCA 3A4LA 2RMKA 3UG6A 2DWPA 1KAOA 2AXPA 4EQ6B 5CYOA 2F3RA 1U8AA 2G1KA 3GJ3A 3ZVLA 3EA0A 3AVUA 4KLZA 3GLFA 1XD8A 1OKKD 1Q44A 4QM7A 3VKWA 4RD2A 3U6BA 2RGGA 1N5LA 5H1YA 2FV8A 2EYQA 3SC3A 4JBYA 4UNSA 1YZUA 3LO5A 2BDTA 3IO3A 5CB6A 4PHTA 3ASZA 5DNYB 2ZE8A 4C7OB 2IXEA 2WSSD 1QDEA 4LYJA 5DN6D 5KSYA 2QZ4A 4URUR 3B9PA 4P0TA 3SYNA 3BB3A 4MGKR 3NKVA 5JRJA 2BCGY 2ZI7A 3K9GA 3QG5A 1GTVA 1Z83A 3NBYC 2G6BA 4LHWA 3TBKA 1WBBA 3C14C 3EZ6A 5CYPA 2IYWA 1JJ7A 2ZU6A 3E5HA 5HE9A 1FFHA 3G0HA 2QMUA 1V43A 1UBEA 3F0TA 3WNBA 2VTKA 3TK1A 2C9CA 3R7WB 5FL3A 1OV4A 5JSZB 2AX4A 2EFEB 2WKPA 5HTKA 3HYTA 1T6NA 1VECA 4AG5A 4DLVA 3AKCA 2P67A 1OXXK 1DADA 4BFWA 2O5VA 2FU5C 4BPBA 1SHZA 1UEIA 4HZIA 4TLBA 5AR1A 4HUQA 4IDOA 4GZLA 1E2HA 1G8HA 1VHLA 4HDOB 3TUIC 4JYBA 1M2OB 3PXGA 1W36C 2QSZA 3Q7QA 2Z4RA 3U3OA 2ZE5A 1FUKA 5AUPB 2GVZC 2JIZD 3QJYA 2V9PA 2YINC 2KBFA 1HH4A 3NEJA 3N2EA 3I73A 1XXHA 2WBLC 1CXZA 3AVOA 1VIYA 3PEWA 1E9AA 3ZIAD 3PR1A 1F6BA 1E0JA 4PC3A 2H1LA 4TLEA 2ORWA 4Y0VA 4BFUA 4NMMA 4QOSA 3DM5A 1ZD1A 4DIEA 3AUYA 2EFHB 3LQRA 1P72A 2LKCA 2QL6A 2AL7A 2V7QA 2ZI3A 3FDIA 4MGYR 2DCUA 2WAXA 4IDQA 1U0LA 2MSDB 2NG1A 4LX0A 4OHXA 1YRBA 3X1XA 1G9XA 3EPJA 2JLZA 4Q02A 3VR3A 5J4YA 2ZRPA 1OH8A 2ERXA 5DE3A 1DVRA 2V6JA 3PJRA 4ZKEA 1DO2A 1NMYA 4KU4A 2GILA 3Q5DA 4O2LA 4NKRA 3DDCA 1G3QA 4DIDA 2IK8A 3L0IB 3WHLA 5FOWA 4O3MA 1E1RD 2ZS7A 1XEXA 1Q1EA 4LC1A 1I4LD 3SEAA 2V7QD 5JZVA 5L3SA 1P4SA 4FD2A 3H2YA 3CRMA 1GG2A 5DI3A 1Q22A 1KKMA 1B0UA 1DO0A 3GJ5A 1FOEB 2IF0A 3KKOA 1HE1C 2R6CA 2X1VA 2AD5A 3BFVA 2IYRA 3LV8A 3OIYA 3GEEA 4M2LA 3AVPA 4K81B 3VU9A 3Q85A 3PV0A 4L15A 2F3TA 4GMXA 1ZNZA 2R6DA 4LBYA 1IHUA 1E2NA 4KVAA 2TMKA 1SVIA 1G7SA 2QA5A 2R65A 3I1FA 4BFZA 3SFVA 3ND9A 4BE7B 5HR5A 2ZXUA 3FGNA 1NP6A 1HEIA 2HF9A 1E9BA 2AD1A 2G1JA 1DE0A 1RYFA 4Q7JB 2ZE6A 2D7CA 2J46A 2YWFA 2WWFA 2FFQA 4KLNA 4X8OA 5J40A 1TAGA 4YMUA 2AN9A 4DZZA 1R0XA 2B21A 3OHMA 1Z06A 4M8NE 2B8WA 5JS8A 1W49A 1JPJA 2GJ9A 2IL1A 4PZZA 3B1YA 2QPAA 2CCJA 2IS4A 3QEOA 3SOPA 2ZI5A 4KFRA 1LNZA 5BXQC 1QVAA 1II8A 3KQHA 3AKDA 1KO5A 1CF4A 2WKQA 5KNCA 4P4SA 3E70C 1AGRA 3THXA 2B6HA 1TPZA 4TMTA 721PA 1VYVA 1FTNA 4Q03A 2J59A 2BBWA 1VTKA 3M0EA 2CVFA 4Q1AA 4QGGA 3CF6R 5FTKA 2H17A 2ZR9A 1DS6A 1XD9A 2RGCA 3A1TA 2GF0A 3I4LA 2YOGA 4JS0A 1HV8A 2BM1A 1TL7C 4Q48A 4OI0A 2BM0A 4YMWA 1UKYA 1XMSA 1IONA 2BKEA 4K46A 4UXHA 5HCNA 2JLYA 1NI3A 4CYMA 1LW7A 4B33A 2XTNA 4ZKDA 3P4XA 3I3SR 1D8TA 2IYQA 2ZS8A 2ASEA 4JSTA 3ZVMA 2JJ2A 4WXRA 1S9HA 4FCVA 4HZUA 1F2UB 4NBSA 2CE2X 4DBLC 4UQOA 2D7DA 1T3HA 2QP4A 3DHWC 4V0NA 4EPWA 1CP2A 2JASA 2ZJ2A 2GRJA 3K0FB 4WZAE 5G3ZA 3PFIA 2XB4A 4ZDWA 1KIMA 1KI7A 1AKYA 3K09A 3U60B 1KK3A 4EPVA 1AGPA 4ASUA 4KFTA 3U44A 3OIWA 4DCTA 1VCMA 4JKIA 2HXYA 1S4QA 2GHIA 4HAYA 3A1VA 1RIFA 1XU4A 3B8HA 5ANRB 5TY0A 3E2IA 4ZDKA 4YMVA 2GVDC 2ZSEA 1NVUQ 2KJQA 4MUBA 5EXTA 5FI1B 2YYZA 3SQXA 3HPRA 4TL7A 3PUZA 2CL6X 2R62A 2PT5A 5EE9A 3L0SA 3KUCA 4US2R 8OHMA 4DHEA 1XNJA 3MMPA 2CHQA 3CLVA 3IQWA 2LKDA 5GJBA 4HYYA 1A2KC 3UMFA 3RABA 4RCZA 2IYTA 2RKOA 1CEEA 2K5UA 1DTSA 4GP6A 4A8JB 1NKTA 1S3GA 4Z54A 4RCYA 1HUQA 1P3JA 1CJTC 1XXHE 2V1XA 5FPSA 5K8UA 1E2QA 1XJCA 2QI9C 3IQXA 1PV4A 1E0KA 5EE0A 3C7KA 4G01B 1NSFA 1LB1B 1ZUIA 2JA1A 3HR8A 5HE8A 2VHTA 2CLCX 3B82A 2ZREA 2WWGA 3NH6A 4LHVA 4R2IA 2ZRHA 1KMHB 3B6EA 4LHYA 4F38A 3KL4A 5D3QA 5IHPA 1SVOA 2QAJA 3X2SA 2IHBA 4QHSA 1VHTA 2F9LA 2HXSA 3FPAA 5E7JA 3EX7C 3B78A 2FN4A 1ZRHA 4LJ5A 4EPYA 1KO8A 4IFEA 4JLKA 1NIPA 2VF7A 3VR2A 2IUUA 3TH5A 3CBQA 3W6OA 1CJKC 1E98A 1XD2B 1E2PA 5FTMA 1AIPA 1AS0A 1N6RA 1G18A 2REXB 4LJYA 3HPQA 1KI8A 3CUEF 4S35A 1CR2A 1P7CA 3RC3A 4CEHA 2IYVA 3FKQA 4TQUS 4R9UC 4C9BA 4IVPA 4PHGA 3SBDA 3IO5A 4Q7LA 3LW8A 4FCWA 2ODNA 4B2LA 1FP6A 4E22A 5JWRA 3GLFB 3WRXC 3ZD7A 4YC7A 4LBWA 1YJ5A 3SDZA 2HYDA 3VKGA 3CR7A 4FI3C 4DKXA 3ZYCA 4M53A 5FUXA 2OFWA 1BMFD 4L9SA 4DLWA 5C1BA 5HCIA 2O8BB 4HATA 2GXAA 2HDNB 5KDOA 1TQ4A 5C2JB 2ZYWX 1DELA 2VP2A 4W5JA 1R5OA 3A8TA 3FVQA 1S1CA 4A6XA 4C7OA 1GRNA 4W5WA 4LGMA 3BS4A 3T15A 1GITA 3T35A 3RANA 1OFTA 2LCFA 3QNUA 1R7RA 4YXWD 3A4NA 4DWJA 2NZJA 3REFA 3TUZC 2GCOB 4FCTA 4BLRA 2CCGA 1ZJ6A 1KK2A 3O8BA 2F43A 1FMJA 4B3DA 2ODEA 3OEEA 4DSTA 2P0EA 3BE4A 4PC1A 4A6PA 4BASA 1R6BX 1MRNA 3RRNA 3TUJC 1OH5A 2IS6A 1HT1E 1N6OA 1Z08A 3R7WA 4GT1A 2ZUCA 5KSOA 5JSZA 2JLQA 2MSEB 5G3YA 1GP2A 1WMSA 2XX3A 3X1DA 1XFAA 3P27A 5FTNA 4BLTA 4PHFA 3SS8A 3T1VA 1HY3A 2FZ4A 3AKYA 2NIPA 2WJYA 4TMWA 1E2FA 1GWNA 2ZUBA 2IWHA 5A0FA 2Z5FA 4QJ4A 3P20A 1VMAA 3OEED 4NCKA 5JFGA 4AD8A 1G5TA 1NLFA 5AUNB 2QEQA 2Q3MA 3GFTA 4HLUA 1UBGA 4MGZR 3C41J 3CR8A 3LX8A 3WRYC 3THYA 2WWHA 4LYHA 4V02A 2JLVA 1SKYE 3I8XA 1Q1QA 2E9SA 3OEHA 3CH5A 3TAUA 1LF0A 1E9FA 2PZFA 1J70A 1Q3HA 1C9KA 2N1BA 4NHOA 2BMEA 1ZNYA 5B58C 2ZI6A 1IY1A 1A82A 4FIDA 1N6PA 4KBGA 1KK0A 1Z5ZA 3P32A 4LYFA 4DB4A 4LRWA 2BOVA 2OUKA 3IIJA 2WJIA 4KBFA 3SR0A 3WYAA 3GD7A 3KJHA 5E7IA 2ZSDA 4RD3A 2E1RA 2X77A 4TTRA 3KX2A 3DZDA 4HLDA 2VP4A 4PQFA 3OIUA 3PEVA 5BN3A 4B74A 3RC8A 2LWIA 1ZCBA 1R10A 3F3YA 4JVSB 4US0R 3OEHD 5EJEA 3SFZA 1DARA 1E4VA 2JJ1A 2R6GA 5IT5A 3A37A 4XWOA 2P65A 2ZAMA 3MJHA 4J0QA 4EPRA 2ZM5A 5LD2B 1IQPA 1XCGB 1MABA 4QBIA 5L3SB 3R9WA 1LVGA 4A9AA 2BBTA 2OCPA 5F9HA 3LDAA 4JMPA 4B35A 1OYYA 2WSMA 2Q9BA 1Q57A 2RGNC 1S96A 2ZJBA 1MT0A 1R0WA 5JLJA 1KMQA 4PX9A 5A5GA 4GSYA 2W6JA 3RVBA 1LTQA 2CEAA 5KSZA 2A5FA 2HT1A 5P21A 1E2LA 1UF9A 2OG2A 4I1SA 1Z0DA 2B7BA 3L43A 2OCYC 4U00A 3B13B 3T06B 4PC2A 4NYMR 3AVVA 1JXOA 4LJ8A 2AFHE 5BYKA 1MH1A 1WCV1 3QPUA 2ZSFA 5AJXA 4Q5IA 2DFLA 4B6EA 1G8PA 3AQ4A 3ADCA 1UDWA 1C4OA 1XTJA 3LH5A 2KI5A 1ZBDA 1FP7A 1WRBA 2AKYA 1OJLA 5FOUA 1XF9A 1E2DA 3ZZUA 1UAAA 2ZJOA 2ZRMA 4PZYA 4II7A 1P2SA 3I72A 3R8CA 4EJSC 1JQJC 3ZVNA 1AA9A 4BZXA 3VKHA 521PA 5A4JA 2CJWB 4GRAA 1FQKA 3C8UA 4Q4AB 1JPNA 2FF7A 2VF8A 3NEYA 4TTPA 3ZQ6A 4C0BA 1NIJA 4YMSA 3P4YA 3TW8B 4D81A 4OHYA 4V03A 2P6RA 2Z0MA 3BGWA 4DDVA 2AK3A 1B23P 4P4SB 2VPPA 2HEIA 3FHTA 1KNXA 4TL8A 4Q1FA 2D4HA 4URWR 4DLSA 4MKIA 1IM2A 1BKDR 1XTRA 4Q7MB 3QI2A 3Q8XB 4RZ3A 2YC2C 5JI3E 2NPIA 4BWYA 4EFLA 5FTLA 3D3QA 1Q21A 1W36B 1OIXA 1NLZA 2F1HA 5JJIA 3RHFA 2AXNA 3PUVA 4M9XA 4F92B 4E5UA 3AVXA 5EXXA 2BJVA 2HF8A 2YJTD 4N1AA 2GNOA 5FR2A 2WJJA 3PUXA 2W58A 4KSBA 2JAQA 3EARA 2GBLC 2GJSA 5IRCD 3KTAA 1CJVC 1GL7A 4R98A 5G53C 4LUCA 1G41A 5FBRB 1PZNA 3KQLA 4RKEA 4NZYA 4FWIB 5UKDA 1E2JA 3QKRB 3UIEA 4WVFA 1KHTA 4MRSA 1W4CA 2O52A 3GLGB 4AI6A 4LPKA 1F2UA 2Q9CA 1ZM7A 5DSZA 1KSFX 1RRGA 3DL0A 2ZRLA 3ASYA 3U44B 1RPZA 1A7JA 1E99A 4OI4A 1CR4A 2CK3D 2VHUA 3WMFA 2QMHA 2W0MA 2YC4C 2BMFA 3VR1A 2EQBA 2NTYC 1ZVQA 2NO6A 1EX6A 3DVLA 4XSGA 4JBXA 3H1TA 3JVVA 4CEJA 5DYGA 2WKRA 3IBGA 1VG0B 1KSJA 3HR7A 1KO1A 1QHIA 2A2ZA 3QG1A 1OF1A 2GJKA 4DUGA 2VSOA 1KK1A 1MRSA 5H70A 5FOSA 1T5IA 1W0KD 4MRVA 4KITB 1G3UA 1JQLB 1ZINA 2ZRDA 3GJXC 4HI0E 2W83A 2ZR7A 1KDTA 3W90A 1Q1ZA 2Y8EA 4W7SA 2J5XA 2ZEJA 5CM8B 3KB1A 3U7EB 4OI1A 3GLHA 4HB4A 1KJZA 1NJGA 1RRFA 2NPFA 3RLFA 3FB4A 1NG1A 4C0JA 1KJYA 2C96A 3QKSA 3TQCA 2NZ8A 2ZE7A 4HB0A 4JVLA 3HWSA 4DUGD 3VQTA 4V0KA 2BJWA 3NH9A 1KKLA 4DDUA 4JJKA 4FXPA 1TU3A 3E1SA 4R7ZA 3FMPB 2CLDX 4OYHA 3ZZ0A 3TLXA 4ZPXA 4Q18A 3H86A 1WQ1R 1D2MA 2DPXA 1KMHA 2R9VA 4IHQA 5JEEA 5JCPA 1VG8A 2A9KA 2HLDA 3ETLA 4LYAA 3ZZTA 1AS2A 3IIMA 4EJSA 1ZC4A 1UKVY 2PEZA 1ZIPA 2ERYA 4D4KA 5DO9A 2BMDA 3N2IA 4CEHB 4AKIA 1XD2A 3EZ7A 3RS4A 5FOTA 2EW1A 4A15A 1EWQA 3BAFA 3AGPA 3UG7A 3LXXA 821PA 4PO1A 4MH0R 1G19A 1GKIA 1WE2A 2IW3A 4CGZA 2J1LA 1T8TA 4IVRA 4PC7A 4KODA 3F8TA 3G5UA 2WZQA 4URZR 3IPYA 4NYJQ 2HLDD 4KFUA 2BIFA 3OFNA 3H4MA 1SZPA 4PAOA 4PSKA 4WIAA 2CMKA 3FMFA 3LD9A 3TRFA 2VYFA 3VR5A 3WBJA 3RSOA 1GFIA 2NO7A 4CVNA 5L3QB 3FOZA 3LA6A 1KDOA 1CR1A 4MRNA 2OEPA 5IK2D 2O8BA 2ZRNA 4ILEA 1E9SA 2GBLA 1ELOA 4JLDA 1NBMA 1W47A 1R2QA 4GMDA 4Q47A 5JI2E 2XNDA 1NY5A 4PTLA 1Z22A 4DT1B 1HTWA 2EYUA 3TW4A 2F43B 2YWEA 3OFND 3UATA 3CX7A 1Z0KA 5BYJA 3IUYA 2AKAB 2GCOA 3CNNA 3R20A 4LV6A 2J87A 2IC5A 1ZAKA 2L0XA 2PZGA 2Q3FA 2R8RA 1E9CA 2ZUDA 1OIWA 1NKSA 1IXSB 4BLSA 2QPTA 1SKQA 2RHDA 2XXAB 5BWMA 5LDDC 1HYQA 1ZM3A 3FWYA 3HU3A 3QKTA 3TR5A 2OXCA 1L7VC 2BEKA 2N46A 4ESHA 1AKEA 4LK2A 4NYIQ 2MSCB 3AB3A 2GWHA 1YVDA 2G9NA 2XJ4A 2MMCA 2XNDD 3DM9B 5E4FA 2C98A 2BC9A 3AP3A 4JLMA 4HUTA 1OXVA 4F4CA 1ZUHA 2QMOA 2W6IA 5DHFA 3VFDA 4AURA 1J90A 2ZRIA 3U3JA 3U7FB 1GNRA 1N25A 4OQMA 2QM7A 4NCJA 5J47A 3K9NA 1KGDA 3T5GA 2C9OA 4LJ7A 3THYB 4DSNA 3W3AA 4IDPA 1CU1A 4W5HA 2IS2A 4MQBA 4QHTA 1QRAA 5TXGA 4B71A 4YQFA 2CXXA 5BQ5A 5ELXA 2XZLA 2FEMA 5J4LA 1JECA 1OB5A 4G5OA 1GVNB 4ZV4A 4Z51A 1QHNA 5E7MA 1OXSC 4W9MC 2RB4A 4XIGS 2GKSA 2WVJA 5DISB 2ZANA 2ONKA 3BD9A 2V3CC 2QNRA 1QHHB 4NP6A 2W6ID 1W48A 2XOKA 1PJRA 2ZRKA 1I2MA 5B64A 2OAQ1 4M1TA 3HU2A 2GDJA 2QMEA 4TT3A 1EFTA 2RGXA 1D5CA 5TVKA 4I4LA 1ZCAA 4F4IA 1XEFA 3V9PA 2QTHA 4LJAA 1C1YA 1Y63A 5E95A 4NL4H 5EP3A 2PEYA 4PPNA 2OAP1 621PA 2JLRA 4K8OA 3K53A 2QUZA 4MKFA 4IEEA 4BLQA 4EFMA 2ZR0A 2IYXA 4OQFA 2H5EA 1MABB 4X8HA 2G88A 3T1QA 3L2OB 3V4FA 4HEJA 4KCGA 1AS3A 4BEBA 2QN6A 5KPDA 2HYIC 4C4PA 2OE2A 2XOKD 1S2MA 4D0NA 4LOAA 4QM6A 1J8YF 1RE0A 2GZDA 3IHWA 2V6IA 3QXHA 4LDJA 4LZZA 4RKFA 1AQYA 1JBKA 2WMNB 4NDZA 2OBNA 2IUTA 1ZM4A 2HUPA 2ZQ5A 4M9QA 4TMVA 3HU1A 3CZQA 4NU0A 1KO4A 4I1UA 1AM4D 3MUFA 1ZYUA 3K70C 4M1WA 2OBLA 3QE0A 4CRWB 1NL3A 3HDTA 2V54A 1J7KA 4JLOA 4JYCA 2ZIAA 1U8YA 4Q7KA 3BH0A 3PQCA 3QVUA 3KB2A 2QU8A 4JLNA 1E3MA 4XJXA 2ZJ5A 3B85A 4UXIA 1N5JA 2R44A 1N6LA 3LQQA 3L0PA 5M04A 2YWHA 3FE2A 4IDHA 5JCZA 1P9NA 3NHBA 2VP6A 3FFAA 3FYHA 1RJ9B 3PIRA 4RFVA 4GNKA 3K8YA 4RY2A 1Q0UA 1YRAA 5GVRA 5JHHB 3GMTA 1E9DA 3TAHA 1WXQA 1SQ5A 3IGFA 3NXSA 3NHAA 1G3MA 3GJ6A 2QT1A 5TMPA 1NN1A 3LLMA 2C8VA 3NIBA 4DLTA 1DAFA 2CJWA 4TL9A 2XB2A 4Q4AA 1JNYA 2ZYVX 1W44A 4JL5A 2OSBA 4D6PA 1L4YA 2FFAA 1FQJA 1SXJC 4PQRA 3TSZA 4JT4A 2PBRA 2QENA 3CWQA 4HB2A 5KUTA 5AK0A 2C77A 3Q3JB 1HT2E 2WOOA 3THOA 1EXMA 3U7GA 1DOAA 2VP9A 3MWJA 1W4AA 3U4QB 4DLZA 1IN5A 3LNCA 4BFXA 5JRZA 2OFOA 2IT1A 3GLFE 2Q0HA 2QP3A 4OHWA 1D9ZA 1FX0B 5IF9A 4D25A 1UEJA 3RS3A 3KTAB 1Z6AA 2H7VA 4UJ5A 4Q19A 2YKGA 1W4BA 5JS7A 1QHSA 3CPHA 1VIAA 3AP2A 3I61A 3VTKA 2ZROA 4GBMA 1E6CA 4WAUA 3W8RA 4EAQA 1LF5A 1ZD9A 3NBFA 2OZEA 3KXLA 4NH0A 4QL3A 1WA5A 3KXKA 4LHXA 3ADBA 3FHOA 3A1UA 3QKRA 2A78A 4FWTA 1KSHA 3GLGA 2NO0A 1NG9A 4RZUA 1W36D 4I1OA 4XVRA 1YHNA 1E94E 4LWZA 2GF9A 1E9RA 3FFBA 4CEJB 3QXXA 2FNAA 1SHKA 1T3LA 2IF2A 1OT3A 1CJMA 2WJGA 2Q6TA 1YZNA 2VQSA 1Z2AA 1DAIA 4PO8A 3SI7A 2CCKA 4MYUA 1GUAA 2FG5A 2QM8A 3CKLA 5DYIA 2Q3HA 1KI9A 4M0LA 2QT0A 4OQLA 2JJ2D 1Q1BA 1COWA 5FUWA 1R8QA 2BBSA 1VPLA 3RWMB 1W2GA 4DCNA 3DOEA 5C46F 2ECKA 4UXJA 1SVSA 2I1VB 5FI0B 5KNBA 2RHMA 2QPOA 3MGCA 2KSQA 4D2IA 4ASUD 1GILA 5BN5A 1OFHA 2PLRA 2C95A 4UNNA 4ZI2A 5DHAA 4HB3A 1KTVA 3GLHB 1XEWX 4GOJA 3JZMA 2HCJB 2W2VA 4Q9KA 3QKSB 2XTMA 5G40A 5LBIA 5KNDA 1G291 2J0SA 1P2TA 4AYTA 1COWD 2QGNA 5AJYA 1G16A 1RW4A 4TL6A 3MLEA 4LJ6A 3EAQA 3W3ZB 1OHHA 4JT2A 5B2ZA 1P2VA 4JLPA 3SNHA 4PAMA 4EJSB 2FJUA 3JZAA 4BQSA 1FW6A 4HAVA 1F5NA 3WXMA 2EVWX 3BRWD 4HLQB 4L16A 4TYQA 3QBTA 3SJBA 2O0KA 4Q00A 4YMTA 2FX3A 2OESA 2CE7A 3LBNA 1QG2A 1TEXA 5HZKA 2JLUA 4MYTA 3MWYW 4POAA 5IDVA 4B43A 2J7PA 3ND8A 1YR8A 1IXRC 4LV5B 1M1YE 2X19A 4EFNA 3NBZC 5CLLA 1BYIA 2OLKA 2WWIA 2FFHA 1KI6B 2VHJA 3KFVA 3C16C 4B6FA 4N0DA 3KQNA 4CT4B 3AF0A 4X8LA 2D06A 2WTUA 2W2TA 2ZRFA 1F60A 2XZPA 1US8A 1NVVR 5JHGB 2R6FA 3I32A 5AJWA 1KI4A 1GZSA 3TNFA 5K8IA 3KQUA 2IS1A 1YR7A 1X8LA 3L82B 2FPMA 2AK2A 2J7PD 4IEIA 3UXMA 5CK4A 3M1IA 3QEJA 3GP8A 1BH2A 5L3QA 1G8YA 5KTYA 4TMKA 4OJQA 1DEKA 3AP1A 1Z6XA 1UADA 1AZSC 1G17A 2QGZA 3KDSE 4C0SA 1F3OA 1NVWQ 5CK5A 2AHOA 3Q9LA 2J45A 2Z43A 3BB4A 1GKUB 1G5PA 4A2QA 1NLYA 1FNMA 2I1QA 2VEDA 3D31A 3U3MA 4OK5A 3WYGA 1S3SA 4C0QC 4DT1A 1DPFA 2V8OA 5TARA 6Q21A 3K9LA 3HYRA 4JL8A 4M4SA 3MSXA 4Q21A 3UPUA 3CZPA 4IFBA 4IDNA 4ESVA 3GPLA 1XZQA 3K1JA 3FMIA 3K0CC 4ZO4A 1XBTA 4KO8A 2G77B 1MV5A 1U90A 5KOYA 5BN4A 2ODWA 3EWAA 2O0JA 3KJEA 2XXAA 3KKNA 2O8CB 2H57A 3MWKA 1L4UA 1EESA 4BZPA 1K8RA 4LSGA 4L9WA 1BIFA 4Z8YA 4D26A 2EFCB 4QGAA 3SQWA 4HAZA 2WWWA 4FMDB 1PLJA 3QIAA 2XITA 4AG6A 2JLXA 4DJTA 3AKEA 3QOFA 2G83A 2REOA 2ZETA 2VHQA 1E1QA 3U3RA 1EFCA 4QRHA 2PMDA 1P75A 1G7RA 4A2PA 4QC2A 4C0AC 3WHKA 5F2EA 3A6PC 4F91B 5EUMA 3CPEA 1TTTA 1DBSA 2PZEA 1SVLA 5GJWC 1FNNA 3RYTC 1KY2A 2HJGA 4G5RA 3B5JA 2D74A 3OF5A 1KO7A 3RSLA 3CX6A 1BOFA 3SJZA 1NN5A 1U9IC 3M4YA 2GCPA 3AF3A 3CRQA 1QHHA 5KSPA 4GP7A 4AKEA 1BS1A 1YR9A 1RRCA 4MYCA 2A30A 2FSFA 1NJFA 4IVQA 5KHOC 1II0A 4PC6A 1GM5A 2DFTA 1MOZA 4RJLA 5J5CA 4R71A 4MKGA 3GLGE 5FBQB 2F1JA 3CM0A 1W4RA 1ETUA 1IBRA 2ANCA 2CBZA 1E79A 3TSOA 1J8MF 1NN0A 5B30A 1Y3AA 4GL2A 3QPWA 1GRQA 2WWYA 5JEDA 2DB3A 4A82A 5KU1A 3UK6A 2EFDB 1HE8B 3CH4B 3CO5A 1TU4A 2I3BA 2OFXA 3GEIA 4MUAA 5F3WB 1CLUA 4F4JA 4BRWA 3EWSA 1W2HA 1IY2A 2UVQA 3QXJA 4B2IA 3EG5A 3S1AA 4G1UC 4OI2A 3ZS8A 4E09A 4LI0A 4RSGA 4A92A 4JIMA 1T0JB 1NSTA 2JJ1D 2RH5A 3CPJB 5FOXA 2H8KA 4O2RA 2FMXA 4IKEA 4Y0AA 2PJRA 1LS1A 3NWJA 2UKDA 4NE2A 1KI2A 5EP1A 2OBMA 2GEDA 3GFPA 2FWRA 4XD7A 1XPOA 1NY6A 2WJHA 1EFRA 2IEZA 5C4GB 4KFSA 1M8PA 2G3YA 2J41A 2FH5B 3TSWA 1N0UA 1RJ9A 2QQEA 2W6JD 3KJIA 3LBHA 4GPTA 3N70A 4I99A 4DSOA 5HPYB 3LXRA 2A5JA 2VSFA 3TVDA 1GL6A 3TGPA 3ZJYA 4QXAA 1G20E 1ESMA 3K0AA 5HKKA 3H84A 3RWOA 2YV5A 1N0WA 1OXUA 3K0CA 4Q1DA 4CEIB 4YONB 2R6AA 3FMOB 1G3RA 4ACBA 4V0LA 1M6NA 1N3BA 3CONA 4PHHA 1JI0A 1EFRD 4UNPA 2XAUA 4H1VA 2J9RA 2OO7A 4IJMA 2BCJQ 2QRNA 2SHKA 2YNMA 5TB5A 4A1FA 3IILA 3UWKA 3C15C 2WICA 3WP0A 2OILA 4C2UA 4BFTA 1QG4A 1N6NA 2JEOA 1CRQA 3EXAA 5B57C 2ONJA 3U4QA 1U81A 2IHYA 2ZVQX 4Q4HB 5L8VA 1Z0IA 2FSGA 2QE7A 2FDCA 3RS0A 1FX0A 1GL9B 3LLUA 5FBVB 2HT6A 2PJZA 3O8DA 2XSZA 2IYSA 2OHFA 3U5ZB 1GNPA 1CKEA 1UKZA 4P4TA 4QBGB 5TDHA 1PVOA 3RNLA 2XTZA 1CRPA 2FSHA 1E96A 2H16A 1E2MA 2J7KA 1EFUA 1U8ZA 1YKSA 1TQ6A 1CBUA 2ZRBA 4LBZA 2QRZA 1RYHA 4TZ0A 1XDBA 3GLIB 2Q21A 4MA4A 4C2TA 1D2EA 5EP4A 3I62A 2FZLA 2QE7D 4P3YA 1JEDA 4B75A 1FTSA 1Z0JA 2W0SA 3ECCA 2ZJ8A 4DDWA 1G3IA 2D2FA 3EPKA 1E0AA 4B34A 3ZS9A 1G4UR 2HCBA 2FPKA 1VKJA 3W6NA 4NTZA 1HURA 1E2IA 3K9HA 2QTFA 1XJ0A 3LAWA 1ZMXA 3KKQA 4I1VA 1N6KA 2QBYB 4JVMA 1DAKA 1TQ2A 1OE0A 4XTRA 4N0EA 2RGNA 2GK6A 4PR0A 3K70B 1X6VA 2JDIA 3DMNA 4MDFA 1JAHA 4HAXA 2QAGC 2WOJA 3O47A 1SULA 3AF2A 4DCSA 3ZD6A 4TYWA 3W34A 4ZIRA 2ODBA 1GIAA 2RGAA 3VHXA 1LFDB 1DG3A 2GEUA 4ZCMA 1FUUA 1Z8FA 1UBFA 4QJ5A 1CIPA 1T9HA 1NF3A 3NDBB 4I81A 1WF3A 4DXAA 1KJWA 2X2FA 4Q01A 3TVTA 2BEJA 3A1SA 3QVVA 3OE7A 2JDID 1Z2CA 1RC8A 1GSIA 4KSCA 4EIWA 1XX6A 3DOFA 1ZM2A 5K8TA 3I5XA 2YZ2A 4RZ2A 2EWVA 3CW2A 3V00A 4B73A 2JATA 2CDNA 5LPNA 2UZIR 4D82A 4DDTA 4TYNA 1Z0AA 2VL7A 2V1UA 3W6PA 1RVDA 1G7CA 1P9WA 2UZ3A 4NCNA 4E03A 1H8HA 1XB2A 2BMJA 2V55B 3IKJA 2GTPA 1SXJB 4IXNA 2C03A 3I92A 3C4JA 5FL7A 3BK7A 3O8CA 4M1SA 1DAGA 1VDZA 4Q1CA 3REGA 4JKYA 4WBSA 1OLOA 4AKHA 1KI6A 5SZIA 1KZGB 2J0VA 4Q4JB 1J2JA 5L3VA 4MDEA 1US8B 4US1R 2C78A 3LWNA 1M7BA 3R8FA 1G6OA 1Z6GA 1XTKA 3WNDA 2CHVA 5JECA 3MWLA 4DLUA 4Q66C 4ARZB 1OSNA 1JEEA 1P2UA 2ZAOA 2F7SA 1P9RA 4DEXA 3AVTA 1G4AE 4BFSA 1H8HD 4FMBB 4JJZA 5EQTA 1FZQA 3IDQA 2O8EB 5DN6A 4ZDIA 3ICQB 1T4GA 2PH1A 1OIVA 2YOHA 2FGKA 2ZTSA 3PVSA 5DLQC 1PUIA 4B47A 4DLXA 3BH7A 3BOSA 4P32A 2VBCA 2WM9B 3J81k 4WZ6A 4MYHA 2O8FB 1U94A 2QTVB 1LV7A 3EIHA 2Z83A 4U7DA 3RRYA 2P5SA 5LB2A 3SBEA 2ATXA 1WBDA 1DAEA 1U0HC 3SHFA 1XWIA 2B7CA 1A5TA 2BWJA 3BFXA 4NYMQ 1Z6YA 1K6MA 1IXZA 2DR3A 1G8GA 1IN8A 1X3SA 4LCBA 4OK3A 1GKYA 1NBMD 2ZVPX 4Q9LA 2O8CA 2VP5A 2Q9AA 1QZXA 4QFMA 2CLSA 4YLGA 4QG7A 3VAAA 2EFGA 4U02A 1W0JA 4G3XA 3QUSA 4P31A 3LW7A 2AR7A 3WNCA 2PCLA 2VH5R 2FEOA 1L8QA 1W7AA 3MRSA 2JIZA 5AJZA 1AK2A 1NRJB 1UPTA 4AKGA 5JJKA 2DHRA 4A0RA 4CF7A 2QAGA 2C2HA 3ZQJA 3LFUA 1ZW6A 3BIFA 4RD4A 3VX4A 3ZIAA 1XPUA 4C30A 5JJLA 5J4KA 2VSXA 4DVGA 4CIDA 2EWWA 3AUXA 5FH9A 4RVCA 4PQYA 4GDFA 3MAAC 3MFYA 4AC9A 3PCRB 1Q20A 4YDHB 1W0JD 2GJAA 2Z4SA 5EZ5A 5FPHA 5AUQA 5EZ6B 2RGEA 4XWKA 3GQBA 3FTQA 4U5XA 3KKMA 4DRZA 3B1WA 1G21E 2O8DB 4HDQB 4TQAA 1JXMA 1JR6A 2ORVA 4GI7A 4KXFB 5G41A 2ZRAA 1P5ZB 4Q9IA 1XMJA 1X86B 4TZ6A 4HAWA 4RFSB 2C5LA 2ANBA 4ERNA 4DEYA 5KDLA 1WB9A 1TF7A 2IA5A 4OHVA 1E1RA 1E4YA 1G1MA 1OYWA 4PSVA 2A5DA 5E3HA 3K0SA 4XOIA 1ESNA 3H0KA 5JWOA 1IN7A 2I4IA 3DKVA 4TT3D 2NO1A 1VCOA 2KWIA 3RDPA 3L8YA 4TLAA 4BECA 1N5KA 3K09C 3M6AA 4LJ9A 2X8AA 2ZRCA 5FPYA 3S1AB 3EZFA 4GZMA 1G5RA 4BZQA 2XNSA 3D8BA 3PUWA 4C0HA 2REBA 2YWGA 3D7MA 3PITA 3RS5A 3UANA 2JCSA 3CRVA 3IBYA 3P1JA 3BFKA 1QHGA 2W00A 1WP9A 2ZSAA 1JAIA 2QG6A 4TYPA 3VX3A 1O3YA 2VP0A 1QVRA 3BJIC 3GLHE 3AV0B 1MO4A 2G0NA 4IOJA 2PCJA 1CULC 121PA 2E87A 3GCGA 1ZU5A 2ZI9A 1CJUC 1GRRA 1S0UA 3LY5A 4AK9A 2A5GA 1F2TB 5FTJA 4DCVA 5LB4A 4AYWA 4FMDF 3UKDA 4AWXA 3PEUA 5D3MA 3ADDA 4JLJA 4TLCA 1NMZA 3AF1A 3A36A 4CT5A 1U98A 4NPHA 3GJ7A 4D4LA 3GFOA 3K0AB 2DBYA 2J3EA 3CNOA 4JBWA 5DIFA 1GOTA 2KBEA 3ZGXA 3CF0A 2P6UA 4URXR 1HQCA 2NGRA 1UJ2A 2GCNA 2P5TB 4RD1A 1ZP6A 4B32A 1KNQA 4A36A 1X8KA 2IBMA 1YZLA 3BH6A 4CEIA 5KPJA 4KHZA 5JBQA 4N3NA 1IJFA 4PANA 1FPMA 2KE5A 1E9EA 5TV2A 1E69A 1N6IA 4PPQA 4V0MA 3EZ9A 1EWRA 4ITRC 1P73A 2C04A 4G5QA 3WY9A 2VHCA 2XJ9A 4QKQA 1NVXQ 3C5CA 5CDFA 2J0QA 3DMDA 5H68A 3LBIA 1P60A 2H18A 3MCAA 1KI1A 2J0UB 3THWB 4PO9A 1G8FA 1A4RA 2A5YB 1QF9A 4Q4HA 3BORA 3NVAA 4OQNA 1G6HA 2DYKA 4OKSA 3NC0C 5DI9A 3B7GA 4AYXA 4EKDA 3R9IA 5F98A 3QY0A 1R5BA 3DPUA 2A3RA 3CWZA 1Z29A 1HA3A 1NBME 1IN6A 1XCMA 3CX8A 3AEZA 1KDPA 2ZI4A 3O8RA 4D4JA 4BEJA 2F9MA 4ZI3A 3DZ8A 4FMCB 2QQ0A 2GEVA 3ZDQA 1BYUA 1O87A 1XZPA 1ZIOA 3NTUA 4TLDA 2OV2A 2ZS9A 2A7QA 1Z6TA 4PPGA 2VA8A 1F48A 3NG1A 1TF5A 2KB0A 1R0ZA 3GLIA 3TR0A 4RD0A 4OL0A 3PENA 2HJVA 3KXIA 1OFIA 1IAQA 4FN5A 2QSYA 4BUJA 3L8ZA 1JB1A 4PXAA 3U3KA 3U6KA 2D3WA 3VMFA 1Z63A 3Q7PA 3DEFA 3BC1A 4KJZA 3KKPA 1YZGA 5HZHA 4UJ3A 5FFMA 1XTSA 1II9A 3IHLA 4D0GA 3T12A 1CS4C 1YR6A 1VCNA 4UKDA 2QBYA 2CVHA 1ZU4A 4F7WA 3X1WA 3V4RA 5FBWB 3EW9A 4B2PA 4G0NA 4WOPA 2JGNA 1RZ3A 1LY1A 3SZRA 2OLJA 4ZIRB 4KVGA 4NCIA 1KY3A 4QBHA 3GJ4A 3U61B 3OZXA 3GJ0A 2VLIA 1MO6A 4EPTA 1XTIA 2C99A 1G7TA 1DAHA 4LPSA 3T1OA 5BW8A 5CLQA 3A58B 4WZBE 3KJGA 2WV9A 1G64A 4XSHA 1TX4B 2IYYA 4IOLA 3ZLJA 1RRPA 2YOFA 4GOXA 4CDGA 1TUEA 1SGWA 4A0FA 4C0LA 2B8TA 3KZ1E 2MMGA 4HLUC 3B1ZA 4Q1BA 4Z1MA 1U0JA 2OM2A 5C4MA 3ZVRA 4B3CA 2ATVA 2PT7A 3RRZA 1L2TA 3K70D 3L0OA 1X1RA 2IXGA 4S2EA 4O25A 3AVQA 4D4MA 5GVSA 5GADl 1T5LA 2QORA 1N6HA 3AF4A 4LV8B 5EXSA 3TIFA 4G5GA 4NCHA 5CM9C 4DCUA 1OB2A 4IW3B 1MKYA 1Z07A 5KDDA 2ZJAA 4PSAA 1YZTA 3HJNA 1SXJA 5C18A 4HSEA 3TE6A 2IXFA 1OHHD 4Q1EA 4Q9HA 1VG1A 4XH9B 4XTCS 1P6XA 4Z1MD 1D9XA 2P2LA 2WHXA 3ADKA 3W5JA 1A2BA 1T91A 2FPLA 1OH7A 2GJ8A 3UMSA 3PG5A 1W5SA 4Q4JA 2RGDA 2WPDA 1NNEA 2ZYUX 4JVNA 3LX5A 1BMFA 1TEVA 1MO3A 3BXZA 4MRRA 3KFXA 5K8LA 1ZNWA 3N5CA 4B44A 2PLFA 3QF4A 1OFUX 3DO6A 3KUDA 5J4VA 1OW3B 1IOZA 1XPRA 4ARZA 1W46A 3EIEA 3LRPA 1E32A 3AVWA 1T0HB 4TMXA 1XJQA 4DSUA 4HAUA 3QBVA 4MRPA 2ZJYA 5EXPA 1SXJD 2O8EA 4A0GA 5FUVA 4M9SA 4YXWA 2D62A 3QF7A 4DLRA 3EC2A 3KQKA 1OPXA 3B1XA 4EQ6A 1ZM9A 2AWOA 3VNVA 2QROA 3CRW1 4LJ4A 4D0LB 3LVQE 2B92A 2OCBA 1QBKC 4F93B 3JVUA 2WPDD 3MD0A 2P3SA 1T8UA 4BGDA 3RRMA 4G5SA 3GEHA 4M21A 4GFDA 4JL6A 4QGHA 4AIIA 2O8FA 4Q9JA 4M1MA 1XTQA 4TQ9A 4XVUA 1XCPA 3T61A 1CTQA 2O0HA 4RZXA 2AFIE 1YZQA 1YQTA 3VNUA 3AM1A 4TSFA 3WMEA 2BKUA 1D6JA 4V0ME 1EGAA 2GZAA 4TYYA 1KSGA 3I8SA 1VYTA 1D2NA 1MO5A 1R4AA 1Q12A 1GDDA 2GAOA 2ZRJA 2OCAA 4HDCA 1E0SA 1PLLA 5CDFE 1ODFA 3U7HB 1KYIA 3HP1A 2QAGB 1X8JA 1IJEA 2OXRA 4PPFA 2PX0A 1S9DA 3C5HA 4X8MA 2WJVA 4KV9A 3EPHA 2IUSA 4B76A 4NONA 1ONBA 3IIKA 4LHZA 3EA5A 3QXSA 4HUQB 4TSFD 1VYUA 3P26A 3VR6A 4WA7A 2DFKB 4XWAA 4OHZA 2GXSA 4BFVA 1E1QD 1CR0A 1QHYA 3WBKA 5AUOB 1KAGA 1U2RA 1XXHB 2FE4A 2X2EA 3QPVA 4TN1A 5CIQA 3GLIE 2O8DA 2ZITA 4WXPA 2CL7X 1H8EA 4QNMA 2Z6VA 3F5FA 4QNRA 2F1RA 4FW9A 3B60A 2JLSA 4URVR 1JR3A 1GAJA 4LBVA 5EE5B 4L8GA 1RKBA 4RFSA 2WWXA 1UFQA 2DFNA 4QGFA 3A1WA 3UWOA 2F55A 4UNQA 2YHSA 5J4HA 4NYJR 3WMGA 3FHCB 1SVMA 1ZUNB 3OIVA 5L3RA 1WDTA 4CZ2A 3QKUA 4V0OA 3UMRA 2CL0X 2H92A 2FOLA 3VHLB 5H8WA 2VRWA 5KO2A 1VG9B 4M9ZA 3T5DA 1E2KA 2ZSBA 1H8ED 4M22A 1E79D 2VIIA 3CIOA 5JMTA 1W1WA 2EU8A 4ACAA 1XEXB 2GXQA 3FKSA 3EPLA 4ZDJA 2C9YA 1JR3D 3X1YA 1KOFA 4QBFA 1BO6A 1J99A 2P6NA 5DI3B 2BBOA 5GJVC 3D6TB 2FGJA 3TMKA 3QENA 2IYUA 5D3MB 2RGBA 3SJCA 4OK6A 1XRJA 3PEYA 1QHXA 1M74A 1RFLA 3VU9B 4BFYA 5AWFC 4B3GA 3PUYA 1F2TA 4Z8XA 1N0VC 3W9YA 5FPKA 4DB2A 2NMVA 2GA8A 2AWNA 1K5GA 1UM8A 2DWOA 4IXMA 4L5BA 3RS7A 4KI0A 2CHGA 2QY9A 4DC9A 3A4MA 4ZCIA 4Q4LA 4A8JC 1Z47A 3AVYA 3QQ5A 4GOKA 3FKSD 2FSIA 3SJAA 4B3XA 5EUQB 4NYIR 2DWQA 4OBEA 3EC1A 4PZLA 1AQUA 4PFSA 2IYLD 3IEUA 5SZKB 4LY6A 2WMOB 4XD7D 4MITA 5FUYA 1YZKA 2ZRGA 1VCIA 1U99A 2IWRA 3SYLA 1JALA 4XVQA 5EP2A 2GESA 1AJEA 2GXUA 1SXJE 4M1YA 4H9GA 1EX7A 4AY2A 4H1UA 2NQ2C 2G0TA 3B1VA 2DY1A 3SU8A 4YDSA 1E2GA 4B3BA 3CRRA 1I4DD 1S8FA 1SVWA 3Q5EA 5CB8A 3QSYA 3AGQA 3ICEA 4JLAA 4OJKA 1II8B 5CJ2A 1UBCA 1AN0A 5HKKD 5DH9A 3G82C 4B48A 4KYIB 5CJPA 2J0UA 3THWA 1ZNXA 3EZ2A 4A2WA 3THXB 3U2QA 4E07A 4EPXA 1I4TD 1M7HA 3CF2A 1EFHA 4CW7A 2PX3A 4MGIR 1GNQA 4EDHA 2NO9A 1M34E 1PUJA 3BERA 1U9IA 2ORIA 4P4UA 4KAXA 1KI3A 4JZKA 5DGXA 2JJ8A 4IOKA 5FOVA 1V5WA 3NDPA 3RS2A 1SKYB 2NOAA 2GZHA 3T34A
chains in the Genus database with same CATH superfamily
1FFAA 1I9CA 1RWMA 2XUZA 1MUUA 1PSZA 2CK3A 3MVEA 2ZU0C 1BGWA 1JJAA 4FINA 1X38A 2J3KA 3I5YA 3ST7A 2ZTVA 3GUZA 4IBOA 3BFJA 1OX4A 1X80A 2Q4OA 2WIAA 3CNLA 1IN4A 3MTBA 5CURA 1U28A 2PUAA 4MQEB 3KOMA 3Q8WA 2QRVB 3QWHA 4LRYA 5BVGB 4OX9B 5LA6F 5BR8B 2W2XA 1X1SA 2M98A 4AO7A 4IRXA 2R85A 4FR0A 4C5BA 2DE0X 1ZOIA 5FR1A 2XBUA 5GJCA 3IPXA 3OPYI 1SHLA 4NR0A 3W5IA 1Z3IX 2ZPTX 4OQXA 2C7PA 2PX4A 5DEOA 3ESYA 3RG8A 3LQFA 4I2VA 2RJOA 5EQFA 1S1MA 3CSSA 3R0XA 4KRGA 5IHXA 1NE2A 2WYIA 3CPSA 5F9FA 3T7DA 1F20A 1MJGM 1N2ZA 3ZK9A 3HTXA 2I2BA 2VO1A 3BBPA 1XPJA 4MR7B 5BSGA 5HKBA 5IJ9B 2ZYTX 4ZCLA 1JQ5A 1FL9A 3E8XA 1Z28A 1O94A 3HVJA 1KH2A 1JIQA 5EQJB 1I80A 2A57A 2OCKA 1EVYA 4QIHA 2OM6A 1YIAA 3EXHB 3TGWA 1EK0A 2XUIA 3WADA 4GKJB 2V74B 4LVUA 3DKPA 3HYCA 5AJVB 1UBKS 1YU9A 3E9RA 2JVKA 3KPYA 2IE0A 3HS3A 4FSXA 4NOJA 4TMZA 3ZHVA 1IY9A 1JDTA 4P7KA 2YZNA 2HWUA 1SK9A 4QTUB 4LC0A 4RXUA 1YBAA 4QDZA 3BWDD 5ALMA 5DX0A 1UDXA 3FDZB 3INTA 1KQPA 2RAPA 5B1IA 1OZ0A 1WXXA 2Y6VA 2FPXA 1UMDB 1FYWA 5CLIA 3DP9A 2G8LA 1JDVA 1X70A 5KYWB 1P61B 1C80A 1R3DA 421PA 3SX2A 1A9RA 1E8DA 5EHQA 3IAAA 3VZSA 3IEVA 1ZOOA 3Q72A 2OT3B 3KYDA 3HXPA 5AVWA 5D7BA 1EG7A 2J09A 3W2TA 3PNOA 4OB6A 3EIQA 3FF1A 1PKEA 1TMKA 2Z1NA 3R3HA 2DVMA 4MX8A 3ZCSA 1TQDA 4XCXA 2AE1A 4W63A 1NJ2A 1T8YA 4LMRA 5CRIA 1N5IA 2YZGA 1BH6A 1NW8A 2WLSA 4WV3A 4C3ZA 1C50A 2P6PA 2V4ZA 3UPDA 2Q49A 1XMVA 2MDTA 1PD0A 2X22A 2YVUA 5A9RA 1LS6A 3FTDA 3NTQA 3VO9A 3FNQA 4KPGA 4R7GA 5C7LO 3W05A 4FX2A 1ZD8A 4YRIA 3SYKA 1NI4A 4OBWA 1P80A 1IJBA 3E1KA 4DSZA 4A4DA 4DLYA 2X13A 1R88A 3S1SA 1P5FA 3NBXX 4K26A 1RHKA 3EFOA 4HV4A 1OJ7A 2WSSA 2ZYIA 4UDXX 1K7SN 1V8BA 2AG6A 1FRFS 1A2OA 1SQSA 1TF2A 1F8XA 2V7EA 2WWRA 2ZYRA 3KWFA 4HLCA 1SUWA 2RMKA 4MCHA 3UG6A 5JV5A 4MUGA 1KYVA 1JI3A 1SUFA 3NAQA 2OWDA 4Z0TA 1B26A 4G23A 4M7WA 4CDNA 1M0EA 3NKLA 5ENZA 5LXTF 1SG6A 1U1EA 3EA0A 3GROA 3AVUA 2P2NA 4UZFA 4MPRA 4OQPA 1NI5A 2P30A 1OKKD 1Q44A 3VKWA 1TLTA 2O14A 3U6BA 2RGGA 3V8NA 2FV8A 2XE8A 1PK8A 3CT4A 3ESBA 4JBYA 4UNSA 1OZAA 1YZUA 2AQHA 3FNBA 3HO1A 4HWSA 3H5RA 3IO3A 3BMOB 5FWAA 5HZGA 1R8YA 4W1QA 5H82A 5DK6A 4ETIA 2MR5A 4LYJA 4XLLA 1J1UA 1IZZA 4ZJZA 1K4MA 2CDAA 5C51B 4GBED 4WESB 1DFHA 5DN6D 3KQYA 4G0XA 2QZ4A 3AF6A 1C81A 4URUR 1YFZA 5FF9A 2ZTUA 3VXKA 3NKVA 4XPZA 3K9GA 2ZI7A 3RC2A 1DIRA 4GGMX 4LHWA 2G6BA 4WK0B 3U1TA 3TBKA 1XK6A 2XLCA 1S3FA 1TMGE 2VF2A 3H17A 4MP8A 3CE6A 2DR2A 1N5RA 3AFNA 3EZ6A 2AN4A 3PT5A 4RXMA 5CYPA 4RE6A 3RE1A 1WZ2A 3E6AA 1JJ7A 3ZIDA 2ZU6A 1DQSA 3G0HA 2Q5OA 1M1NA 4IKPA 4RGVA 1FRVA 2NSHA 1MX5A 3JVDA 1SIUA 1V43A 3F0TA 3FCYA 2P3QA 3GFGA 3OY2A 5DLPA 5C8DA 2VQFB 2VTKA 3L4KA 2PUVA 4LJSA 3R7WB 1NFRA 2F1OA 3AHCA 1QQBA 3K96A 4HQLA 4PW0A 3VSCA 4KNWA 1ZI9A 3E8MA 1F0NA 3ELDA 2VPYA 3SE0A 3GRPA 3OIDA 4EO7A 2NU7B 3ZK8A 1P0MA 1PT9A 1QIGA 3I9MA 4GQIA 4BFWA 5I7SA 1EE1A 3OG9A 4CM6A 2YS6A 4EMBA 4HZIA 3MERA 4TLBA 3TTSA 2Y1OA 3WKAA 4D57A 1ECPA 4BS9A 1BKYA 1MN6A 4HGZA 3B3QA 3P52A 3ZWMA 3TUIC 2ACEA 1CY2A 5I9SA 3TQRA 1XQVA 1C9EA 4RZIA 4E0BA 3PXGA 1W36C 5CDHA 3WNQA 1ADGA 2QSZA 1X0VA 2Z4RA 2BFBB 3Q7QA 2PR2A 3SEZA 3E4CA 3WG9A 5A1JA 4H0CA 2YINC 1VJ5A 3EBPA 4PX2A 1OVMA 5CCEA 1V0JA 3N2EA 1OI2A 1XXHA 4PYIA 3AVOA 4C07A 3PEWA 2M9MA 3GEDA 3PR1A 4PC3A 1E0JA 4BKOA 4TLEA 4BFUA 4D99A 1THZA 5H4HA 1CYEA 1ZD1A 6NULA 2EFHB 1LPOA 1A9OA 1TZCA 1L8XA 1P72A 4NVRA 2LKCA 4M0EA 5IBQA 3QVTA 1OROA 1I1NA 1KEVA 4HS9A 4KN6A 4GYJA 3CVYA 2DCUA 1UJCA 4IDQA 3V2HA 1JIXA 2MSDB 2NG1A 3GNSA 4LWQA 1YRBA 4OHXA 3Q10A 4KN5A 1JG2A 2O6HA 1DKNA 2YX1A 3D8SA 4RF4A 3EVCA 3W1WA 2JLZA 3LUCA 2QPLA 2GTHA 4TV8B 1ZEJA 3U1BA 2C2ZA 1GSAA 2ERXA 2RSLA 2XUAA 4YGXB 3GLFE 1XZEA 2PUTA 4ZKEA 4MWTA 4A8TA 1QGUB 2GILA 1SA0B 1ZHFA 3K3PA 3NZEA 3DDCA 4NKRA 4TS1A 4DMLA 2R4UA 2WHPA 3T7SA 1ZKDA 2CKMA 1N8NA 4NS4A 2P68A 3L0IB 4XKJA 4H16A 1AKVA 1UFKA 3H6KA 4R9VA 2WF8A 1I10A 3ZXYA 1FVXA 1R6UA 4LC1A 3ZW9A 4CODB 4P80A 4XFKA 1FRQA 3MWDA 5K0CA 2GEBA 4EYKA 1DO0A 1MC1A 3WV4A 4KGXA 2YJ5A 3DDZX 3KVRA 3L0CA 3QWFA 2P5YA 4BP8A 5B55A 2QK4A 2PJDA 2QV0A 3RF6A 5JXGA 2X1VA 3TLKA 2ZSKA 3BMNB 4JEIA 4BDTA 4JZYA 2AJ8A 1MF7A 3LV8A 4G1FA 2VHWA 2C3MA 3AVPA 3HU5A 4K81B 4L6AA 4ZODA 3JZFA 4CKXA 3EEYA 3TMYA 3DV9A 4LBYA 2R6DA 1PK7A 5BSHA 5JYCA 1K8XB 1ODCA 2TMKA 1SVIA 1G7SA 1SOMA 1Y1PA 1TRHA 4KVAA 3J7TA 2R65A 3WIDA 4MWBA 4DMRA 5LQRA 2D5LA 2Q0SA 4NJEA 5L95A 1K8ZB 3D1VA 3SFVA 3S81A 2ZXUA 3EODA 3FGNA 3N3AC 2HF9A 1SFRA 3BDAA 4BV2A 1ZGCA 2WPNA 2DLNA 5EAIA 3ZQUA 1E5VA 4B0OA 2YWFA 1EFDN 1Q3KA 2CNNA 2WWFA 3WRVA 3P2MA 4KFCA 2BELA 4KB5A 4RNDB 3O31A 4YMUA 2B21A 1UJ4A 2XMGA 3KKZA 2B8WA 2WSLA 4B5KA 3HJGA 2GJ9A 3PZRA 4YMHA 2NYRA 4WI1A 3JQCA 4HDNB 6REQB 2C7RA 5EIFA 4KQ9A 1SUBA 5FBKA 5JAHA 4MVJA 3HRKA 3PTAA 3OD1A 4YJ2A 5ER6A 2F64A 1U5CA 3QX7A 1NHWA 1Z35A 1YFKA 1LNZA 1O5IA 3B7WA 4I3GA 5L53A 2J67A 1II8A 3AM5A 1F17A 3GFFA 3AKDA 4B85A 5LQDA 4KR3A 5M34A 4Y2RA 5KNCA 1KWKA 5K8VA 3E70C 4BBZA 3THXA 1CUYA 3VNBA 4GMGA 2NZ2A 5JDCC 2AOWA 4RTSA 4QGGA 3R5FA 3R75A 4I9FA 3CF6R 3AINA 3FA2A 2ZR9A 4RHFA 1DS6A 4U4AA 4JCOA 1T5TA 4WLEA 1V95A 2XDYA 1OI3A 4DC0A 3RUFA 4D46A 4OI0A 1D6NA 2BM1A 2BM0A 3LGAA 1XMSA 4YMWA 2D5IA 2PG3A 5AW2A 4AY6A 2OSVA 1X80B 4B7ZA 3QY9A 4FKZA 4DPLA 4N8DA 3QVJA 3N0RA 4OOEA 4RQTA 3NHYA 3OQOA 2IHJA 5AI8A 1LW7A 1QYRA 2XTNA 2QD2A 3D6HA 4PTZA 3QYFA 4ZKDA 4JSTA 1E8NA 2MWMA 3ROZA 4WXRA 1S9HA 2ODPA 1OLXA 4HZUA 4MRMB 3IT1A 1Y37A 3LCJA 1XZIA 1JEJA 1QKJA 1V16B 3C39A 4V0NA 4EPWA 1Q74A 1Z2PX 2PWYA 2GRJA 3RJ9A 5F7JA 2H1CA 1IEXA 1XZ8A 3DYIA 1NAHA 4B1FA 2VXCA 3PFIA 2FQQA 1GG9A 1PL0A 2IQ5A 2XB4A 4ZDWA 5IC4A 1PR4A 3QU2A 5F4ZA 1AGPA 2QVYX 3B5IA 4ASUA 2RHBA 1X87A 4U39A 4D4GA 2HXYA 4R8KA 2JVIA 2VHVA 1FIUA 4HAYA 4PFJA 3UMBA 4MVXA 3PNSA 3EVAA 1RJEA 3Q87B 5TY0A 4DRXB 4MIYA 1LQUA 1P19A 5KMGA 2BHLA 2IEGA 5FI1B 2KYRA 1TEZA 3C97A 2PUHA 2LW7A 1R0RE 4DCMA 4WY5A 5KEIA 2IBTA 4GM0A 2IBSA 2HCTA 4BVBA 3L0SA 3ZV7A 2XCIA 2LGJA 2ZT6A 3GPCA 5A9TA 2XVAA 3TKYA 4DHEA 2NM0A 4P34A 3CLVA 1J8VA 4IIHA 4XEHA 5J9FA 1CPYA 2LKDA 2WF7A 2WY2D 3ROEA 4V3BA 3SXJA 4UREA 3QTBA 4GD3Q 3JQ9C 4L7QA 3LC7O 4RCZA 1PZMA 4L22A 1DEOA 1DTSA 4G89A 1QE5A 5CTJA 2DEUA 3WJ1A 1S3GA 3QLJA 4DA8A 3NHLA 4JY7A 4FR2A 5DASA 3MXOA 2O3UA 5LYJF 3NB0A 4ZQGA 1JG7A 3KYDB 1RHMA 1NUQA 3V4VB 5KVAA 1IG3A 3IQXA 1JHYA 1QZZA 2DQKA 3C7KA 4G01B 1NSFA 3UV7A 3A1DA 3GRYA 5FWXB 2ZREA 3BWBA 3C5VA 2OBBA 1Y5LA 1GZUA 1L5HB 1QP8A 5D6OA 1SN7A 1WZCA 2QY6A 2WZCA 3P5SA 4F72A 4LHYA 3GGGA 2ZCJA 1ZXBA 2OFPA 3BGIA 1SVOA 2QAJA 3U7IA 4IXWA 3NHFA 1VHTA 5JQGA 4R1TA 4E7PA 1TZJA 2ZWAA 3TQOA 2FN4A 4LJ5A 1E7WA 3TDMA 3E2PA 4HQKA 1NI4B 3WFJA 2IUYA 3R7AA 2W4MA 1CJKC 4EA8A 2AW5A 1T2EA 2JBAA 2LZ0A 1AS0A 2GRUA 2VCEA 3HRIA 1DTWB 3LKDA 4OMFG 1YRQA 2REXB 4UUPA 1G0NA 3HPQA 3CUEF 3RC3A 1CR2A 1IMOA 1P7CA 1N5DA 4IDDA 3UJ8A 1K5HA 3N87A 4F8EA 4Z7JA 4NU5A 1OZFA 2R48A 5KU7A 5ISMA 4TQUS 3SMQA 1JU9A 5D8DA 2W2KB 3SC6A 4IVPA 3K92A 4JLWA 2VZEA 1SQ6A 2I55A 4Q7LA 2EG5A 3B3AA 3C0KA 3M4NA 4RKWA 3WRXC 4U2FA 2E6KA 4K6OA 3SDZA 2Q45A 1SD2A 3A27A 4P3KA 3RWBA 3UHPA 1S2LA 4DKXA 1U5BA 3O83A 3LCCA 1VMEA 4TXLA 4A8PA 2ZUFA 1CF9A 2P11A 5FUXA 3VH2A 2OFWA 3SPXA 3L1IA 3Q3CA 1Y4DE 4KYVA 4R51A 4HATA 3PD1A 2GLXA 5KDOA 5J2TF 4MV8A 5C2JB 2ZYWX 4JP3A 1WTCA 1H9BA 1V3UA 1YTLA 3ICVA 4JR2A 2VP2A 2BYTA 4HZGA 3EFEA 1PR6A 2ACVA 3FVQA 2E48A 1MP0A 3C85A 1VLJA 3OZ7A 5PNTA 1I2BA 4PICA 1YH3A 4LGMA 1NW7A 2QF7A 3RANA 2IY9A 4PGMA 10MHA 1KS2A 1R7RA 4RJTA 5JXHA 2WYOA 3CTPA 3REFA 1PT8A 3ZDZB 4NXNB 3ED5A 1E20A 4KTTE 1ZJ6A 4R41A 5JXWA 4EHNA 3W77A 2FDCA 3NOXA 4P3XA 1UXOA 2Q1TA 5E6RA 2F43A 2NU9A 4EKYA 2B2NA 4IH1A 4QSHA 3OEEA 5E9WA 2GPTA 4JI8B 3F9CA 2Y9PB 5AI5A 5TLSA 4ZQBA 4EFKA 5A6SB 3ZIUA 1ESCA 5LYYA 4MSUA 1R6BX 1QFYA 1QO7A 4OH7A 4A6PA 3RRNA 3IT3A 5F7XA 3IELA 1AKTA 5B58T 4QA9A 2R1TA 3UUFA 1RJDA 3LG2A 4D4IA 1VP9A 5IAEA 4GT1A 3LLCA 3KT3A 4EUHA 2JLQA 3GEMA 3W5CA 2XX3A 3X1DA 4H2DA 1NPTO 3QMVA 3DZHA 3SS8A 4AU1A 3HJFA 1KVUA 2ADMA 4PNHA 3FTNA 4EYGA 2P9TA 2NIPA 2I3GA 3COPA 4RL4A 2WM2A 2Z5FA 4OXXA 1WDLA 2Z6QA 1O5TA 1VMAA 4XAQA 1F1BA 3A6JA 4YK7A 1G5TA 1JQKA 5A6VA 3C41J 3VUFA 3CR8A 2EDAA 3THYA 1JJFA 4LYHA 1FRNA 5IT4A 1SKYE 3I1IA 1IOLA 3RTGA 3KB6A 3UH0A 1IPHA 5FHRA 3TAUA 3B1FA 1GQYA 3HKBA 1E9FA 2PZFA 1A72A 3BJRA 1Q92A 1Z25A 3KHTA 5C1PA 1XCLA 5K3FB 3CU5A 5K51A 4MUHA 2GM9A 4OQQA 3SZMA 4HR7A 4BNJA 4LRQA 1P6QA 4ND8B 3LOQA 1N4AA 1IY1A 1AVTA 3AHIA 4FIDA 3N74A 1NDQA 4B6QA 4F46A 1Y8AA 3IT2A 1H66A 5IF3A 3A9WA 1J9GA 1SQFA 2IYFA 3KJHA 2ZSDA 1A9QA 2ARKA 2YHAA 3A10A 3INYA 4JELA 4NARA 2J9ZB 4C4ZA 2X77A 2EF0A 3NATA 4PQFA 2VP4A 3OTWA 3OIUA 3PEVA 3VPHA 5BN3A 2XB9A 3JSXA 3KKKA 1ZCBA 1QZUA 1R10A 1ZH0A 4OFXA 4US0R 2PXAA 3P9XA 4GL4A 4UZSA 2WHPB 3EGDA 4LYGA 3IJEB 4ZT4A 2YHBA 4J0QA 1F12A 5L4NA 2WM8A 1IQPA 3A0UA 3ZDYB 1TVCA 4XUGB 5C80A 5LD2B 1EUQA 2CUNA 4Q7EA 3QLTA 3R9WA 3MWDB 2GVNA 1U2DC 2LDBA 4RGQA 1GPDG 1NJ5A 4FGJA 4HGRA 3U5TA 3UQYS 2G04A 2JIBA 2E5FA 3PI6A 1Q57A 1JBEA 3II6X 5E6UA 1MT0A 4IJUA 4F3YA 5A5GA 2BKXA 1W88A 2W6JA 4B8ZA 5JD4A 2PMEA 4EMSA 4CIYA 4MVJM 4EDFA 2A5FA 3UV3A 2BLLA 1CZUA 4I1SA 5BW4A 3F96A 4LAFA 2H29A 2QTZA 1HMPA 2JFXA 1VJDA 1ZR4A 2HKIA 5HJ5A 2ROQA 1KP9A 1JQDA 1SB8A 4KR2A 4NJEB 4O29A 4JB8A 2Q9UA 3PNQA 5EWJA 1R6VA 5BYKA 1AA6A 1WCV1 2DWUA 2LNDA 5AJXA 4Q5IA 1BC5A 4B6EA 1G8PA 4REOA 3N6VA 3GXBA 1UDWA 4WXHA 2PUDA 1XTJA 5SY4A 3QVOA 3RT9A 2UXBB 3A6EA 1AUOA 2OHGA 1WRBA 3FCSB 2I6UA 5I01A 4MKRA 2UYYA 5AESA 3FCXA 2VA9A 5EZSA 4YRTA 3C8MA 2XYGA 4Y6OA 1AKNA 1WW3A 1AMNA 1NP3A 3FVVA 1INLA 2QDXA 1Z4KA 2RGUA 1U8UA 2XQGA 1LX6A 1ENPA 4Q4AB 1JPNA 3VPDA 2CFCA 1I1OA 3TTUA 3U0BA 5AT1A 1D4ZA 1Z34A 4LOHA 3H4TA 1P7WA 4YYEA 2ZJ7A 1VPTA 3NM4A 5BSEA 4OHYA 2HIHA 4RV5A 3TLAA 2GBIA 2VPPA 1BTOA 4DLBA 2DBVO 3ZEAA 4URWR 1CV2A 4DLSA 4MKIA 4PZCA 2EXXA 4I9HA 4FYWA 2YYAA 3ILSA 4QEDA 3V80A 2BTQA 1YS2X 5B7PA 1TAUA 1JKFA 5SICE 3HFSA 5GV7A 3OQ1A 4WD3A 4BWYA 4UOZA 4EFLA 2RKBA 5LKRA 1HT3A 1CP3A 1PT5A 4QFDA 4C05A 3DEIA 4X5OA 3RHFA 4ARBA 5H16A 2JD2A 1E58A 2W4QA 4BBJA 1O03A 1YBVA 2HF8A 5FR2A 4QFBA 5K45A 2WJJA 4HPJB 1H2EA 3M6MD 2AJTA 4ZFNA 3DBVO 3ETJA 2ABWA 2JAQA 3A04A 2XQKA 1CJVC 3QMMA 5BR7A 5G53C 4LUCA 1G41A 2E0IA 5FBRB 1NUHA 4RVHA 4YB8A 1M5UA 3PC8A 2PIAA 2FRDA 4ZC1A 1B14A 4FVTA 2NVUB 4KDFA 4BU0A 1E2JA 1CS0B 4MRSA 3DYBA 2ADFA 4MQ5A 4N8SA 3F74A 2GN6A 3T9CA 2WF6A 2J6IA 1F2UA 2IOQA 3BRCA 5E2AA 4JASB 3ZGYA 4GI3A 2GZ1A 1E99A 4HEA6 4ME6A 1CR4A 2CK3D 3PUHA 3SGLA 3UICA 3ZOKA 4C01A 3GU3A 3UENA 2AEJA 5HFJA 3W9BA 2BGTA 3TF5A 5ABPA 3BSFA 4FFPA 4DQDA 4Z7NB 5K99A 1UR5A 1WUYA 4XSGA 4YH1A 5KMGB 3JVVA 1E7SA 2YJGA 1JG4A 3M8KA 4RPLA 3FTPA 5C81A 2G40A 4AM8A 5DYGA 1ZEMA 3CEAA 4L72A 5GZ3A 4ZYYA 4JQSA 3A3YA 5F9MA 3HR7A 3KSMA 1KO1A 2EKQA 3VDQA 2GJKA 1BWQA 3UQZA 1CY7A 2OORC 4X91A 1FFXA 5BWBA 5MDHA 2C42A 1SBHA 1SWVA 4BJ6A 2BEVA 2Y4OA 5KC8A 3LUBA 2XYHA 1MRSA 1NUAA 1OFUA 1T8PA 4YO8A 4YRQA 1T5IA 5H70A 3UHFA 5BN5B 1TVKB 5BMVA 3KLBA 5DXAA 4GBGA 1ZINA 1YDHA 2ZRDA 3H83A 1EI9A 2NNLD 3WB2A 5KYUB 2FETA 3W90A 3P9CA 4MW0A 1PT7A 2ZT8A 1GTJ1 5CFMA 2DUJA 4MGEA 1J0DA 2AI3A 1UAGA 3I2GA 3K30A 3PFBA 1U80A 5D84A 2X4IA 4C6RA 1O94D 4EVIA 1RRFA 5EJ5A 4XVCA 3AFGA 3RPEA 1NG1A 3P96A 1DIGA 1KJYA 1BDBA 1M6VB 1XTTA 1DV1A 2FVXA 1E1CA 1GG5A 1S02A 3I2FA 1GV1A 4K86A 4JVLA 3HWSA 2H7XA 2ZBDA 3HBAA 4DUGD 3M6LA 2BFEB 3PJFA 1EK6A 2BJWA 1KKLA 2P4SA 4MDHA 3KSZO 4TZKA 4Y18A 5IVIA 4CT0A 1K6JA 1TOAA 5JQGB 1M2VA 3FMPB 4IMJB 5LLSA 3TQQA 3ZZ0A 4EWLA 2H06A 4MVCA 1WQ1R 2I2DA 3GC6A 2Q4TA 4JYZA 1O0BA 4B82A 4P7FA 2FUKA 2A9KA 3PVZA 4RQUA 2JIOA 5JR3A 5FUQA 4EJSA 5AVUA 3RJMA 3GZ4A 5IMSA 1P4GA 1ZIPA 2ERYA 3RKSA 2BMDA 4RK5A 1G59A 3KEOA 2J31A 2CDRA 4JV5B 5C34B 3RFXA 1XD2A 3RS4A 2IDZA 2C4WA 4A15A 1BROA 3MF4A 2ZZMA 1EWQA 2CFSA 1HKHA 3BAFA 4CL8A 1C0LA 3AG5A 1RBMA 4ZOEA 3LXXA 1ZVJA 3PWTA 1G19A 2ONZA 1FP2A 2V3WA 3CC8A 3INGA 3O84A 3RJTA 1RTTA 1PEAA 3HUTA 4EVRA 2HQOA 1YU6A 1SJ9A 3G5UA 3OMWA 3QBEA 1MB2A 3LPAA 1OFGA 3TB6A 3HUUA 1L7OA 1QDLB 4F3KA 1HM5A 1KHHA 3E3AA 3OFNA 4N9WA 5KTPA 1KMIY 1J0EA 3IALA 3E1GA 4WJKB 4BMPB 3X0DA 1M8JA 2CXHA 5IS2A 4G0PA 3HUDA 3EXIB 1DBVO 1QE0A 2FHSA 1OD6A 3DAHA 2UUAB 3GQVA 1KDOA 5DYNA 5FLKA 4MRNA 2OEPA 1WPQA 2FWIA 4AMYA 4DA9A 1RBYA 1VL6A 1BDHA 1E3DA 3WBFA 1E9SA 2GBLA 2PUJA 3Q2IA 4M1QA 3BD8A 1P4JA 2X76A 2CHFA 5I3ZA 2X4DA 1H0KA 1NBMA 1W47A 4PFKA 2XNDA 1NY5A 1GTMA 4LNUB 4Q39A 1TTHA 1JDPA 3QX9A 5A7GA 3AONB 4ZVUA 1TKBA 5E6RB 2BW0A 2F43B 2B7LA 2H31A 1WETA 3DE6X 3HVIA 3ZHOA 3CX7A 3HP7A 3MSCA 4BKPA 3DWIA 2J87A 3F1KA 4B6PA 1VRWA 1KL7A 2C59A 1USIA 2NW6A 4MYRA 1NKSA 4U7WA 4RHXA 3UAWA 3HSKA 1SKQA 3V4PB 4BCDA 2GH1A 4R40A 1HYQA 1ZM3A 1YK1A 3SKYA 2PXXA 3Q9SA 3TR5A 2YJ6A 1B15A 1RLMA 1TIBA 3VOTA 1DXYA 1VLVA 2N46A 1ZLYA 3LYLA 4WRRA 2MSCB 2G9NA 4BGIA 4J0KA 3NASA 3OT4A 3MTEA 3SQNA 2IPNA 2PBZA 3TFQA 2BC9A 3L0BA 4JLMA 5KQSA 1IAVA 2P4HX 2W6IA 3EDQA 2ZRIA 2RC5A 4EEZA 1GNRA 3H9CA 2QM7A 2Y2UA 1PZHA 5GGYA 4M9RA 4HYQA 4ZOLA 1BMDA 3EMDA 3P7MA 4YV7A 1LU9A 3W2FA 2XE4A 3COWA 3CZCA 4Y2TA 4DSNA 3THYB 2VWPA 3ZGNA 2M1XA 2Q50A 1QRAA 3IVCA 3Q1LA 3O1JC 2FUEA 4B71A 3E3LA 5ELXA 2XZLA 5SYMA 2GAIA 5J4LA 5EXEA 2WZDA 4ZV4A 5H59A 5E7MA 4KWEA 1CZOA 3RV4A 5CH8A 2IZ1A 4WZBA 1CUVA 4H6VA 2EGUA 1L7NA 1PDWA 2OGSA 2WVJA 5DISB 4W4TA 1QG0A 3U4IA 2KLHA 2QNRA 4FOTA 1UK8A 1RQRA 1T4CB 2XOKA 3KDAA 3VTFA 3GPIA 3D7SA 3M3HA 3HU2A 2GDJA 4J29A 1EFTA 1WOYA 1XTVA 2HQBA 1P9LA 5D87A 5NULA 3A05A 2CDBA 2JEYA 2PSFA 3BIWA 4MICA 1ZCAA 4AMVA 1ABFA 2PD6A 5BN3B 1ULAA 2GLUA 1NZDA 1C1YA 4X95A 3CLUC 5EP3A 2FEAA 4M86A 4BNLA 2UVPB 3Q9UA 1C3OA 3ZJ5A 1P4RA 5B4UA 621PA 5K0ZA 1DTEA 4Y2VA 2FMKA 3AEXA 1GPUA 3L2OB 3T1QA 5KQMA 4CJXA 3V4FA 3AIIA 4AF7A 3MM4A 4MJXA 3H11B 1PQ4A 2QN6A 1W34A 2PLWA 2XGSA 1YKGA 1R0CA 2IE8A 3F98A 2XY4A 2OE2A 4FDUA 4GPBA 1YS1X 1EVIA 5IN5A 4D0NA 1LBSA 4LOAA 4FFMA 5E6UB 1KOGA 1C3JA 1GKKA 1H3FA 1RE0A 2HD4A 1T0BA 4LZZA 5EMNA 2X6RA 3LQ4A 3UJDA 4G84A 1P0QA 4NDZA 2IUTA 3PE3A 2GEJA 4EYQA 3HU1A 3OFKA 4AN4A 1KO4A 3NNNA 3OQIA 3BJEA 4I08A 4I1UA 1CRWG 3IRUA 2ZLBA 1TCUA 3OLVA 2CXNA 4Z5XA 5K0GA 1ZMBA 1NL3A 4FEGA 4CRWB 1J7KA 4H6WA 2Y71A 1NF9A 2O2HA 4MS3B 4JLOA 4AVYA 4CQJA 3PQCA 3QVUA 4QJIA 2QU8A 3GBVA 4JLNA 2OB2A 4Q37A 3D5EA 3H8SA 4P81A 4RFLA 2NYUA 2XWBF 4YREA 5M04A 5G0SA 4G24A 1F8GA 4IDHA 3UHOA 1P9NA 3NHBA 1E3QA 2IZZA 1DNPA 2FN7A 3G9ZA 3QUTA 5C53B 3MYYA 1XMPA 3JQ6A 4Q3KA 4ROTA 5A4KA 3WGQA 4RFVA 2AS0A 4C2AA 2XT9A 4CQLB 1QOPB 1LK0A 2RKWA 3GMTA 4LHSA 1LDYA 5TGDA 2A5LA 2FPIA 1WXQA 1B73A 1UJBA 2NACA 3JWEA 4E2WA 4JUIA 4X7BA 4OMUA 3ERCA 4C3UA 3G0CA 4YIHA 2VSQA 5KWSA 4RC9A 4OOFA 2C8VA 4TKUA 1FSSA 2NU6B 1TCCA 3ORFA 4TL9A 2CMFA 2VYCA 4ZAZA 1K66A 1LRJA 1R1DA 2P0YA 1BQ3A 3WWOA 2Z9BA 1ZCZA 2ZYVX 1TLLA 3OC0A 2P9FA 1A7KA 1TYBE 1NR7A 1J4AA 2NAFA 3DYVA 1PV1A 2FFAA 1PGQA 4G25A 1U3WA 4RELA 2V3CC 3NFRA 3TSZA 1P2FA 2I87A 4YCMA 4HB2A 4HGNA 2DLDA 3GFRA 3R3SA 4EECA 5KOIA 4MUJA 4BO4A 3CZRA 4E14A 4LCEA 1DT3A 5ITWA 3THOA 1U0GA 1ONSA 4G5YA 1DOAA 1D09A 1TCAA 4UBJA 3U4QB 2HCRA 2PSDA 3WZMA 5LOVA 1R4MB 3T3DA 1E2UA 3LA8A 2PYZA 3DV0B 2EX0A 3NEPX 1PJBA 2IT1A 4K40A 4MS4A 3FGOA 4Q3LA 5BT9A 3WS7A 4DAOA 2V8BA 2JZOA 4OJTA 3PDJA 2VBGA 3A1NA 1GPJA 5DDIP 1FX0B 4L1KA 2OO5A 4D41A 2ZYSA 1Z6AA 1VBMA 4G4SO 1W4BA 1WEKA 4WFKA 4O4JF 1YZFA 5EHNA 5KNCD 4ODIA 5AKLA 3CVUA 3VTKA 3ZDCA 3W6UA 4KE7A 1L1FA 3MJCA 4L4XA 1I6KA 1PJLA 1ONOA 4P9NA 3KXLA 3T3HA 1TM7E 5DM1A 1WA5A 4F12A 3KXKA 4LHXA 4UM9B 1Z6QA 3FHOA 2QW1A 3AIKA 3OSZA 3FCUB 4FWTA 1KSHA 3GLGA 2NO0A 5H81A 3GNLA 3C45A 3RODA 3ZW8A 5AM4A 1UKBA 3P2YA 4LWZA 4XDGA 2XXAA 3ELYA 2XCRB 2HWXA 4GNRA 3PFCA 4OLFA 3JSAA 3FFBA 4LZAA 3W8FA 1J8QA 1BAPA 1L5GB 5FFNA 5IJAA 1DC4A 2DJ5A 2WK1A 3UAOA 1FLDA 5BW5A 2DQ4A 1T3LA 4QRDA 1W4LA 4CHTA 1IFXA 1OT3A 2YV1A 1D1SA 5BSVA 3ENWA 2NVOA 4PO8A 4YRAA 2CVQA 3HWRA 2CCKA 2IDJA 3E0QA 2FG5A 4K6GA 3V7YA 3V8VA 2NP7A 1YB5A 5FUWA 3KAKA 1R3UA 1Q1BA 1COWA 3P9KA 4L07A 2BEVB 1NVKA 3K6KA 3VO8A 3WK5A 5KJ1A 5KYXB 5EHZA 5C1IA 3DOEA 2C7VA 5BMVB 3G9UA 1GY8A 1H6DA 5ICFA 3WJAA 2I2AA 2WJWA 3HXKA 2I1VB 4UUBA 4UXJA 1RR6A 3PKJA 2I9PA 1HFJA 1RMYA 4O4IA 1Q6ZA 2QPOA 3L49A 3I4FA 4FP9A 3IXMA 2E4XA 5AW6A 2FR1A 4MA5A 4ASUD 1GILA 1OFHA 1TYCA 2E4YA 2PLRA 4UNNA 3FDFA 3L6BA 4IO0A 2P35A 3CCBA 2OHXA 3OQBA 1KZHA 3VC7A 3VHXB 4D9FA 3JZMA 4E4YA 1QU3A 3P19A 4Q9KA 3INRA 1E1CB 5LBIA 2VJDA 1QQ6A 2V7GA 4ZRDA 1P2TA 1OGYA 2H4WA 1HPLA 4AYTA 1A5AB 4LKOA 5EOVA 3P2EA 2HY7A 4FOOA 1B6SA 4HF7A 1LSJA 3MLEA 3W3ZB 4BLVA 3TTYA 5B2ZA 2Q28A 1USWA 2QD5A 4EJSB 3T7KA 2O2DA 4BQSA 5HIMA 2OBXA 4ZCPA 2EVWX 1CVLA 2FMIA 3BRWD 4O63O 4ECEA 1G20A 3SJBA 3QBTA 4YMTA 3ZV3A 4F9EA 5HZKA 2CE7A 3LBNA 1FYXA 1U0SY 3MOGA 4MYTA 3F46A 3E2MA 4MYDA 2D3TA 3GJYA 1GDTA 1GT6A 1QVVA 3W5HA 4ENPA 2J7PA 5G0VA 5EFZA 1L0BA 3CUKA 3AXSA 3G8BA 4NCXA 3DWFA 1M1YE 3C6ZA 4EFNA 1FLNA 3U9TA 3OE1A 3BXFA 4CG1A 2CNKA 2OLKA 1I5RA 2Y0DA 1KC1A 3I2YX 3WGYA 3ZDFA 4YJ3A 1GLNA 5FJJA 3G8YA 4AP5A 3HEAA 5K0NA 1RSZA 3V8BA 4EA7A 2GN4A 2WAAA 2SKEA 3KQNA 2YWDA 5AP9A 2BMWA 1DKUA 3WDKA 5LFAA 1TC2A 3ZVKA 4GMKA 3DVAB 2N75A 2XZPA 1T9CA 3FUCA 3I32A 5HQJA 5KSWB 3OQNA 4GZ6A 1V47A 4CMBA 3ORSA 2PAFA 3AM3A 4DUYB 1U3VA 3TX2A 4A03A 1KF0A 5JADA 2CNBA 1YE3A 3GP8A 1BH2A 5L3QA 1G8YA 3AR4A 1Y3CE 2BFWA 2XGMA 3JYPA 1DEKA 2J33A 1ZK2A 4OJQA 1CY4A 4A6DA 4E5YA 5JUWA 4BV9A 1D2GA 1Z6XA 1AZSC 1G17A 1NXSA 1SZDA 2R7MA 2RDMA 1ABEA 3KDSE 3WICA 2NUPA 4C0SA 4Q7QA 2UYCA 1CF2O 4RY9A 1XZJA 5ESRA 1D6SA 4V0QA 1E3EA 1NJ8A 5HXAA 1NLYA 1MIHA 2VEDA 3D31A 3Q6NA 1DHTA 2QS9A 1DO8A 5JAIA 2QUJA 1Z4NA 3K9LA 3HYRA 3ZZNA 3MSXA 4Q21A 3CB2A 3GWGA 1QJCA 4GPEA 3PNPA 2PLAA 1UJMA 3FMIA 3QTTA 2OTCA 2I54A 3QMPA 4KO8A 5EN4A 4ZVNA 5DHRA 5KOYA 2BF4A 3MRXA 4HDMA 5JC1A 3ZJVA 4REQA 4QOJA 2H57A 2P8SA 3GLSA 3H2IA 3GFQA 3RU3A 4BJHB 1FA9A 1K8RA 2GAFA 1PHPA 1XN1A 1YZ3A 2GTIA 2NXCA 2WG1A 2XA2A 3EIUA 1AKRA 4Z8YA 2B3TA 4HAZA 4DLPA 3QIAA 3R24A 4KXLA 3BEDA 5LZ5A 3IVGA 1FP4A 3AKEA 3FCEA 3LGSA 2ZETA 4KW7A 4JWKA 2JGJA 4QRHA 4RVNA 1P75A 2R2GA 4QPCA 2FW0A 3Q5GA 3D8NA 3STXA 1HORA 3WHKA 5K4HA 2QDKA 5F2EA 4JXZA 4F91B 4OTZA 5EUMA 5KNCH 5JJ5A 2IHUA 1TTTA 3Q3GE 3RYTC 3HKCB 1DKPA 1B2LA 1EFLA 1FNNA 1KY2A 2WHRA 3B48A 3OPVA 2H4FA 4KXYA 4WZBB 4S05A 2PWPA