3QVJA

Allantoin racemase from klebsiella pneumoniae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
245
Chain Sequence
b'SVRIQVINPNTSLAMTETIGAAARAVAAPGTEILAVCPRAGVPSIEGHFDEAIAAVGVLEQIRAGREQGVDGHVIACFGDPGLLAARELAQGPVIGIAEAAMHMATMVATRFSIVTTLPRTLIIARHLLHQYGFHQHCAALHAIDLPVLALEDGSGLAQEKVRERCIRALKEDGSGAIVLGCGGMATLAQQLTRELRVPVIDGVSAAVKMVESLVALGLATSKHGDLAFPEKKALSGQFQSLNPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydantoin racemase
molecule tags Isomerase
source organism Klebsiella pneumoniae subsp. pneumoniae
publication title Characterization of the Structure and Function of Klebsiella pneumoniae Allantoin Racemase.
pubmed doi rcsb
total genus 79
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12500 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3qvjA00
3DTVA 4FQ7A 2XECA 3IP8A 2XEDA 3IXLA 3IXMA 3EISA 3QVKA 3QVLA 4IX1A 2VLBA 3QVJA 4FQ5A 3DTVD 3DG9A 3DTVB
chains in the Genus database with same CATH superfamily
3I61A 5CBPA 3H0KA 1Z6QA 4LY3A 4F11A 1CUWA 2QQFA 1TQ8A 1GPMA 3B20A 3C5WP 5D5PA 3BXFA 5AXCA 4JYBA 3UWSA 4QU5A 3ZV5A 5BV7A 3C16C 2XNCA 1GN9A 5J1SB 4RFVA 3ANTA 3Q2KA 2XLCA 3E53A 5L45A 10MHA 1ZJJA 1H8HD 3LUBA 3PX2A 1C3LA 2PX5A 2FZGA 3INNA 4RZXA 3I45A 1UKCA 4J0GA 2ZBVA 1GM5A 2CJXA 4U2DA 4JUAA 3ZZTA 1PI3A 4BO1A 4I55F 3VAYA 1VG0B 4EF6A 4MAFA 4I7EA 5GVRA 1B3BA 2QXYA 2HNAA 1SNYA 3HKCB 3DT8A 5FNVA 4F0JA 3GRVA 4NFHA 1Q6YA 4FFSA 4KVFA 4RX1A 4BP8A 3V8NA 4EKNB 5JAHA 3GDWA 2VHEA 4XYGA 4D9MA 1DUVG 5BN4B 2BGNA 5AVRA 2CBGA 3FOWA 4DKXA 3Q12A 2QM0A 2CVPA 2JIDA 3A0RB 4RUKA 2DZDA 5B4VA 3S8EA 3F78A 1GL7A 4X5OA 1J2JA 4X6UA 3ZE6A 3EOAI 4J16C 4FCVA 2BOVA 1VRCA 3B9QA 3PL1A 3RK4A 4YUXA 1T5HX 4JI6B 1PZXA 1W35A 2NTNA 2PA0A 4Q00A 1JSCA 5ENDA 1BE0A 1XZPA 5I4IA 4K6FA 2PLWA 3KEGA 1T24A 3VYWA 3ETHA 2UUOA 5HF6A 1CF2O 4MGZR 2ZCVA 3ZCQA 1ZHFA 3ASZA 5AHOA 4OQDA 3LXXA 4OOEA 5CUQA 5AUNB 2WHEA 3DZHA 5AVWA 4CF5A 1P1RA 1CZHA 3ABIA 1EWRA 1T2VA 2HO4A 3H2HA 1X92A 4WL0A 5D3QA 1NHWA 2PG3A 4QG7A 2ZJ7A 4JSYA 3UJ9A 2YWRA 4XWOA 1M10A 3O8DA 1Y1TA 1BEZA 2RBKA 4LKRA 3L7OA 1WXDA 1KAMA 2QTZA 4JUDX 4QASA 4QDKA 1NVVQ 1D04A 2PGNA 2VNKA 2C5LA 3BJMA 1MAVA 3DWEX 3RG2A 3TLMA 3ZC3A 2QRLA 3DT6A 1LH0A 1VE9A 1NJ5A 1JJ7A 4FP9A 4KQWA 1GD1O 3RWMB 2BKEA 3BTVA 3W6PA 3E7XA 2PH3A 1F14A 4U9HS 4BX3A 3CPEA 4FDVA 1D4AA 1VJDA 2R8RA 3FJOA 4B84A 3B82A 2WA2A 1MB4A 2WYUA 2QT1A 4C6HA 1YR1A 2YVLA 2JFWA 5KYVA 4PAOA 4NXMB 1YQQA 3EF3A 1ZSVA 3NVMB 1J99A 1NMSA 2JJ2D 4R6XA 4UMFA 4ZJZA 4LNUB 3AR4A 2HA5A 2WG2A 4ZYYA 1G20E 4ETMA 3U4QA 1R8QA 2CXPA 3PNMA 4LOHA 1PFGA 1TVKA 1Z25A 3ZDXB 3H5RA 4NCAA 3KE8A 3H87A 1XTRA 4X64B 5A5DA 3VTAA 5TIIA 5EZYB 3U9LA 1KI1A 4MKHA 1KQ3A 4KR7A 3D8RA 5KVVA 2VJKA 1JFFA 3CZAA 1T8YA 1Z08A 1TO6A 1UKBA 4G4SP 2NUTA 1SULA 2AI1A 1XT6A 2J59A 1FP7A 3EGXB 4MW7A 3QBJA 3B13B 3LOPA 4G1BA 2IH2A 1QB7A 1UPFA 9ATCA 1FSPA 5J63A 4F6RA 4QUEA 5IEJA 2A6PA 3C3YA 3WNCA 4DWOA 2ZDQA 1MVLA 5GV8A 2Z5FA 3O4GA 4ZCRA 3HWRA 4IDPA 3WWYA 1G8HA 2O8NA 4LFAB 3ZGNA 4H0FA 3JARA 4FEYA 2G6TA 4H1HA 3TZQA 3HBLA 1YQGA 2ZIXA 4WKNA 3S0JA 1PTJA 5CNIA 3OQOA 4DQDA 1ZHHA 2BTQB 1NASA 4JP1A 4WT7A 1JFFB 2WWIA 4UEKA 2ZI5A 3IDQA 3TOXA 4FJ1A 1KKUA 4DA8A 4TZ6A 4YJFB 4LZJA 3LBFA 3ZU6A 1G5HA 3EGXA 1B8VA 4LYDA 3B5EA 1FU8A 3GXOA 1SHJA 4NFYA 3TPCA 4PSUA 4WVLA 1S7CA 2HK6A 3DVRX 1J09A 3CRZA 3ML1A 5EJ6A 5JANA 4K0RA 4MIKA 4UHBA 4CLRB 1SQGA 3GEEA 1UXIA 2QTGA 1G3UA 1OY1A 4KFCA 1FZTA 4P7GA 4AYTA 3BRCA 1N5RA 2NU6A 1WLSA 1KYYA 1SC9A 3CR8A 3VR2A 3ZWKA 1GQQA 1XTTA 2BFEB 5LPNA 3DAPA 1PSDA 4DA9A 1ZI9A 3AFIA 3NO4A 5DBEX 1YU6A 2B1IA 4XKJA 4R84A 4CIWA 1N5OX 4YIKA 3ENQA 1GNLA 3LPLA 2APJA 4OU4A 3INGA 3NJ4A 4UDXX 4YJFA 5DBFA 3OTOB 2J5QA 4KQHA 5A4IS 3AXTA 1I0ZA 1G0OA 5DKFA 3WGUA 4DOMA 4HNHA 3B3FA 4XTRA 2P4UA 1NVXQ 4F3RA 1K8YB 3OCCA 3PPYA 2FEOA 4LVUA 4XQCA 1G7CA 4BS9A 3VR4A 1I5RA 1WUJS 1XZAA 2X0IA 2PIAA 2XUJA 3ZHBA 2W42A 2O3QA 3HNRA 5FWYA 2GESA 4M21A 2WTUA 3TVDA 1E3EA 3PEFA 2X0RA 3DUWA 2GCIA 1CDZA 2VTVA 1E7SA 2PT6A 2VJNA 3MQ4A 2RGNC 3NRJA 3IODA 2RHCA 1BZYA 3PUZA 4Q4AA 1DU4A 3UEOA 3P0HA 1Z0FA 5G0TA 3K1YA 4F3TA 3CW2A 1YZYA 2O07A 1OLUA 1VE7A 5CX1B 4ESOA 5CDTA 4JVNA 3RHZA 3C70A 4R7GA 1GTZA 2I62A 1DBRA 3ELWA 4NRDA 4RIHA 3WL4A 2IUTA 3H16A 1SCKA 2CCJA 1R9NA 3IAAA 3JQDA 5CT4A 4BEBA 2G72A 2CDBA 4FFBA 1CY7A 4AQDA 1FYVA 5HMLA 2HV9A 1I2BA 1XZLA 3JR3A 4HEHA 1FFEA 2ZYRA 2G5GX 1E6KA 3DBRB 4IDNA 2CN1A 4R0VA 4Y8VA 4PVDA 5FTWA 2IYSA 4AZTA 2FUG1 3SR4A 1WD5A 3FTNA 4ZT5A 2CMGA 3Q3HA 5JCOC 4CXMA 2ZXEA 3NAMA 3FA2A 2AX3A 1DO0A 1CE8A 3CSDA 4JOQA 1WEHA 1N77A 4NONA 3N2GA 4DCTA 2Q50A 3LHSA 2SCUB 2D0PB 2YZ7A 3PXCX 3KSAC 2WSBA 2PJZA 1KSGA 2P3OA 1UFQA 4CEJB 1XMPA 3L1KA 1HY3A 2HBRA 5REQA 3G8DA 2XBLA 3QELA 1X7ZA 2WZBA 4J90A 3BFPA 4KNYA 1Z6TA 2G88A 2XDQB 5KX5B 1GGFA 5IDXA 1BFKA 1YB4A 4PNHA 3KAPA 4UNPA 5H3LA 1R74A 1W5EA 2WE8A 3B5IA 3ODGA 3MUOA 3OQHA 5DRTA 3ZQ6A 5CIYA 4JJEA 4ALJA 3FTEA 1ZM7A 2C2MA 2RGEA 2V58A 3FPLA 3GGGA 1RYNA 3IURA 1EQAA 3O94A 1TXGA 1WCYA 4NG4A 5CP8A 3U17A 1FDTA 3HHEA 1N3YA 1U31A 1XZMA 3FD8A 3KE9A 2L17A 4JV5B 4MGIR 3WGHA 3HXOA 1TCUA 4WN9B 5CDUA 4WUTA 4YP5A 1VJ1A 3I6ZA 3AVUA 1AKVA 1KMIY 3BD7A 3UUEA 2G9QA 1EFHA 1G4HA 3G8AA 3WO1A 4EPXA 3GGPA 4NPAA 4PBTA 1N0VC 1ACJA 1XEWY 2VQSA 2IU3A 2QLLA 3AJEA 4KDRA 1SUAA 3P9NA 3GRFA 3VAZA 1XD8A 4GECA 1IXSB 3PHGA 3UOAB 4A9AA 3CT6A 2CLHB 3D4LA 3PVZA 3TFQA 1N34B 2ZITA 4R51A 2X1HA 3DR5A 3SXPA 1O95C 2PZGA 2W8BA 3AFGA 3EYWA 2DR0A 3GFFA 5ELXA 2OL4A 1E2PA 2P1ZA 4HEA1 5J59A 3GPDG 1IHPA 2XCUA 2ST1A 3HQ4O 2FXVA 3KUDA 1RXUA 2I29A 1Y9DA 4KDFA 4M9SA 4IF6A 2F59A 3BFJA 3E3LA 4ISBA 2C92A 4P5EA 1XRNA 2VSFA 1C9DB 3TKLA 1C3XA 1SG0A 4OJYA 3GYGA 3I1YA 2BSQA 3ZI4A 1W4CA 5JMPA 4MI9A 4ZU6X 4OQEA 4KWHA 4ZEWA 4L7QA 5C1DA 4EM6A 2DCMA 5JCXA 1PGPA 1SCJA 3DHYA 4ZQCB 5IFKA 3ZIUA 4OXRA 2EDAA 1R4NB 2JGMA 4TXNA 5GJCA 1B26A 1QGDA 1S96A 5HBRA 5LZ4A 2CB0A 3MMSA 2BFBB 2GBCA 2ZB2A 1TJ4A 3D7RA 3SSOA 4AP6A 2W8BB 1J5PA 3LHFA 3QOYA 2UYCA 2WU8A 4UE6A 5CHEA 3HJRA 5B1EA 5CB8A 4ROTA 4J3FA 2K2QB 1G8SA 4LGYA 2ZSJA 1V6AA 2EDCA 1XVUA 2GUWA 3H86A 2LCFA 5BRJA 4ARCA 5IP5A 4LF8B 3S2SA 2ATIA 1N6IA 4PFJA 1MXHA 3W2FA 1U02A 3D0OA 3GK3A 1SA0B 1FSSA 1T4CA 1E5TA 1WXHA 3PUWA 4JEIA 4YQZA 1ZH6A 2OBBA 2YHAA 4PQGA 4J4BA 1UT8A 2PKRA 2Q4OA 2ZT5A 4AO8A 3KSDO 1ZI8A 1XVTA 4I1RA 1SXJC 3W90A 3DOHA 3ZWMA 1MUUA 4QYXA 5HFJA 1P81A 2ZVQX 5LDGA 3S2GA 3DOCA 1UK9A 1FP4A 1UZNA 2H1IA 3EULA 1CF4A 1OWMA 2OP0A 2PPVA 4ZTBA 2ZIEA 1I6LA 2BMJA 3AJAA 3OZEA 4P2BA 3V46A 1WB9A 1DIGA 4JLSA 2Y8EA 1N2EA 1SFRA 2ISSD 2AW5A 5ALKA 3HXLA 4YJ2B 1FE8A 3PGKA 4CN9A 4EVRA 3GPIA 3C8MA 2CXSA 1O94D 4DLRA 4HNGA 1DKQA 2IELA 1TF7A 5LWHA 4PXSA 4DIUA 4N4AA 3SC3A 4DWVA 5LLDA 2X4LA 4NY1A 4DLSA 1YRHA 2EXXA 3FCUB 3IPAA 4OHFA 5ALQA 1FUKA 1Q1BA 1QCCA 2ID8A 1Z7YA 4PIPA 3ZR4B 2R6GA 4CDGA 3U56A 2JJ1D 2HJ9A 1P45A 1VP3A 2AOVA 2MIIA 4J43A 2Q2QA 4DSOA 1KJJA 1IB6A 2HNKA 3PEVA 4G25A 4BV3A 3RJ5A 1ORDA 1KFBB 3P2OA 1CD5A 5ES4B 1HK7A 4IGEA 4RVNA 1JFSA 3WK5A 4L0DA 4QSHA 4PX9A 3JZIA 1ECJA 3KZNA 3IT0A 5EMHA 2IOQA 4TS1A 1MC1A 2HIAA 4TZKA 3S4YA 3VYSB 5JXGA 4FNAA 5CLJA 5A0VA 1P1JA 1NN0A 5A9TA 1PNTA 4G36A 2FPPB 1O87A 1Z4OA 5BW4A 5CBKA 5HF9A 2QRVB 1SKUA 2BKUA 2ESRA 3F2IA 4JT4A 4JXZA 2IKSA 4KRGA 1Y63A 3WAJA 1A9XB 1PR6A 1QYWA 2FSGA 4HAWA 1GG5A 1Q3TA 2H92A 1Y4SA 2HQOA 4G01B 5DK4A 2HFKA 3A0UA 4OQFA 3QXGA 4RMJA 4YP6A 4B4DA 2H4XA 1WBDA 1T8UA 2F1OA 2NO5A 4EFKA 5E3HA 3DDSA 2A4KA 3LPAA 1UQTA 3HO8A 3STUA 3ZV6A 4Z49A 2P3QA 3OJLA 1GKYA 2OAEA 3ACDA 5H3CA 3MM4A 4DJAA 2V0CA 2WYOA 4BWGA 1KZGB 3AR7A 3OD5A 1IY8A 3NC0C 5JAMA 3Q8LA 2OP1A 1Y8RB 3LWBA 1JGTA 1U7UA 3MTEA 3PUJA 4XDYA 3SF0A 1XK7A 3W6ZA 1T8WA 2QT0A 4MKGA 4YVFA 3B9PA 2PRKA 1RQGA 1QPBA 1CJBA 1V1RB 1PW5A 1DWOA 3O4FA 4ILEA 4P5DA 5KOHA 3PJRA 3H4VA 2V55B 1TEZA 1Q0TA 2X9QA 4U7JA 5FTMA 2BKAA 5LB2A 2I3ZA 3UC5A 2EAUA 4OHUA 3VZPA 1BCRB 1DHRA 1S2DA 1XR3A 3NHAA 1V3QE 1II8A 3HEMA 2HQ1A 3M4XA 4NJEA 1XAIA 2E87A 3V1UA 1Z82A 2CDRA 4NESA 3R74A 2ABWA 1EUCA 3B1KA 5CYOA 3WP0A 1GL6A 4EUSA 1S4MA 2WI8A 4RBNA 5I4CA 2H2HA 4QBTA 4PAGA 3RKUA 1RHJA 3JWEA 3NHBA 4WZZA 1YR9A 3NGXA 1OX4B 3BJEA 1IU9A 4TKUA 3R41A 2AWNA 2E4AA 3FZQA 1IY0A 2OK7A 2W2QA 4P7KA 1UZUA 4P80A 2JLSA 3U4AA 1EUQA 2LKCA 4KSBA 3UH0A 3EXFA 3TL3A 1QH8B 2NYAA 4DM7A 1UK8A 3O6VA 3L84A 3EMKA 1H2EA 4PRLA 5ALSA 3BB1A 1U0JA 1V7QA 4OHPA 4IMPA 1UJ5A 1DEOA 2GBGA 1RTTA 3JD0A 4NJEB 4KK4A 1J7JA 3ENZA 4EFLA 3ZDDA 2HCJB 2GDZA 2WDZA 5K0CA 4X54A 3BZUA 3L6UA 1K1EA 2BHSA 4YEDA 5TJ9A 5CYGA 4ZCQA 2GNAA 1T2UA 2NZUG 1OIVA 1J1ZA 1G42A 3EXAA 1ZD5A 1E2IA 2C95A 3EZGA 2BN4A 1CQPA 2JKZA 5LQMA 4Q3NA 4I14A 4UCXA 3WIEA 2YN4A 4B6SA 1MB0A 4M60A 3TBFA 5JZOA 4JQZA 3V7WA 2V0NA 1E2GA 3TZ6A 3RUDA 2VYND 2PUGA 1Y7IA 4OD0A 1TECE 3MJSA 4AJ2A 2H06A 2PMEA 4BFLA 1DDIA 1LDEA 2P9TA 4BIIA 2XKBA 1MV5A 3D02A 1SB8A 3LDGA 1JJFA 2RB4A 1TDJA 1GCAA 1EESA 1R0YA 2WU4A 2Q1TA 2V9ZA 4IFBA 5EERA 2BKXA 4GT1A 2C84A 5B37A 3UF0A 2CHUA 4C0WA 5BN3A 1KO7A 1YUNA 1YV9A 5CT5A 2VPYA 5C31A 2X58A 2QL9A 1LJUA 2FQ1A 1VPLA 3H9UA 3N59A 4N6GA 3T5BA 4DLBA 4OK3A 1YA4A 4NH4A 2EZTA 4Y6GB 3T5DA 3OE7A 2VRNA 4JGBA 5IANA 1OH6A 1ZVJA 3QUSA 1F60A 5H82A 2ZJFA 1QVRA 4RPHA 2ZLBA 2BWJA 4DAOA 1DEHA 3RSSA 1YQ9A 2DT5A 1ZRHA 2A94A 1IY9A 4D6YA 3PXEA 4CKEA 4CQJA 4EAQA 1I80A 1IATA 1NXPA 4EK9A 2HNBA 4KQ1A 4XVUA 4Z4IA 3Q10A 4UASA 2OY0A 4NDZA 5DGCA 4BTLA 5AH0A 2CXHA 4JITA 1M5RA 3FGOA 1XCMA 1P7WA 2PRYA 3FYSA 5IN4A 2VT2A 4RL6A 3ISVA 2H2IA 4RVHA 5C51B 2X0JA 5EXPA 1RFLA 2I6TA 2IWRA 3VHXB 1PGQA 2DHRA 2WJPA 4DLWA 1LW7A 2G04A 5E1OA 5GZ1A 1KNQA 2Q3CA 3RRXA 2QBYA 7ABPA 4ZMRA 1FA9A 5I7HA 1P6QA 2J9GA 3D3NA 2LDXA 4JI3B 1T2AA 1VDZA 2DVMA 3L0DA 2OK8A 4PGGA 3FDIA 1HOTA 1C1YA 3HXTA 5HVNA 5FUYA 1ZD1A 3FJ1A 2X3YA 1ECFA 3MHPA 2FGKA 2X6TA 4JR1A 1WU8A 4CEHA 1N5MA 4JEUA 1EX1A 4IDDA 3MJRA 3CRVA 5KNLA 2Q6KA 4DA4A 2OO5C 2PFSA 5IHPA 1CSEE 1T9HA 4UHEA 1E9FA 1F8XA 1E0JA 1R10A 2J3IA 3EXHA 3PGLA 1GWNA 2AE1A 4HCJA 1A5ZA 1JU3A 3MCUA 2QX6A 1NXOA 4HRVA 4ND8A 3B2EA 1TVCA 4PLVA 4UMEA 4YJHB 4WHMA 5EGNA 3QKSB 1QHHB 3R5HA 1YDFA 3VFDA 2FWIA 2V9CA 3SIXA 1NRWA 3THXA 1D4OA 1WB5A 3PQ3A 2VPZA 3H6GA 3KETA 2CXUA 2MYPA 5A71A 3C39A 3T5AA 3FTFA 2VWGA 4G5RA 4OH7A 1EA7A 2PLAA 3GV0A 3D4BA 3MTBA 1VYHA 3F5QA 4WH0A 4NENB 1FNDA 3DONA 2B5VA 3UUGA 1K0FA 2YMLA 3ILXA 1NGSA 4KX3A 3C24A 3R2JA 2CLMB 4UBIA 1RJGA 4FN4A 2YR0A 3BXXA 4W1RA 4ZANA 2HF8A 3ND5A 2WJVA 4UNQA 3DEKA 2XVAA 1NYTA 3W5JA 2C96A 3BRWA 2FSVA 3OQPA 4I1SA 2I03A 1VXOA 2OFPA 5IDYA 4OHVA 4UREA 5LP6C 1QHHA 1I0IA 2HRZA 3DEIA 3LC1O 2CT8A 4FI3C 1HEUA 2XGGA 4F5YA 3B6ZA 3P5BA 4QT0A 1W1WA 3D0RA 2W4QA 2ZI9A 1D2EA 4WNAB 3TNJA 2FN8A 1XD2A 1YONA 3ELBA 4H59A 4PZ9A 1ZISA 3INRA 4BVGA 3VPAA 3D54D 1DXHA 5HGXA 3EQ2A 5L6MB 1XAHA 1L1EA 2NM0A 1VYTA 2XUDA 3K6RA 2H1CA 5DNWA 2IGTA 3H65A 3DTVD 3MC1A 1ZGZA 2F3PA 4Y2RA 1U2DA 5T5QA 4DADA 4E51A 2VDLB 1H1LA 4E31A 4X7MA 4NJOA 5C8YB 1MO5A 3FAKA 3IERA 3LGAA 3OQIB 4DUZB 2M6RA 4G4JA 3K96A 3LOQA 5EMNA 2JANA 3N70A 4QJIA 3AHEA 1WPXA 3DO8A 4C7MA 4CUZA 2R1VA 1RBQA 2OBYA 1P0PA 4L5IA 1HNZB 1EIWA 4IRXA 5EWLB 2V4MA 3NIFB 1GYQA 1KK3A 3CH6A 1SD1A 721PA 4Y7DA 1TO1E 1O96B 5CXQA 3LCMA 3X43A 4LZWA 1VYUA 1QIJA 2ISQA 4G0NA 1A71A 1ST2A 2Q1YA 3BMQB 3W3ZB 1CRPA 1Y89A 3MQFA 2IPXA 1GPH1 3EWSA 1A95A 2PQ6A 2QNRA 2REBA 3UK6A 4B1FA 2CNNA 1W9MA 2JARA 2X4DA 2QAJA 3DCYA 4TWRA 1YFZA 3D8TA 4CG1A 4RY2A 1Q83A 3A1FA 1EK5A 4GRDA 1E3SA 1T2FA 4CV0A 5AM3A 4RD3A 4NABA 3OCVA 1KBOA 1S2IA 2VFAA 2Z8ZA 1ECCA 3NYIA 4RSHA 5FADA 3ZHSA 2AB0A 4OQ4A 3B3AA 1XRLA 1ZCFA 4NBTA 4NCXA 4ZWNA 2JCSA 3E6AA 3Q7PA 3TTVA 4LYEA 4Q7QA 2B5OA 4IM7A 1JKMA 4MDHA 3DE5X 4RK7A 2GK7A 1JVSA 2V3VA 3HFSA 2RIPA 3NBZC 4JJ7A 5TSDA 3ZE8A 3IAM1 1U3VA 2HWXA 3BH7A 3FY4A 1RIFA 3AF5A 5KQSA 2Y66A 4X8HA 1Z0AA 1TF5A 3AV3A 4O4HB 2JPDA 1Y3HA 4P38A 3EQ9A 2H0QA 3QLUC 3V8EA 5A1JA 4J7AA 3T7DA 2V6JA 4Q3BA 3QHAA 4MWGA 3TK1A 4D9CA 2Z8YM 3NHRA 4QUKA 3LQFA 1ZO8A 2XZTA 3AQIA 1HM5A 2GYWA 3K72B 4M7WA 3FF4A 4YXFA 5FQNA 3B1VA 1CU1A 1H2RS 3CRQA 3OTQA 1ZHOA 3A1UA 1KEZA 1XEAA 1ZJYA 1DKUA 2RC5A 3EVGA 3PA6A 3OETA 4I19A 1GN8A 3LF2A 5E3JA 2O48X 4TV9F 1XXHB 4M38A 5J4VA 5KHOC 4G5OA 4YCNA 1M7BA 2VQDA 3RAFC 1W1UA 3WWEA 4QGAA 2FE1A 3R9XA 1NM5C 1W94A 3OF5A 4EI2A 2AVDA 2HOQA 3FFTA 4XIYA 4KR9A 1GOTA 3Q3JB 3WICA 4KYUA 3MGBA 3VR4H 4E07A 2QM7A 1ZM9A 3DLTA 3MCVA 6LDHA 2Y1CA 1ZN9A 4OIFA 1TEVA 5L3VA 2N46A 1HE5A 3B7WA 1TZBA 1W4RA 4M53A 4W8HA 3RVMA 4PG6A 3WK7A 1ND5A 5E2BA 2NZWA 3OF3A 1S02A 2D0OB 2J9FA 2PQ0A 4LWZA 4U2BA 4K6OA 4WAUA 5DNYB 3K09A 4CTMA 2H1WA 1MVOA 1T25A 3E8XA 4HB2A 5JALA 2P9ZA 1PX2A 3DMFA 1T0IA 4O2RA 3A3YA 3PLRA 1BX0A 1CJCA 3T9AA 2I7VA 5DP2A 1MEEA 1EIZA 3CJQA 4LGMA 2NZYA 4RABA 3D4NA 4F4IA 1O0BA 4HUQB 5I4KA 4CU2A 2FOXA 3R8FA 1F17A 3LQRA 1RYDA 4YFVA 4NMMA 2LP4Y 4KRXA 5LQUA 4M1SA 1IRIA 1FBTA 1VTKA 2NUAB 5FP0A 1R5BA 2RGAA 3OE7D 3ZTWA 2X9NA 2H6EA 3UMMA 3C3XA 3FCEA 1C7RA 4FYXA 4BBPA 2FMXA 1SU7A 1O4VA 2PKEA 2R8PA 1V16A 3NHKA 1NT4A 1XNHA 1Z7BA 2Y0EA 3ZU4A 1S2MA 2PX0A 4AZ3B 5JAUA 4O29A 3GMIA 3U7EB 3U4CA 2D5IA 2A0WA 1MA3A 4JMLA 1MGOA 1G6HA 4P84A 5JMTA 4D3YA 4LFBB 4IUBS 4F2WA 1J6UA 2R7MA 1ZNXA 2BZ1A 4GVLA 1H9BA 1JALA 3FDFA 2R3SA 3AG5A 3BWMA 3NHSA 5P21A 3PDHA 1GYRA 3ONFA 1R2QA 3M6XA 4ETIA 4AKIA 1JZTA 2WV9A 2I8AA 3QWFA 2ZFUA 4NEQA 1EJ2A 1L5MA 5HCNA 2I4TA 1V96A 4MMYB 4UHHA 3OZGA 4BTEA 3S81A 5IVHA 2RKWA 4GX0A 2ZWIA 2BMAA 4AJIA 1POXA 1YBVA 1ISMA 3MCAA 4IDOA 3LLMA 3D7NA 1HDZA 3KR2A 4KPUA 2BI7A 4EG1A 3DZBA 4FJ0A 1EHCA 1FNSA 7ADHA 3Q4GA 3UT5B 3U1BA 4AX8A 3KBBA 3ZV4A 4NNOA 4AECA 2VWQA 3KL2A 1W0KA 1S9HA 4WZBE 4D82A 1RJEA 4IJKA 2D4AA 2D74A 3OY2A 2A1TR 4L8VA 3VJMA 1JIKA 2JEZA 5LZ2A 4EY8A 1E6WA 1E1QD 4G5SA 1T1SA 3RDPA 3I9OA 4GWGA 4DF3A 2OCAA 4EJSB 1UMCB 3BL8A 4YI5A 3EFOB 3SVLA 1HEYA 3E2IA 3EUFA 1XAJA 4G1FA 1R9GA 1COWD 2RHLA 4X60A 4RTPA 4Y9TA 3OZ7A 3NU1A 2DWCA 3KJHA 1K4YA 4X20B 4MV0A 1NYQA 3AUSA 5KJFA 3URMA 2GM5A 4OH1A 2BE9A 2P62A 4C4YA 1JIQA 1ZW1A 2W98A 4U02A 2BBWA 1V5GA 1DQYA 4C0XA 3U37A 4MWEA 2QXTA 5EL0A 1BHO1 1CUEA 3FKSD 1E5DA 1GG9A 3UGJA 2ORIA 5CH3A 4CR6A 4ZQFA 5C1PA 4TGLA 1JPNA 1X14A 3NC1C 2CFTA 1NY5A 1US8A 4GOND 2MSLA 4WADA 4LDPA 3IQFA 4HI0E 1OXKB 5FCDA 3O2QB 4R8KA 3AXSA 2V65A 2E82A 2QE7D 2BUBA 2ZPAA 4B0OA 4HGZA 1VL1A 4DIFA 3CEJA 2XXAA 1Q7RA 3M8KA 2WR8A 3TOZA 5FPTA 5AXBA 3U3DA 5AIAA 1JFLA 2C42A 4ER0A 3VNBA 3F7MA 3ZZNA 1GTRA 3HJHA 1DKOA 1VE1A 5A5GA 4TZ0A 2H2FA 1OUMA 1W1IA 3PNVA 4KG7A 1PQ4A 4OJQA 1IHYA 2Z43A 2CVHA 3MAAC 4RD2A 3TX2A 4Q15A 3KQYA 3ZWNA 1U0OC 1TJNA 2K4MA 3WYCA 4DZRA 3GA5A 2VL7A 4ZMSA 1YL7A 2FP3A 4IS2A 4B3RB 3CZ5A 2B99A 3D6FA 5EC8A 5KYUB 1D4FA 1TJ3A 4RPIA 4BTVA 1SBYA 2VSXA 4KQMA 1P5RA 2NQTA 2N47A 2ENWA 4NTZA 1MB2A 1HZJA 2NZJA 4D9HA 4OMCA 5J9FA 1SOMA 2PUFA 4YIHA 5BOSB 1QTRA 1KXJA 2EBHX 5AW2A 3EQ6A 4WOKA 1E0AA 1YI0A 1E2FA 3G0IA 1JYEA 1NONA 3M0EA 2D2FA 4M54A 3NOVA 4M6WB 4WOPA 4O1IA 4MQFA 3NLLA 4RF3A 4DE5A 3Q9UA 3SXUB 3ITKA 2R68A 2YQ5A 3F4LA 1UDAA 4P7FA 5DCWA 2A58A 2IP1A 3BORA 5ALLA 1G8MA 5KSPA 2JEYA 5BN4A 2H1HA 4V0NA 5G53C 4JBIA 4IIJF 1Z29A 1LLDA 5M3BA 1MEOA 2J9YB 3SQOA 4AZSA 3KKKA 4PLWA 1EVEA 5ANRB 4C6SA 1N2IA 1L7BA 4R31A 2V9PA 4YRTA 5JLAA 2GZ3A 4EHHA 4CMJA 2BH9A 1LPAB 4HNRA 2PSEA 1BU5A 4RH3A 3W6UA 4UTVA 2OQIA 2QROA 3K6KA 3M1AA 2A0FA 2YDYA 2H5JA 3C48A 1UOEA 1ZK2A 3V9AA 4KH0A 1J21A 2OHOA 4B87A 3WQBA 4JD5A 4FGLA 1D2MA 4DMUB 1P7CA 2NO1A 2VJPA 2XRMA 1IBCA 1N7IA 3AV0B 3GAFA 3HN2A 4XGRA 4EUNA 4MUFA 2MDTA 5ALZA 2N1BA 5A4FS 1U8YA 2WJ6A 4IMJB 2WJHA 2EKQA 2O54A 2NZXA 1OAAA 3DJYA 3G6WA 4IQGA 4WCFA 4BATA 3M70A 4BRUA 3EA5A 4LVOA 4IDFA 1UJMA 1UXHA 2IEAA 3HWWA 5EFZA 1X42A 1NYLA 2FFHA 3DHWC 2XZOA 2FW7A 3O8CA 5ALGA 3T7IA 1A82A 2AR0A 4D8TA 2ZBFA 4OJTA 2Z1NA 4FGWA 5AXAA 5IRCD 2X7XA 3IUEA 5GM2A 5K6TA 1ZK4A 2FPGA 3MGAA 4FHZA 5H59A 5CFOA 1MNAA 2ZYIA 3C87A 3O8OB 5UKDA 3ZOKA 4B6FA 4F9GA 3OIVA 5C32A 1LVGA 1AE1A 2OD7A 3L8CA 4EZBA 4NYMR 1Z8DA 2C4KA 3I04A 1NFQA 4WZBB 4BRWA 3KUCA 3U60B 5ALXA 4LRTB 1GG8A 1BH2A 3ECAA 3P9RA 3GLFE 2VUSA 1QLHA 3FNRA 3PT9A 3OMXA 3O83A 1E3JA 4R1OA 1Z45A 5DB4A 4F3CA 1IULA 1OGYA 4DDWA 4IIUA 3JQPA 1WSWA 4PV7A 4TYMA 1Z7GA 2J6IA 1P9NA 2WHQA 4PSAA 3A4MA 2B20A 3P0JA 2P68A 1VLVA 1H3EA 3ADDA 1IOLA 4GF5A 4NBWA 2OAGA 2J0EA 3Q6MA 5IF9A 3D43A 3P32A 2QTAA 3E5NA 2XGJA 4OGLA 3KBOA 3CCFA 3RQSA 1KDOA 2H1OA 4AN4A 1ECGA 2JDIA 1WMAA 3I2IA 3V8VA 2KLHA 1ZONA 3HCOA 1RDFA 1PJSA 2KHZA 4MUIA 5BVHA 2QX7A 5EJ7A 1NDQA 4PC6A 3B85A 1NFFA 4LY6A 1ZYUA 1KVQA 4TV8B 1YZQA 5KX5F 1A50B 2XJ9A 3TSZA 3OLCX 3ACCA 5JAPA 1YULA 2PS0A 2QSUA 1GL3A 4K46A 4ZVVA 1R4ZA 5BSEA 4RXTA 4I6EA 4P92A 3NUQA 2B7BA 4R2LA 2D2VA 5TMDA 4D9IA 4GOMD 4TMXA 2WJWA 3OQ1A 3HKDB 1SJ9A 3SYNA 1FFYA 4MGYR 4ENVA 5JQGA 3BD6A 1THMA 1WOMA 4P32A 3DDUA 3KKQA 1FJHA 2VJOA 4DZZA 2ZR0A 4P7JA 4CFZA 5MGBA 5I6DA 3ZS9A 1N7JA 1CJTC 2WKPA 4KC0A 2C8JA 5FPYA 3DD5A 2GJ8A 4BFVA 2ZPUA 2VWHA 2H2AA 1C0KA 4N7JA 4CLRA 1M3SA 4ZVRA 3IQXA 2ZUSA 1UMBB 2ATEA 3HDVA 5ECWA 3AKDA 3DAYA 2Y76A 3AMVA 4N0MA 4OA8A 1BRTA 3K53A 1W0JA 5JHGB 2WWYA 3JS5A 3S68A 3EDYA 4FI3F 5TPZD 3BGVA 3QJYA 4DLXA 5LP6F 4L9RA 4C0HA 2GH1A 2K87A 5ESDA 1CR1A 2PBRA 2YV1A 3DNPA 3HI6A 1KDPA 1FOEB 2YY5A 4MRVA 5IEBA 4RVFA 4YRCA 2XDYA 4B85A 4C22A 1TLTA 2OXRA 4F4UA 4KXUA 4RGBA 3IHTA 4EGAA 3D6JA 4EA7A 2FP4A 4RD0A 1ZD4A 4XQGA 3L7YA 4OK6A 3QJ5A 4PG5A 1KZHA 1VM6A 3CO5A 3UUFA 4DV6B 2F43A 2ZJ1A 3S44A 3CVUA 4IDQA 1PTJC 3GMDA 4MRPA 4QEZA 3M33A 5ALJA 1JXAA 1U2PA 3FSJX 5JWHA 3ST7A 1AUPA 4X6YA 4M9RA 3PTAA 4LA4A 1NBME 2G07A 3E2PA 2F90A 5DNEA 3P19A 2GHTA 2BM9A 2V6BA 3WNDA 1Q12A 4QLBA 2QF7A 1FYXA 3I04M 1TW3A 3T1QA 3AYXB 3VC1A 4FD3A 1E7YA 4J4TA 1P29A 3DFKA 1XWFA 4RHEA 2W6NA 4TMVA 1CV2A 1L3BA 4HVAA 5CCDA 1ZR2A 1N2ZA 4UM9D 3PFHA 5K3AA 1E62A 2BGIA 3ZE1B 4XJTA 1L7OA 4LWOA 1W0JD 4MWSA 5KVCA 5K3BA 1LLFA 3ABQB 4GS5A 5HQTA 1RXSA 3EXG2 4RV9A 1SVNA 4IJ5A 1Q0SA 2JD2A 3GJZA 5ALVA 1SMKA 4WESB 1K68A 3THWB 4XAQA 4M0LA 3MD0A 1ZGJA 3GLRA 4EG3A 3EGEA 1GEEA 2MINA 5KSWB 2EBFX 2BP7B 4PZLA 1IAQA 4H7IA 3T61A 2AF3C 1XX6A 4JCCA 3VKFA 3QF4B 2OQRA 2E4WA 2EF1A 3NATA 1BS1A 3EY9A 1M2FA 4M0KA 2YIMA 4O0LA 2OFOA 4F45A 3NGMA 1A8HA 2XYGA 4IQ0A 4DXHA 3V48A 2P9YA 3DKIA 2R48A 2A5FA 4IVRA 4QBIA 4YT5A 5EIOA 2WAYA 4EHNA 4JOSA 1RJDA 3BZWA 3ZEAA 1A4XA 1Z0KA 4R9RA 2PNFA 4C7BA 1E99A 4DQKA 3N2IA 4AS2A 3AESA 3AWIA 3CBGA 4RCVA 4BZQA 4HX9A 1E2BA 4O6VA 3QU2A 2VDUE 4JJ8A 2GN8A 2O8DA 3IVMA 3KLNA 3TAHA 1NF9A 3RVJA 1IBLB 3KUUA 5D87A 5BWNA 1M2WA 3FLBA 4H7JA 4BNVA 3EUAA 1J20A 1ID8A 4RULA 4F4JA 4J0FA 2HBQA 4Q1FA 1GCOA 1WB4A 2DRIA 2PZAA 1WV1A 3NFYA 3ZN2A 3TECE 2PSFA 2MSNA 4S1NA 2A5YB 4I3HA 2X9VA 1TTQB 4RM2A 1OXTA 2ORYA 2VJMA 3IA7A 3K9NA 4Y67A 5ILGA 4YR9A 1KSJA 4JI7B 5AI8A 3JYHA 4B6OA 3ZE2B 1Y5LA 4ND4A 5A0FA 5JYEA 1NV8A 5ER6A 1I2AA 1JU9A 1UBMS 1H2AS 1B4DA 1XLTA 3AEZA 4EYGA 4A03A 3KD3A 1RP7A 1UFRA 2VP3A 4NNJA 1VOTA 5A7FA 1TVMA 1ZN8A 1FYFA 4RW0A 4RJIA 5HRCA 4NIMA 5JZSA 2ISCA 4ZYXA 2OG2A 2PH1A 3CE6A 4DVGA 1XZFA 2LCIA 2PYIA 1FNBA 1DSSG 5F78A 4B71A 3LW8A 5K8JB 2Z95A 4LJ6A 1JDJA 2YXBA 3WRWA 5JCZA 4CIVA 1EK0A 1OAOC 3H2KA 4O8CA 4OFZA 1MAUA 1QZ3A 3TSOA 2UU9B 4QLOA 2BGUA 2LUOA 5KWJA 3LIPA 3VKGA 2V98A 3QQPA 2GBFA 1KEEA 4KU4A 5CA0F 2ZXFA 1SBIA 4RSMA 3WOHA 3CISA 1OI7A 3HL0A 1U90A 3GAZA 4Z4QA 1SHUX 4X3OA 1Z38A 1H42A 1Z4KA 1ZRSA 1WETA 1MDBA 4ESEA 3HM9A 5AIBA 1NX9A 1WJGA 1RRCA 3K15A 1XE3A 1N2BA 5FORA 4NCKA 4Q1AA 5SY4A 4JJFA 4IIBA 1JDVA 5LZ5A 4LGVA 1E7RA 2IYQA 1XO1A 2QG4A 3B7GA 5TB5A 1JZSA 4LGCA 2ZR9A 4M76B 4C2BA 4TQGA 4NDNE 1YL5A 2PAAA 2PSJA 1QYXA 3M1YA 4BE9A 1E9RA 1G8PA 3INYA 3JWIA 1RS0A 2XE7A 2C59A 1LU9A 1SA0A 2JFFA 2CNWD 4L3WA 4Z99A 1G8YA 1TT5A 2DQZA 4EMUA 5ESWA 1YUBA 1BHQ1 3EJ6A 1YQTA 1ZN7A 1J8FA 1Y3FE 3FNGA 3NRCA 5KYYB 3PNKA 1QNFA 2FG7C 1B2RA 1KZ4A 2Z0MA 1SUSA 1L9XA 3DT9A 3GY0A 3KJEA 3QLEA 3R5FA 4MSUA 4F92B 3U44B 1ZAYA 4RJJA 5HJ2A 4YBRA 4D9FA 5TEWA 1OH5A 4PO9A 1EK2A 1NDUA 3WWDA 4QOGA 4HS9A 2DGDA 2BIFA 1CVIA 4MVJD 3DEZA 2EZ9A 1QK3A 1RAFA 3CEPB 4M1ZA 2IGBA 4TQ9A 1KH3A 1NFRA 4ZZ0A 1K2VN 2SECE 4INJA 4A5OA 4CLOA 4HWGA 2F1IA 2JGDB 2ZB7A 4IEEA 4U8GA 4BVFA 3OQJA 3D3QA 3T94A 3UK7A 4XGKA 5I3CA 3COWA 3AF4A 3TIFA 2RONA 1KEKA 3A10A 1MFPA 1OHHA 3ER6A 4RSGA 5CLHA 4EYKA 1GDTA 3STHA 4C21A 4FKMA 5CG1A 1L8OA 4U00A 5BW5A 3JZFA 5AKZA 1H6CA 1E3QA 1DC7A 2F1HA 4KNWA 4Q93A 1SD2A 7MDHA 4I50B 4RIEA 3JD3A 1GVNB 1D6JA 1DFHA 3HSSA 3P27A 1UXOA 1IUPA 3G8YA 1WXIA 4ITRC 1RAEA 3KB6A 3JARB 3C1TA 1C9MA 3OT5A 1JQKA 1O1YA 5IAJA 4UBNA 2ZKIA 3ND8A 1GPDG 3I12A 3UZUA 4EGFA 4NC9A 4LW8A 3TW4A 3E82A 5THKA 5KKCA 1X7WB 1ORVA 1JQEA 3ESXA 2CCGA 1BMTA 1JIXA 4ILKA 5I5EA 3RUPA 2H8GA 4L28A 2WM9B 5DTQA 2YXDA 1XCJA 1E94E 4Q9KA 3QVGA 3CX7A 1MABB 1B74A 1TZKA 1XJ5A 2B9EA 4PIVA 1RAIA 1QHIA 5C9ZA 1HSOA 2H08A 2NU6B 2GVNA 3EWAA 2R0QC 1EK1A 4ER3A 5BSVA 4I1IA 3EPHA 5J3JA 4FOPA 3WNZA 4AYWA 4C4OA 4UNNA 4WOBA 5DYTA 1GKIA 1OJ7A 1WUHS 3I5AA 4PNEA 4A0HA 2I6SA 1QHFA 1ACLA 5I8ZA 3HZZA 4A73A 2QZSA 2J5XA 3GF4A 2OZLB 2OXEA 3L7JA 3ESDA 4LRSB 3C7CB 3F0TA 3VQTA 4LV6A 4WBXC 3R7LA 2C7PA 1OPXA 4UARA 4PYKA 4BGUA 4EHFA 4AF7A 5GJWC 1M83A 3O2JA 1CJMA 1HQDA 4HDQB 1KARA 1Z34A 1VHQA 2W2OA 1HTTA 2XBUA 4L5BA 4X1YA 1T9AA 2YS7A 3B1YA 4CN8A 1EUCB 4U4AA 2AFHA 4NE9A 3ZQJA 3BF7A 4DQVA 4UMVA 2XCTB 1K6XA 3F9RA 3L7CA 4KPFC 4UM8B 4EYQA 5LBIA 3GZNA 4BMCA 3QKRB 1VHWA 4UPVA 2G5PA 4RK5A 3GCGA 2C7GA 1WEKA 2INGX 2GJAA 2J5RA 2RHJA 4K1XA 3FXAA 4Y6SA 5LJLA 2G9VA 1GFSA 3I05A 5I9IA 2IP4A 4TLMB 3EZFA 1Q14A 1ACMA 3U4GA 5DHFA 5CVVA 1QH8A 2XE8A 3MT7A 1Q2UA 4G23A 3HA2A 3RF6A 4ARIA 2QV7A 1DC5A 4BZXA 5EY5B 4E3ZA 1E9EA 1IM8A 3DZCA 4IDCA 3VPDA 1G5QA 1F1BA 2RHHA 2VJDA 4M9XA 3K71B 3UC9A 2BEUB 4PZ0A 1D7OA 2HN9A 5HIMA 4B5LA 1I7NA 1MRNA 1NBMA 4FYVA 2F1RA 3TOSA 2QVZX 2CNDA 4CM3A 3I0NA 4UEQA 2DCUA 2DQ4A 4ABYA 1K3FA 1F5NA 1QYDA 5K45A 2C83A 1T5SA 1LDYA 1V7CA 1IZZA 2QE6A 4Q1EA 1QTIA 5EYPA 5IJXA 3SKYA 2FMTA 2H2DA 3QOXA 3S3TA 3MVEA 3HVUA 1Y33E 5I8PA 3I0MA 2D5BA 5JUWA 4RENA 3TW6A 5BSWA 3H1GA 2VZ0A 3R7AA 1NQTA 4DLKA 121PA 1Y98A 2Y2UA 4C30A 4DDMA 5JH7A 4ZTZB 1Z4NA 1ISPA 2VOJA 1DZIA 1P9LA 1ZJ4A 3SHOA 1DO2A 4HX5A 4PAQA 4YR7A 3GIDA 1CQIB 5ED0A 3VKUA 1BE8A 1F4PA 3SWWA 4CEJA 4MQ5A 3QNWA 3OMLA 4X84A 5KTMA 5CNJA 4R68A 2DWQA 3BRQA 3ICCA 5JTUA 1NW3A 1KWGA 4MVCA 1XLVA 4E5KA 5C80A 2MSDB 2A1TS 4I4NA 2VEOA 1ESNA 1DIHA 2R9VA 3NBKA 4BUCA 1DPFA 1T4DA 1M2NA 1XDUA 3F71A 2ZUTA 5C7IO 1B23P 4XD7A 1E32A 5DNVA 4ZHQB 4YQYA 3AM5A 3PUIA 1S01A 3D5QA 5TQ2A 4AL4A 1HYBA 1KO1A 4H35A 4KMOA 3VR3A 3BHIA 2JLXA 5B3KA 2GRUA 2CNBA 3FROA 5HXAA 1QF7A 1YFJA 5C8YF 2KM1A 2V7XA 2VNSA 3M5WA 2UKDA 1MZVA 2F67A 3EAGA 4TT8A 4Z54A 4H77A 1QYRA 1NA5A 4JLNA 4FGSA 4AUKA 4HEA6 4B6EA 2PGXA 3I42A 2W2TA 4YMWA 1Q20A 2EWMA 2WOJA 4Q21A 5JDIA 2XHEA 3WOVA 5C4IA 4LZPA 4L74A 4K6MA 5CH8A 1KU0A 1SOVA 3MWEA 4PPNA 5JDCA 5F4BA 4LE2A 4PX5A 1BYUA 1H85A 2BL4A 2RJOA 2B92A 1SUIA 3IE2A 1RPZA 2B9VA 1RYMA 2AMFA 3VNQA 2IIQA 4HN9A 5EWMB 3WQSB 1AQ6A 3K5PA 3TRJA 1RAAA 4UUBA 1ESCA 3A32A 3NDPA 4RQTA 3V2HA 3OOSA 4AJJA 1W34A 4CDMA 1Q17A 4N5NA 1ZH0A 2VTEA 3HO6A 1Q1AA 5CDYA 3CKKA 4HBZA 1XMXA 4BXOB 1HL7A 5IKXA 1N6RA 2JJYA 1E0KA 4FBLA 4RZQA 4XRRA 5DYGA 5IXYA 1O7JA 2PX4A 4KQ2A 3DFUA 5EN4A 5EZYF 3UAGA 1MAHA 3C97A 4FBMA 4KYTA 3VNRA 2JAXA 1BW9B 1D8AA 2CVOA 2QEQA 4BKMA 4D6PA 4JP8A 1KI2A 4ECAA 3MT0A 2E1PA 1D0VA 1QXSA 2OBNA 4DQUA 5BRNA 3T7TA 3SC4A 5EXSA 4RKFA 2YHSA 5CFNA 2QLNA 1SCUB 2Q1XA 4IDBA 4Y9SA 1EP2B 5H83A 5KB3A 1CS0A 5P8WA 2CZQA 4A8JA 4XX1A 4K9DA 4D99A 5J2UA 2DJIA 4XPIA 1L8LA 1YZLA 2JZCA 1BS2A 5F7XA 2GMWA 3ROMA 5F1OA 3KJGA 5EVJA 3FN4A 1EXVA 4AJHA 1YA8A 4RTQA 3NM5A 3R6GA 5EMLA 2Z5GA 1L4GA 3DQPA 2OORC 3G0HA 3ZBUA 1F38A 4TUYA 1KRWA 3LT0A 2J45A 1KQGA 1ONBA 3N2NA 1T3HA 2O5VA 5ALTA 2EQAA 3R0VA 5E9JA 3EIEA 4BFCA 5H5JA 3UA3A 1OROA 3AERB 5FOSA 3ZEIA 4YJ2A 2W70A 3SOPA 4F1KA 5LJIA 4EENA 3O1JC 2HMYB 4H15A 4M0MA 4MW6A 4NPCA 2W0SA 3KKOA 1ECBA 3SZRA 3TE6A 3QWHA 5EHQA 2TYSB 3BYZA 3EEFA 3MS4A 3UYLA 3W0LB 1EK6A 3H17A 2XA1A 3E27A 4PTYA 5CTAA 2G40A 4CG2A 3JAKA 5ES3A 2ECFA 3B60A 1NUHA 3BWYA 2XEDA 5BSHA 5DW0A 4C4ZA 2R96A 4GDMA 4J2TA 4G41A 2QVBA 1RCFA 1UPBA 3L49A 4HQFA 4Q39A 4WKPA 1ZOOA 3L2OB 5EJAA 1EP1B 4D1YA 5KQMA 1X3SA 3GLKA 2FUEA 3I6MA 5HOQA 4NI5A 2GJSA 1D4ZA 5HIIA 1QP0A 4M89A 1QCYA 2B8EA 3KL4A 4OBXA 4AJLA 2QPLA 2X0EA 3SJCA 4IIDA 3K9GA 2FPPA 2FMKA 3EC1A 2HD4A 4EHJA 2ZM6B 1K4KA 4J1TA 3TS1A 1M76A 2CKMA 3ADKA 4QYTA 1TRKA 4EJ2A 5JYCA 1OZAA 3HSYA 2WPNA 3KCNA 4R9UC 1U0FA 4I08A 1SEVA 3RRMA 2AR9A 1JSXA 1XQVA 2ZBUA 4PLZA 2I91A 4ZIRA 3A3NA 1AV7A 1EI9A 1BGWA 1TM5E 1GUYA 3R6TA 4KWEA 2CMHA 3K31A 4FQ7A 3GX1A 3UWKA 1OXBB 4GKKB 4CIBA 1XU9A 4PWYA 1GZDA 2Z3ZA 3WE7A 5AR1A 4CMGA 2HA6A 1KEPA 4LNHA 5F9MA 4EBBA 3MPUA 2IOYA 4D9BA 1L6IA 3Q11A 4NU5A 3ZJYA 1E2JA 2XB2A 4WINA 3ECSA 1WDKA 2AYZA 2NO0A 2YCBA 2O2GA 5DZSA 2B5WA 1M0EA 3GAAA 3D6UA 2Q5LA 1ZICA 2OV6A 4LYGA 2P1DA 3TQHA 4UNRA 3QG1A 5KOHB 3WP1B 5IAEA 1U0NA 4FMCF 4J0JA 3AVVA 4EB3A 4O2AB 3DZDA 2D1SA 5HRUA 4INAA 4BFSA 1QP7A 2DF8A 1II8B 3GMTA 1DIBA 4KXYA 3PIDA 4OB6A 4RTOA 1CRWG 1D2GA 4L0CA 1PT8A 2PL5A 4OXIA 4CFYA 5H81A 2I87A 4ZAXA 3W8EA 1Q1NA 4G37A 5JQGF 1ZD9A 1Q7GA 1CZOA 1UQRA 3JQQA 4MV1A 2WF6A 5K4HA 3C3CA 1AB5A 2HSJA 3FWNA 5U1PA 5C37A 3Q5EA 2Y1GA 4S0ZA 1ZC3A 2WUWE 3F7NA 3S2IA 5JATA 4A36A 2OKCA 2X1MA 5B12A 3P9PA 4C14A 2WPDA 2EFEB 2HK7A 2PQMA 8MHTA 3L4BC 3ND9A 4UU7A 1UKVY 1EWYA 3O8QB 4FOOA 5SYAA 3TXAA 5LIPA 3KSBC 1Q0ZA 2HCFA 3WJ7A 3SVTA 2WQ7A 1N2XA 2Q2VA 3OFSA 2PWBA 2VOEA 4N18A 1Z0JA 2VP2A 3IOYA 3K4HA 1QJ4A 1CQJB 5CT9A 3ZZ0A 2YKGA 1N6NA 2ODAA 3OZDA 4RTNA 2B34A 3FM9A 3KV3O 1W6RA 1Y34E 2OCDA 3FNFA 4PHCA 2ANCA 1VDMA 1TTHA 4JOCA 4RKQA 3WY9A 2BJWA 3ESBA 4PCLA 2FWNA 5C8VA 4PGAA 4JT8A 4QOJA 3ICOA 2YNMA 3MW8A 4KPEC 3LC0A 4GOOD 5DTMA 3T0IA 5EXEA 3P7MA 1ZUIA 1C3EA 4H6VA 3DCJA 2FQWA 3JWPA 3N7TA 1I01A 2JIZA 2W6QA 3FZGA 4V0ME 5CK5A 1YK0A 3MXTA 4AG6A 4HOYA 1DC8A 3IA2A 1M7HA 2Q8PA 1K8RA 3B6IA 2OV2A 1RBYA 2Q46A 4WASA 5IVDA 2FVYA 2CNKA 4IXMA 2JGJA 2F17A 2EARA 4D3SA 1PNQA 1U2DC 2GPNA 3WX0A 4FK8A 3WGNA 3THYA 5CDGA 2VDQB 4HAVA 3VRHA 3GT3A 5ALIA 3N58A 3RSCA 1EVYA 4PYIA 2H4WA 1UBNA 3V42A 3EDQA 2JH3A 1I3OA 3IUJA 2GZDA 4JI1B 4MRMB 1KJ9A 2Y0PA 4DS3A 1L5GB 3I6YA 4RV5A 3IMEA 5KWIA 3K9LA 2PAFA 2VATA 2JK1A 1CQZA 4EGSA 1OKKA 3PWSA 4HWKA 2OYSA 3ABOB 4DREA 3V1LA 2O4UX 2NSHA 2OHJA 1J22A 3ZWOA 4OLAA 3FYCA 1NAIA 3EVDA 3HP7A 3U4IA 3L4SO 1ULBA 2I0FA 4IV0A 4NOKA 1BN7A 3LQKA 4WJZA 1Y7TA 4DB4A 1G6OA 1YAJA 5K2MA 1V5IA 4MRNA 1WZNA 4W9NA 4O2BB 2Q27A 1ZNQO 1N5IA 3ZW8A 4V0KA 1M67A 2QMHA 3VPGA 1EDDA 2HQBA 1R3DA 5I7RA 3INTA 1XKLA 2G7ZA 3NEYA 2NO7A 1CY2A 2XNJA 4LRWA 5CURA 1UT5A 4REOA 5KNCH 1DKLA 4JA2A 4MRMA 3AI2A 4F5DA 4KXWA 2YNMD 3GC6A 4AP9A 1NKVA 4LF6B 1K7CA 3RUHA 3BA6A 1A9PA 1FVXA 2ZJYA 4P3XA 4BN5A 4NAHA 2BEKA 3PQ2A 2JAQA 3LLSA 4HRXA 2PJUA 1S3FA 4AG5A 1JLLA 5HZGA 1UP7A 3WRXC 1QF6A 4UVHA 2H9IA 3VZDA 2PCJA 3I3SR 4RYDA 1NBOA 3MS2A 2FW6A 4BFYA 1Z36A 3TFOA 1I7LA 1KGSA 3NM4A 2F3SA 5KMGA 2IPLA 4FWBA 3OEWA 2RAPA 4U2CA 5A3RA 3HBMA 2XUPA 1ZSNA 2ZSUA 5FR1A 1B6TA 1AG9A 2NVUB 3QITA 5LQDA 3E9MA 5HCIA 3ZDQA 4EHDA 4POOA 4ZD6A 1UMCA 5BR8B 2Q5HA 2AEEA 4IVPA 4B33A 5ILQA 3P20A 4ZHSA 4JLPA 2BGMA 2CKDA 1A96A 3QBTA 4YV2A 5EIBD 2ZIWB 5FI3A 1JIUA 4P93A 4BX8A 3CGWA 1H4TA 2VF5X 2EHJA 4D98A 3B51X 5AW4A 5JBIA 3TGLA 4QARA 1QV7A 1KJWA 1ZGHA 4DXDA 5AVXA 3OHMA 4U2GA 4CG0A 4XGQA 3S5UA 4BWVA 2VTDA 4RMGA 5JYDA 5AXDA 3I5UA 3H3JA 4EB6B 2PMWB 3WLTA 1PZEA 4PG8A 1E3WA 3SF8B 2QTVB 3AUTA 3M6LA 2PXAA 4Z7QB 4O2AF 1QS0A 4YUVA 4ZO4A 4A8HA 4B3JA 4DWJA 5ICGA 4CRWB 1U2GC 5EHNA 2RK3A 4HNQA 2BSAA 1EUDA 1KEVA 2RGNA 1N3LA 1JHMA 1L5RA 2ZKLA 5LBUA 3W5DA 1V2GA 3RS7A 3CV3A 4RETA 3BKXA 1SXJE 4GC5A 5HKBA 5BV0A 1QKKA 4YAIA 1U0EA 2IIPA 1MP0A 2W6ID 4HH1A 4MPTA 5HNKA 1G0NA 1L4KA 3KTOA 1FRFS 4WNAA 2YCLA 5K0TA 2DLDA 3LKVA 2GSWA 4DYDA 4EPRA 2EKZA 3QTTA 1XRJA 4CFSA 4ZXFA 2WWRA 2XV1A 1D07A 1SN7A 2RHTA 2IBTA 2ACKA 1P1FA 1W46A 4TS4A 2QTVA 2VT7A 3QMVA 4RK1A 1CW2B 2V4UA 2JH8A 4ALNA 5KJ6A 2PZFA 3DL0A 4KRFA 3MWDA 3B6EA 3C6YA 2PSHA 5C8YA 1C1XB 5JAZA 1TRHA 1EUDB 3WZ2A 1MN6A 1RM3A 3JYQA 3PS9A 1Q0RA 2L69A 5AMXA 5FHRA 1QHEA 1P6UA 1NZDA 1N0UA 3AIKA 3FHCB 1VLLA 5L6LB 3UN1A 3VR5H 3ZD9A 5IJ9A 1JX6A 2F62A 2R84A 4G0QA 3I23A 2GM4A 2R1TA 1TMYA 1AX9A 1ZITA 3AHHA 1M2GA 5EWLA 3VO8A 4CMCA 1Z0DA 1AZTA 4JX8A 4OHKA 2QX9A 3KSRA 3M9LA 3NAGA 5IAOA 2BFWA 4CMEA 3MGGA 3AKYA 3R6DA 1HBJA 4Q1DA 1O97C 3SP1A 4ER5A 1ADGA 1RQNA 2C3YA 3HCWA 3JWHA 4Y1RA 3WDSA 4D0RA 1GQRA 4D4LA 4BNXA 1K9VF 2ZE6A 3OJCA 2GK3A 1EFPB 5IBRA 3EASA 2OMEA 3SICE 5JS7A 5I7AA 1YZTA 5B5SA 2HJRA 3I8SA 2Z6UA 3B2NA 5IJ9B 4GZ6A 5MF6A 1ABFA 3J7TA 3OPNA 3U19A 2V7VA 4ID3A 2X2EA 3GLHE 6Q21A 1L4NA 3QXJA 4L1KA 1FRNA 5DSZA 1O8BA 2OC9A 5AWFC 1WY7A 5IARA 2Z6AA 2GBLC 1Y42X 1VJGA 4FCWA 1XZJA 4J0CA 3PEEA 3DEYX 3KDPA 1FTSA 4JB2A 1Z0SA 4UUAA 2H4JA 3A6LA 2RI6A 3AEUA 5K1ZA 4A8JC 3BIWA 4DWWA 4OX9B 4MQBA 4JP3A 4RH0A 4IVNA 3FVVA 4HG2A 1U7PA 4FMDB 2FE4A 3L77A 3T5CA 1T5OA 1A8SA 1Z2NX 2J85A 3DL7A 3FB4A 3WHIA 1DFIA 1W73A 3JY6A 6YASA 1AQIA 2PX3A 1RLUA 2GGSA 4M87A 4WY5A 5D51S 2QPAA 1TC1A 2YW9A 3LXMA 3SZGA 4L78A 3ZGVA 4AM8A 1KY5A 4ZZ3A 1H22A 2OQ2A 1LDMA 3H9EO 2XUKA 2FPSA 2W00A 3GJ8A 3T4UA 2A33A 3HJCA 2Z2XA 1IAVA 5A6SB 2HC9A 2OD9A 4PLHA 1B1AA 1G1AA 2QI9C 1A4RA 3BEOA 3UFXA 3TQTA 4AT1A 1RMYA 3PIRA 3HY3A 4LZAA 3BX1A 1Y7PA 3ER8A 4BVJA 4EP1A 3G9XA 2AQIA 3I2FA 4YXWD 3HKEB 5KWEA 4R2MA 1QFMA 1HDXA 2TSYB 2EFHB 1JAIA 4RK6A 2ZP1A 3KOOA 5E6UB 5ITWA 3QM1A 3HADA 1WUKS 5I7UA 2YYYA 3UH1A 1XZ8A 3V4ZA 4EG7A 4IGIA 1LSJA 3OQ6A 3K1AB 3PSAA 2VP4A 4D9KA 2W2KA 2XCOA 5DTRA 1L4MA 5JSZB 1YGPA 5SYNA 2J3DA 3C43A 4EY7A 2RK4A 3DOOA 5AW9A 4RNCA 1R6DA 4LXTA 4KLNA 2Z9DA 3EH1A 4DYVA 1Y1KE 3S7TA 1S8AA 4TL8A 5U4XA 1PD0A 1QIDA 4O4IF 4BNDA 4RXUA 5EIFA 1YFLA 5KTKA 3UFXB 2PWZA 4GUAA 1RZUA 2E85A 3K1TA 3IQWA 3LCJA 3R24A 2WIGA 2QUAA 1L5YA 3PQ4A 4XSHA 2AQ8A 3UENA 4GZLA 3ZGXA 3X0DA 2CDNA 4OBEA 1LY1A 1Y8CA 2GCNA 2TMYA 3KEOA 5B6PA 2DECA 5DMHA 2X0DA 3R7NA 5K3DA 3RVDA 4N54A 4B6GA 1VLMA 2WAAA 2QYOA 2QV0A 1KZ6A 2YYZA 3PC3A 4N65A 4LRUA 4A92A 2LPMA 3AJRA 4GBMA 1E5LA 2XKAA 1A4UA 2R47A 3WYBA 3NIWA 4II7A 4UJ3A 4FR5A 4HPWA 4EAAA 4ZVQA 4BNWA 1R6AA 3L8HA 1E2HA 2QRJA 3R20A 4QTZA 1LWNA 1WS6A 5AM1A 2C1EA 1EQ2A 1FP6A 1JBEA 3NASA 1Q50A 2BUCA 2NTYC 3GZJA 3O9MA 5FBQB 3UV3A 5HTOA 4NU0A 4JL6A 3HB5X 2W71A 1MLDA 4OF4A 1HQYE 2NZ2A 2VTKA 1YH3A 2VUHB 3RU2A 3CLVA 3R0QA 4YC7A 2BR5A 4O25A 1IWBB 1V3TA 4ABTA 1R6UA 3DW1X 2XITA 1R6XA 5FTJA 2DFNA 2FDCA 1GTG1 1Z4PX 3I5XA 4OFXA 2ZBDA 4QT4A 2O4CA 5K3EA 4CQLB 1WVGA 5EJ9A 1LDBA 4D4MA 2RD2A 1P4SA 3TTSA 3LE8A 1N9GA 2HMSA 4O5AA 1P1CA 2HRDA 1W4AA 3WS7A 1F8UA 2A59A 2HPVA 4AMUA 3WK8A 3UJHA 4TSFD 3ZD6A 1X15A 1ZWLA 3HG7A 1YDHA 4R0NA 2AHOA 3B6MA 4BNHA 2XH8A 3K9WA 4BEWA 5L8VA 2W6MA 4IHKA 5BWOA 1FNCA 2P6UA 3LAWA 1BQEA 2FV8A 2J09A 3KTDA 1CUCA 3IAS6 1YVDA 3PPVA 3QFTA 1TCCA 4UHDA 4NZ9A 4ZQGA 1M1NA 4LAFA 5JASA 3ZGLA 5KNDA 5LFAA 3L4JA 2J7KA 5C8XA 4BNKA 5AW8A 1XTPA 4L8LA 3AI3A 4LSZA 3ZXYA 3O03A 1ZQ9A 4KVZA 1QSGA 3NHZA 3HJBA 3QYJA 1R15A 2YIJA 4XWWA 3O4IA 4LCBA 3SQWA 3LQ2A 1NL3A 1AQJA 3IIMA 4K3UA 5IZCA 4TTTS 1XXHE 5L3QB 4YCBA 2F8TA 1CUXA 4V3BA 1ENPA 3IKJA 5LNK6 1T0BA 3G79A 3SJBA 2G5TA 2OFWA 4FDMA 4GYYA 5AVJA 5BWMA 3STXA 2HLPA 1G5PA 4AKEA 1NMYA 3ET4A 4PNPA 421PA 2KSQA 4PE5B 3UICA 3VVBA 5I9TA 2B4QA 1WHTA 2VK2A 3ICVA 4QRDA 4F5WA 1ABBA 4L85A 3C4JA 4ZVTA 3LT1A 4GLFA 1EVLA 4PG4A 4FZRA 4BNLA 5CBPB 4KCGA 5LMUB 1JBQA 1YIAA 3N39C 4IJQA 3NVKI 1O6FA 4NEHB 1Z6PA 1BSVA 1R0WA 2QM3A 4RE5A 3BCHA 3GA0A 5JAOA 3SLKA 1R8XA 3G1UA 2P6PA 4BB0A 1J49A 3UBMA 4R3WA 1EGAA 4HDSB 1C3OA 3VDQA 1A4IA 4I81A 5M34A 4Z0TA 5CNKA 3WDMA 5DI9A 5LUAA 1SHZA 2WHYA 5JRZA 5K2OA 1C2YA 1C8KA 1VCIA 2CMDA 3L46A 4IQFA 3PHIA 1PJRA 5KS2A 1NLUA 1XTQA 3QXCA 2B0JA 2XADA 1KS9A 3PZBA 4I2VA 4M37A 1MPXA 1E1RD 1RTKA 1XG5A 4I6JA 3LWNA 4B6PA 5EHZA 1Q6ZA 1WXFA 4QREA 4OBBA 3HKCA 2L42A 3IYLW 4HZIA 1CUDA 1NHGA 1ONNA 1P3Y1 3U5TA 3F1KA 3WLPA 1GAXA 4HDNB 4O4JB 5K9ZA 1XQ6A 5JTTA 5BV2P 4BGIA 4TTPA 5ALWA 1WRBA 1AD2A 3ZHVA 4HWRA 4Q3AA 4PYJA 4ZDKA 5I9LA 1SXJD 2ZJ6A 4TKLA 4BX0A 3JVIA 5L51A 3VVMA 1KP3A 2FUKA 3C8DA 2AW3A 4GICA 2ZYHA 1ZZEA 5CU7A 2ZATA 4ZQEA 2CMFA 2XMBA 2RE8A 3VJLA 1CY1A 1G291 3RYIB 1VXRA 4NOLA 1UP4A 2GM9A 4JC5A 4I3GA 1NLFA 1JKXA 3IQHX 1XTUA 3AM4A 2OCGA 3UXYA 5CXUA 1OZGA 3MUEA 4L8YA 3E15A 4B46A 3X1KA 3WL5A 1QHGA 3H19A 4P0TA 1BDBA 3K73O 5AVQA 4TOIA 2EFJA 4IZIA 5AM4A 3KYDB 5A1TA 1BA3A 1FPQA 3FNQA 3DZKA 3I34X 1VJ0A 5IDWA 1THGA 4CCYA 5JRJA 3I53A 5FPHA 2D2EA 4QXMA 4BE4A 1P7YA 2R11A 1EP3B 2OORA 3E9NA 2HJVA 3BH0A 4OYYA 3B8HA 1GQSA 3GBVA 3UGTA 3VH3A 7AT1A 2XBMA 4MNTA 1N2HA 1Q91A 3CN7A 3RYIA 2YHIA 5FA6A 2HLDA 3CO0S 1I3MA 4I5EA 3FGPA 4JSRA 2AKEA 2H7VA 3BGWA 5IKPA 3JALB 1Z8FA 3Q0IA 2IX9A 4WLFA 1V2HE 4Z0NA 4DGQA 4HAYA 3FHLA 2PKQO 4C3VA 3VV3A 4JR2A 3ILYA 3RUIA 1R8SA 3UHFA 1KPGA 1DUIA 1TIPA 4CKYA 1B0AA 3KPJA 3OZXA 1YIOA 4HDOB 5DULA 1ZUWA 2CW5A 2NU9A 2C5GA 1UOQA 1RJ9A 1QDLB 3CH7A 4QOEA 3J81A 4GNKA 3JAWA 3DF9A 4S35A 2VXOA 2IYOA 3NM6B 3FOZA 3D6HA 1ZJ5A 2GHQA 1A0OA 4N3AA 3FLMA 4IV8A 2PBLA 2DKNA 4RGQA 3CPJB 1UC8A 2FCAA 2R87A 4KYVA 1UEXC 2GI4A 1DEXA 3OOHA 4E32A 3IPRA 4H7KA 4PG7A 3WIUA 1P60A 2IEGA 3CTMA 3L7BA 2P4QA 1YD7A 3ASUA 3RTAA 3WGVA 5E6RA 1E66A 3L7KA 1RQRA 2VI5A 2O2JA 1P1IA 3M7IA 2YZGA 4Q3DA 5JSKA 1J0DA 1N75A 2O7NA 4GOLD 4IYRA 3TGWA 3CUEF 4I5IA 1W4LA 3MAGA 1KIAA 1PK8A 4K88A 4HR7A 3RTEA 4ZZ1A 2GD2A 5A4KA 3TAXA 5FDFA 4UM5A 2EU8A 1FU4A 4BBZA 2BPOA 4ZQBA 3I8OA 3QV2A 4PHHA 3ISJA 5LZ9A 1K6JA 4OXQA 1WM1A 1EHIA 2GAJA 2OB1A 1B6GA 2JBHA 3LO5A 4YAJA 2D2IA 4GI5A 3T3HA 5G41A 4FLEA 4J0EA 4DM3A 1Y4AE 2E9SA 1K2WA 2ZIFA 2WT9A 4JNCA 3Q72A 1M2EA 4YRNA 1YFKA 1YT5A 5KDOA 4N8EA 4BYMA 2VF7A 4EY4A 3GDHA 5BOVA 3TDMA 2C97A 4ZYVA 2GM3A 1E20A 1JU4A 2RIRA 3AVPA 5GAJA 4HH4A 5CEFA 2NACA 5JPIA 1ZLXA 1JWAB 4QDOA 4AJOA 2JKVA 4BVAA 2RB5A 4MV4A 2FWPA 1N57A 4DSTA 2QJFA 3STYA 1WDTA 3JZMA 1H1DA 4FSHA 3CU5A 1PFYA 2IYPA 5DGIA 5JQGB 3ZGZA 2B8WA 1CRZA 1XNJA 3HNPA 3AO0B 5ICEA 1RXEA 3ETLA 2VRWA 4G26A 4GI2A 2PNJA 2PTGA 2IZZA 1V1MB 4JT9A 1IBKB 1PD1A 3MG9A 3NETA 3OC6A 2XB8A 1R50A 4L27A 3L8EA 2Q3LA 2ZSBA 4GZ5A 1UINA 4PQYA 5DM1A 3TW0A 2WTNA 3ZDEA 2BI4A 1YQXA 3C98A 3DG9A 4Y2SA 4W6QA 4BQNA 4Z3KA 1LKZA 1QX4A 2BM1A 4R9SA 1T26A 2P2YA 3H1TA 1X80B 3BGOS 4KWCA 4OP3A 4AZVA 2PEYA 4MUHA 2WFZA 3RBAA 1UBUS 3R40A 4C43A 3T5MA 1TAHA 2YASA 1QU3A 4BAUA 3SHTA 4BQFA 1GFWA 4DARA 1O89A 2BDUA 4OQXA 1UPAA 3K9CA 4F2DA 3E5RA 4H2DA 3L8GA 1F8YA 3USZA 1ZU4A 1U8CB 3IIEA 3TL2A 3RS9A 1TMKA 3WMFA 4C4TA 1U0BB 3MJDA 1CUAA 1KRXA 4AN1A 3GLIA 3T1VA 2ZVJA 2XD9A 3VOTA 5T57A 2O20A 3DC7A 3DFZA 1RZRD 1W76A 2Y4OA 3PCTA 3TI7A 1P2TA 3DEFA 1I4DD 1YUMA 2QTNA 2F9FA 3A05A 1KPIA 1KJZA 1OLUB 2C78A 4PSVA 1YZ3A 4NAVA 2J07A 5CX1A 2O5CA 3P0FA 5FA8A 3T5TA 3GT7A 1EG7A 4GOXA 3T7CA 2I6QA 3BKWA 1BVRA 4IHAA 4X1YB 5AJXA 3NUGA 4DVJA 2I33A 3MTAA 4NCHA 5GADl 2X7JA 3ZZ1A 4KACA 5K6AA 2BRUC 2OENG 1VKJA 4WK2B 1QO9A 4C4AA 4CBVA 4B3XA 4MWTA 5E1DA 1FTYA 3IAS1 1KMMA 3DBRA 5EKUA 4EVQA 5C8DA 2Z09A 1YU9A 2QI9F 3D1VA 5BY2A 1U0SY 1TW2A 2EX1A 1P2UA 3S29A 1Y3DE 4WA7A 3CEMA 5C7YA 5EPEA 5AJVB 3NBQA 3NS7A 5DSXA 3GRKA 5LYJA 1BXRB 2WAOA 2J4CA 1YB6A 2YN2A 3HA5A 4C2TA 3COYA 5K3FB 2YUIA 1KORA 1JP7A 4AS1A 1KK1A 4D8UA 2O8FB 2G1AA 2TMDA 4R01A 4MPJA 2Z98A 1KJNA 2IPNA 3WLSA 1JHAA 4HUTA 1L5FA 1MQ8B 4LE0A 3G6KA 1A27A 4FGJA 2FPKA 3HPQA 5HS4A 1CQXA 2QX4A 4F60A 3FFXA 3LKBA 1E5XA 4P3PA 4RANA 5ITVA 3V1TC 2E4ZA 3KKMA 2D5CA 5GGYA 3EPJA 4RPLA 2FKAA 1ECPA 2IS1A 1CUVA 2XDWA 3UKJA 4IUYA 1Q1GA 1X1SA 5CCXA 1U3UA 3OTIA 4JXJA 4F4FA 5KO2A 5FOWA 2FQQA 1WUYA 5BNTA 5JBQA 1ABEA 4YMLA 5E6SB 3EEQA 1XU4A 3L41A 3QKWA 2OC4A 1JAXA 2HLHA 3WADA 1UUFA 4FE7A 4RFLA 3QNUA 1YHYA 2JJQA 4JIGA 1GO2A 4YJ2F 4C5BA 2PKXA 2GERA 3TZKA 4CT0A 3E8SA 4OHZA 4NU8X 4PS0A 1UZMA 1KMCA 1MIOA 2AUTA 3FVTA 4BASA 4HXGA 2TRSB 1S5PA 5FAXA 4JWKA 4N0DA 3DL2A 1JNXX 2FPMA 3RSZA 2I22A 5JV5A 1Q5PA 3I76A 3IC5A 1VL6A 3UHJA 3LBIA 3N2GB 5KSOA 2PL9A 1E2UA 2J5KA 2QS9A 4Z1MD 3PEWA 2B3DA 1VMIA 3C1AA 3GJYA 3ON5A 3PFIA 5CCEA 5CDFE 4FLFA 3D3EA 5E6SA 2NO4A 4L5JA 3A9RA 5IJ0A 3SR3A 1INLA 2W6JA 3RIMA 3OLVA 3PBKA 4F9FA 5EE1A 2ZAOA 1IMOA 1X77A 2SHKA 3G2PA 3PDIA 4EOGA 5F98A 1Q11A 1RRGA 2VHCA 3RWBA 1JLKA 1U1GA 4MYUA 4QDUA 1IJBA 4NICA 3OZAA 1OYVA 4GPAA 3DXFA 1C8BA 3L79A 5EIXA 1QIEA 4UTXA 2RGXA 3KOMA 3UKDA 1H23A 2GPTA 3K6JA 3OZTA 1D0SA 1JR6A 2B98A 1JEQB 3MTJA 5HIJA 4UM9B 1DOZA 1LBQA 3R7WB 5HQ3B 2YWCA 1UXGA 2P6MA 1U2GA 2FY8A 2P77A 4UTZA 2CFSA 221PA 3TW8B 2V6MA 3TM4A 2XTNA 3PSHA 4Q12A 3EGIA 2CZCA 3EVAA 2MMCA 1RQLA 4RYLA 1WVMA 2P9CA 2G1JA 3HYNA 3IV6A 5GV7A 2V7UA 3TQSA 3AUFA 4L4YA 2JLWA 2QP9X 1RM5A 3B52X 3NEAA 4JQSA 3E9YA 3UW3A 2Q3BA 2ZS9A 2P9GA 4BBAA 4QFMA 2PE5A 4BX2A 2UXBB 2UZ1B 5JG7A 3SZUA 2DBRA 5TVGA 3J80A 3Q41A 2DTXA 1QJCA 3DJFA 4HRAA 4DA7A 2EEZA 2H1VA 3B9RA 3RS8A 3ZNOA 3C3PA 1JEQA 4W1PA 4MA0A 3JZAA 4KDEA 2WF5A 5HM6A 4BLWA 4U2FA 4W7HA 5FL7D 3R7WA 5HQ3A 1E96A 4XFKA 4CKBB 1WD7A 4YHHB 2Q9UA 5ICFA 4KLZA 1OU4A 3D5EA 3OTWA 4XX0B 4ZEOA 4ZI3A 1IJEA 5EZSA 1AF4A 3KQQA 1PT6A 3DOUA 4XTCS 4KDCA 4D9GA 3HYCA 5DHTA 4BB5A 3O2SB 5EP3A 3EHDA 1OXMA 2JZNA 4DL9A 4C04A 2NO6A 2NU8A 2BCJQ 2HJSA 1M2OA 4IWXA 2Q28A 3JPYA 2I6GA 1KOGA 1DKPA 3QZUA 4YRAA 4EFMA 1T2CA 1YVEI 2OCYC 2W58A 1G98A 3HCEA 4S1PA 4CUJA 1DHTA 4C7VA 3E7WA 1R12A 5KZMB 1NW4A 1T4CB 1Z28A 4W5JA 5KTPA 1UAYA 2ZSHA 4BO6A 2Q9CA 3E2MA 1G5FA 1TX4B 5CJJA 3BJIC 3OEYA 1GGVA 1L8QA 1AXEA 1T8PA 2PV0A 1POWA 1A97A 3EODA 3OLXA 2H65A 4LZZA 4XDGA 4FEAA 4J0HA 5JZ9A 2BD0A 3A1EA 3OJXA 3PGVA 4H17A 1OV4A 1XGKA 2ZOSA 3T7JA 5EIBC 5THXA 1T2DA 1GZUA 1KKMA 2PD3A 3PJEA 3ZV3A 4CJXA 5JCPA 4W8GA 2N42A 1Z0IA 4DC0A 3MINA 3S8YA 1L3IA 1DLJA 2Q6OA 2GKSA 3IALA 3O5AA 3BMNB 4QUGA 3P2EA 5TDHA 2P11A 2CL0X 3BG5A 3KLBA 4WPGA 4ZRDA 1UZLA 4WRRA 6NULA 1DIOB 2WQ6A 2ZJBA 3VYTB 3I52A 1TYBE 4HB3A 3UWOA 1X7WA 2HWUA 5B3AA 4BOYA 4XVHA 4ZJPA 1UOOA 4ZAWA 4IJUA 1V1RA 2QHXA 3LY7A 1L5WA 4LMRA 2ZYAA 3QVOA 1MQ9A 2VBIA 3M6FA 2C31A 3M49A 5AJYA 2VCEA 4BNMA 4MKZA 1N8KA 2GTHA 2WUGA 1MABA 1KEWA 1RAHA 1SQ6A 3MEQA 2F8MA 5EXDA 1NQ5A 1ECLA 5BQPA 1TI7A 1GPNA 2FDRA 2XTZA 3V4PB 3U6KA 1RM0A 5AOVA 2GNPA 4KIWA 2QGNA 3RTBA 3IGFA 2I6FA 1K66A 2H4FA 4V1CB 1C4OA 1GSHA 3OJWA 3BD9A 2HCBA 3AR8A 3N74A 4J6EA 1DX4A 1U8AA 1SBQA 2PUJA 1LJLA 4DJTA 3JVVA 3FX2A 3MBOA 1JDBB 1JMVA 1T91A 3FIJA 3DBLB 5I7FA 3PRYA 1WCV1 3A1TA 3AETB 1DEKA 1DV2A 2Y1XA 3GEHA 4FYKA 3ZY6A 1JPVA 4OJMX 1L7MA 2HADA 5FTKA 3NI2A 3BA1A 3LCUA 5FL3A 3UA4A 5I7OA 3L3BA 2P27A 1U7ZA 3AR2A 4O2AA 1O8CA 2EV9A 4PVCA 4DV5B 1YDEA 2I1WA 1AVTA 2KJQA 3BMOA 4EJSC 3OLYA 2RKBA 3DVQX 2C04A 2C1ZA 1P2DA 2CXOA 2ZSIA 5E7MA 2B69A 3IB6A 3W5UA 2MR6A 3HH8A 3OUZA 3GCZA 2IKQA 2P4SA 4CCSA 2ZAIA 3X1YA 1GTJ1 1O6CA 1R00A 4LRQA 3GZNB 4JA0A 3ZBTA 1QC5A 3PPWA 4BCCA 1P7VA 2WJGA 4JT2A 5DP1A 4B32A 3N1UA 1PL8A 3P9YA 4OP1A 5CIWA 2ZJ5A 4F5EA 3IJ5A 1G3QA 3ESRA 1PUJA 2R00A 3AEKB 1MOZA 1C5KA 4Q9HA 4XPZA 5HG0A 5BWBA 1GLGA 2WUDA 3R77A 3ZXUB 4E4TA 4GU5A 5TARA 3Q40A 4YV1A 3KQKA 3PFWO 2BF7A 4EVSA 4M86A 4MB0A 1NTRA 5M04A 3L6CA 3P71T 1DCMA 5FPSA 1LSOA 3SBOA 1WTAA 4R9NA 1YI1A 1NF8A 1NNUA 1MC5A 1OOEA 2EP7A 2P0YA 1EFVA 5K0JA 3BH6A 1WP9A 2RJNA 3DBIA 2KX7A 5AOBA 5AW3A 2O7QA 4UPDA 1A9RA 1KR5A 1W6UA 1U65A 5IU6A 4ZAVA 4TKUB 2CD9A 5AD1A 4NZZA 1ZNZA 2PLRA 5M2QA 2I71A 1GNSA 3P9KA 3ANMA 1N8TA 4EUKA 3Q7TA 1ZBDA 5HPYB 1MAAA 3AL3A 5LIRA 1GILA 1KY2A 1N8SA 4YDHB 4BNGA 5ICSA 1QORA 1FFDA 1PG5A 1AA9A 1SXJB 1SR8A 2E37A 1Q15A 3N8NA 3BDIA 4FXOA 3SEFA 4IOLA 1GYPA 3DDHA 4WZAA 2ZBEA 3P9XA 4BFWA 3O1IC 1SIOA 1L5QA 1EFVB 1XIVA 3GWZA 1VG1A 3A4VA 3KAKA 3HA3A 4RF5A 3LOUA 3UHAA 2O8EB 4PRYA 4I4LA 1SKQA 3VNVA 4ZHQA 3EQ8A 4BWYA 3QYFA 1NOKA 2HWYA 2C0PA 3W4IA 4RY0A 2PZLA 5D84A 4F3KA 5HWSA 3DEHA 1U3CA 3BILA 3ONEA 3AKEA 2B4AA 2OXIA 1Z39A 2F55A 3GDOA 3LUFA 2Z57A 4QXRA 4G5YA 4RDXA 2JD1A 3B6JA 3RFTA 1FVHA 4MAAA 4ZYWA 4MROA 5G3ZA 5B1DA 4G0UA 3JQ7B 4NCBA 3FRJA 1GITA 2EKLA 5AOCA 2B1JA 3ENNA 2GVDC 2VLIA 2WA1A 3LX8A 5IC5A 2HA7A 1QFZA 3AQ4A 5EGSA 1FS6A 5KJCA 3LYHA 4GYKA 2J9XB 4F21A 1T9GR 4G24A 1DMSA 4W7SA 1BFUA 4C05A 3GU3A 3RHTA 3ZI0A 4HV4A 3VYRB 3Q98A 1CEXA 1P1HA 4PAMA 3U13A 5D5HA 5TLSA 4E2FA 5TT1A 3ZW9A 5KQLA 3CVOA 1AO3A 1OI3A 1J0AA 4P81A 2C4MA 4JZYA 4Q82A 2ZJ3A 4QHSA 2J31A 3LT4A 2VZEA 4B7XA 4L02A 1NN3A 2HLNA 3FCCA 4JI0B 8OHMA 1JLMA 4GXRA 4HFNA 4G0YA 2DTDA 1JYFA 3ND6A 5F7ZA 2P5TB 3BTOA 1Z06A 3LHKA 3KXPA 4LHSA 4YRDA 5KI6A 3WMEA 3ZJ5A 1CRLA 1XLUA 2YW2A 2ID9A 3LGXA 1RYFA 4KN5A 4A1FA 4ROSA 3V8QA 5BSFA 3ILSA 3E05A 2QUKA 1EE1A 1TU0A 2GN9A 3F8TA 1DCKA 1G9TA 4NECA 4TS3A 5IK2D 3G5LA 3C6MA 3IILA 4J16A 2HHLA 5HM8A 4LRYA 1YZVA 3MUFA 5JZVA 1FFBA 2CF5A 2V45A 4LJYA 4CETA 1KQNA 3VR3D 3E4CA 2GF9A 1V8OA 2I78A 4GOKA 4HMQA 2QSZA 2CE7A 1B42A 4REQB 3D0QA 3U3XA 1DJLA 1LQTA 3AJ9A 3OX1A 5KTTA 5KYGA 2KLBA 4X8LA 3DPSA 4F85A 1ZJWA 5B7NA 4YWHA 1J2YA 4Q7EA 3T7KA 4QM7A 2V7BA 4LEIA 2PFGA 4OHRA 3W9SA 1WO8A 2H0AA 4P9NA 2WIDA 3JCZA 2E6UX 4XCXA 1AF7A 4CPDA 1LPSA 3G2MA 3ETGA 4WGFA 3RR2A 1U28A 1H3NA 1Y9EA 1RHUA 4P58A 1M34B 3PGMA 4PFQA 5BQOA 3W8FA 3FCYA 4L4UA 1RE1A 1Z17A 1Z6AA 3Q8MA 1ZMTA 1ODSA 2HFJA 1QS0B 5ALPA 2RC6A 2VQEB 5JW6A 2OUIA 2ADOA 3DVSX 4NZYA 1QFSA 2ZU6A 1V71A 4IJVA 4XUEA 1GPBA 1NLZA 5B4UA 1ZMXA 4DPKA 2L19A 4ND8B 3IUBA 2W5UA 3BSWA 5DM0A 3PEYA 2SKDA 4JROA 2P9QA 2YC4C 3THXB 3LW7A 2PUDA 1RYZA 2Q6LA 5JNSA 4HO1X 4NMXB 4ZT6A 2VJBA 3T9CA 3GLSA 5D3ZA 5HE8A 5FOVA 5HX7A 2ZEJA 1ZGCA 3LA8A 1CUJA 5K09A 4DLTA 4M9CA 2I4LA 3VYUB 2XYHA 2DFTA 5JDCC 2BEVB 1DCTA 3D64A 3IEUA 2FG5A 3W6OA 5AVYA 2ZYSA 3B1FA 4WX2B 4KQGA 2VYQA 2JVKA 3BUSA 3DUFA 5C5CA 3EUWA 5KQRA 2HIHA 4GMDA 4DJDC