1AJEA

Cdc42 from human, nmr, 20 structures
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
194
structure length
194
Chain Sequence
GSKIISAMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Definition of the switch surface in the solution structure of Cdc42Hs.
pubmed doi rcsb
molecule keywords CDC42HS
molecule tags G-protein
source organism Homo sapiens
total genus 31
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 1997-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ajeA00
4DT1A 4UNRA 2FSFA 4A15A 1EESA 2AXPA 5CJ2A 1G21E 2O8CB 2O8FB 4EJSB 2ZXUA 4KLZA 4RY2A 4DUGD 3DPUA 1HYQA 4A0RA 1T4GA 3QF7A 4PPFA 1YR9A 5C2JB 1IY1A 1IY2A 1G3UA 3NG1A 1A4RA 3UK6A 1YJ5A 3THOA 421PA 1OFTA 1D9XA 1FZQA 3G82C 3RRMA 1WA5A 4GI7A 4QOSA 4BE7B 3EPKA 4JZKA 2X77A 2P65A 3V00A 2O8DB 3SFZA 3KL4A 1KMHB 1L8QA 2C8VA 3LX8A 4RVCA 5P21A 3GLGB 2ZM5A 4BFSA 3SQWA 1GIAA 3WP0A 4LWZA 2BBWA 3CX6A 3IIKA 2PLFA 3K0FA 4M1OA 2ONKA 4L15A 3JVVA 2F3TA 1CR0A 3BB1A 3OIVA 4XVUA 2YWGA 3WBJA 3LW7A 1P61B 821PA 3LO5A 2LWIA 5JCPA 3QXSA 1ZM3A 1X1SA 1XJQA 4DEYA 5LDDC 1DAFA 3QKSA 4JYCA 1KI9A 1G3QA 1HH4A 5JBQA 1S8FA 1DBSA 3ZH9B 3TUIC 5KDDA 1SQ5A 1VTKA 5IRCD 1UAAA 5F3WB 3WNBA 4TYWA 3TUZC 2DHRA 4Q03A 2OESA 1KIMA 4DB4A 4TMWA 2VBCA 1SVKA 2GJAA 2FNAA 4D4JA 3NVAA 1US8A 3W3AA 3N5CA 1GP2A 1XP8A 3AKDA 5ANRB 1PLJA 3EX7C 3CF2A 3D7MA 5J4VA 1SVOA 3HP1A 1Z8FA 2CNWA 1XMSA 1Y63A 3NDPA 3CW2A 3PJRA 1FP6A 1ZAKA 3OAAD 5FBRB 3X1YA 1JI0A 3QVVA 1PVOA 1KDOA 2RGCA 2QP9X 1E9RA 4TSFD 3JZAA 3D8BA 1P2SA 1DS6A 2OCYC 2XJ9A 1S1CA 4MITA 3UXMA 1RYFA 1R5OA 2J3EA 4B47A 2X2FA 3PV0A 1EGAA 1GOTA 1HA3A 1IBRA 1QHIA 2ANCA 2FH5B 2PJZA 3K1JA 1TL7C 4AURA 4ESVA 1IN6A 3W5IA 3KB1A 3CRQA 1MRSA 3NBYC 1OFIA 2BKUA 2GBLC 5CM9C 5DYIA 1G7RA 3EZFA 2R6AA 1ZYUA 1NNEA 2OV2A 3QUSA 1GWNA 3UWOA 3UMSA 1XTSA 1ZC4A 2V4ZA 3QENA 2ZR0A 4QGAA 3ZIAA 2V1UA 1CKEA 3A1WA 1OFHA 3PIRA 2C04A 5DO9A 3HYRA 4URVR 4YLGA 2WM9B 1CR4A 3W8RA 2DFNA 3ZYCA 1UKVY 3QXXA 2BBTA 1XXHA 4KHZA 2FSIA 2KBFA 3RRYA 2KB0A 1LY1A 1NMYA 1GSIA 4Q4HB 4ZPXA 3VKHA 2CL7X 5J4YA 4ARZA 2A2ZA 4LX0A 1U2RA 2JLQA 1J8YF 1RKBA 1WE2A 2OHFA 4TLEA 5LD2B 1G7TA 2JDIA 2P3SA 2FGKA 2P67A 5BN5A 4D25A 2JIZA 1E96A 1Q1EA 2B92A 3U7HB 3KZ1E 4LJYA 5HCNA 4QJ3A 4B3XA 2Z43A 1VCIA 1G8PA 2QAGB 2VQSA 2XSZD 5DH9A 2NO0A 3CH5A 4KITB 4TT3A 3C15C 1VIAA 4Q01A 4JLNA 3GJ7A 1SHZA 1TEXA 1JAIA 1FX0A 2F3RA 5GVSA 3JVUA 1CRPA 2IYTA 1E6CA 3DZ8A 4M1TA 2H1LA 2WOOA 3AVOA 1ZRHA 4BWYA 4URYR 3QQ5A 3IEUA 4RFVA 2ZIAA 4MRSA 4F7WA 2J0SA 4J0QA 2MSEB 2QG6A 2WJIA 5H8WA 3SOPA 1X8LA 2JJ1A 1BOFA 1CIPA 3NHBA 1E4YA 3KJHA 5CB6A 1PZNA 1I4TD 3VMFA 2ZRDA 1P9WA 1A2KC 1T6NA 3VR6A 3WNCA 4MKIA 2C95A 4BLQA 4CGZA 3EZ6A 4IEEA 3UIEA 4BZXA 2H8KA 3VR4A 4CEJA 2WIBA 2C98A 1QHXA 4KCGA 5B2ZA 1KY2A 1E2KA 3H2YA 5L3QA 2NIPA 2QSYA 4EFMA 4HEJA 2IXFA 2GVDC 4IKEA 1NJFA 3OE7D 4HB3A 3BJIC 2ZVQX 2ZU6A 1COWA 1D5CA 4PHHA 5GJWC 1G6HA 1Z2CA 4NDZA 1MR3F 1A82A 1N6RA 2JATA 4G5OA 1XU4A 2XITA 4EQ6A 1GRNA 1XTRA 1WP9A 2XNDA 5FPYA 2IYQA 4IDOA 4P4SA 2YOHA 4FCVA 4JYBA 1U94A 1XB2A 3CX7A 4PC1A 4PPQA 5L3VA 4IDPA 4R9UC 2CK3D 3OZXA 4UXHA 2RGNA 3G0HA 4V0KA 4WXRA 2WKPA 5J4HA 4IVRA 2HYDA 1DO0A 2ZETA 1B0UA 5TB5A 4BECA 1A7JA 1GNQA 2ZUCA 3QI2A 1Q22A 1L2TA 1P2TA 4IRUB 4QJ4A 2ZJ2A 5KNCA 3C8UA 3I72A 1EG7A 3THYB 2VTKA 4UNSA 3KQUA 2GEUA 3FVQA 3L0SA 3CZPA 5DI9A 3BORA 3SQXA 1ZINA 2J9RA 5KPJA 5FR1A 5DHAA 2FV8A 4HB0A 2CL0X 4DDVA 3OEHA 1P75A 2HCBA 1G3IA 2ZRKA 2QMUA 3LLMA 4JJKA 3CPJB 5DN6A 3ZQ6A 1TF5A 4P31A 4ZV4A 3LD9A 4C4PA 4Q4JB 5UKDA 1Q3TA 3FTQA 3TW8B 3GJ8A 2XOKD 4TL9A 1M1YE 5FOUA 4D2IA 3ZJYA 1T0JB 4ZCIA 3EWAA 2XNSA 5FH9A 3ZQJA 2B8TA 1ZIPA 4Q00A 2J41A 2YWHA 3L2OB 2IK8A 3CRMA 4GRAA 1ZC3A 2BM1A 3A1TA 4DBLC 1XX6A 2R44A 3UG6A 5DLQC 4U02A 3BFKA 3U3OA 4AKGA 2EW1A 2EFDB 5EE9A 2WSSD 4Q1EA 2ZS7A 3K70C 1UKYA 3RC3A 2DPXA 3GLFE 4QBHA 4JLVA 4IDNA 1ZJ6A 1N6IA 1T91A 3PVSA 5TMPA 2UZ3A 5J4LA 2GHIA 3B8HA 3I32A 3NH9A 1OYWA 1YKSA 5FL3A 3FE2A 4C30A 4DLYA 1U81A 4JVSB 4P4TA 4LV5B 4Q21A 4OQFA 2IWHA 3ADDA 1CJUC 2XTZA 2XXAB 4B76A 3HR7A 1KI6B 3VKGA 1HTWA 4PC2A 2AN9A 3RS4A 3QPVA 3PFIA 3IHLA 1E2IA 3DVLA 5FPSA 2ZE8A 1W36C 4MRNA 5JEDA 3FKQA 5JSZA 4UXJA 2MMGA 1N6LA 4E22A 1P72A 3F5FA 3TVTA 2O0HA 5TARA 1EWRA 1NKTA 5IHPA 1W7AA 2ZAOA 4MGZR 1AQYA 4E09A 1YZKA 4I99A 3KX2A 2GZDA 2KJQA 5LB2A 1JR3A 1AKEA 2ZEJA 1EFRA 2H92A 2OFWA 4M9ZA 2RCNA 4TYQA 1FL9A 2CLDX 3TNFA 4OKSA 4OQNA 1VIYA 4RCZA 2C99A 1NVXQ 4LBWA 5KO2A 4QGGA 4XD7D 4XTRA 1Z0IA 2IYXA 2PLRA 3BE4A 4JVMA 4WVFA 4Z51A 1KO5A 3RRNA 2R6DA 1XTJA 4CVNA 1OB2A 3DOEA 4XWKA 5LBIA 3CB4A 3FPAA 2WMOB 4LV6A 4B32A 3A1SA 4GOKA 3WNDA 4HAXA 1OHHA 1S4QA 4BEJA 1E94E 3KQKA 2JLYA 1B23P 1VCOA 1BKDR 3JZMA 4JBYA 3CONA 4LC0A 2QRNA 2QBYB 5AUPB 4G1UC 1VHTA 1W5TA 1II9A 3M4YA 3LVQE 2A5JA 2F9MA 4MRVA 4QKQA 2GXAA 4CEIA 3SR0A 4F4CA 5EP1A 1IY0A 4EPRA 1D9ZA 1OXVA 1KDRA 3B9PA 4R98A 4LPSA 3AB3A 2XX3A 3C5CA 4BLRA 2F9LA 1NBMA 1R0WA 2GK7A 4RSGA 4XJXA 3P4YA 5FOVA 4OHZA 5D3MA 2J0UB 2O8BA 2BJWA 1U8AA 1HT1E 2F55A 2G77B 3Q7QA 1MO6A 4BZPA 4PAOA 5EE3A 3S1AB 3VU9B 2AR7A 5HZKA 1Z0JA 4A36A 5FUVA 1TNDA 2JASA 3UMFA 2OO7A 4FMCB 3SYNA 3CPEA 2OAQ1 1WCV1 2AKYA 4L9SA 1OXTA 3WMEA 1NVVR 3KKNA 1XRJA 1UBCA 4LCBA 1YR7A 2XJ4A 1E2JA 1E9FA 3GJXC 5L3RA 2F7SA 3AGQA 1XJ0A 3AVQA 3BH0A 3VR3A 3NH6A 2BBOA 3ICEA 3CIOA 3ADCA 3IILA 2AFHE 2VP6A 2ORWA 2JJ8A 2QM8A 3N2EA 3QKSB 2OCAA 2R6FA 2N1BA 5AJVB 2W00A 5EUQB 2ODWA 2RGNC 4QHTA 1R0ZA 4PSAA 2IS6A 1ELOA 2V7QD 1J8MF 3GFTA 3X2SA 1TQ6A 2Q9AA 4DUGA 5LB4A 2WKQA 5CB8A 4WIAA 1E0KA 2CJWA 2YHSA 3PQCA 2G0TA 1VDZA 1AK2A 1US8B 4M53A 4W5JA 1G19A 5CLQA 2DBYA 2PX3A 2QL6A 1J70A 2RB4A 2QP4A 4FIDA 4JMPA 2P2LA 2AX4A 3K70B 4B48A 1Z0FA 1Z0AA 1ZIOA 2C77A 3I8XA 3V4FA 5JS7A 4QHSA 1VCNA 2RH5A 2CXXA 2JLWA 2D7CA 3GLFB 1N0WA 1KAGA 1I2MA 5HTKA 2MSCB 2CCJA 2YKGA 4JBWA 2D62A 1A1VA 4Q47A 3MJRA 4V02A 4AYXA 4M1WA 5CJPA 5FBQB 1NVUQ 2F1RA 1JALA 4GZLA 4DDUA 1II0A 4RD3A 4BLSA 3BFXA 3BERA 1UKZA 4LJ9A 1ZUHA 5FUWA 3P27A 1AIPA 2HYIC 2OFXA 3RVBA 5BN4A 3MUFA 4ESHA 4DDWA 3GLIE 1OH7A 4OHYA 3OF5A 2GJKA 4LHZA 4RZUA 4DXAA 1CU1A 5EXXA 4PANA 2GA8A 5J4KA 1VKJA 4A6XA 4B3CA 1UFQA 3CBQA 5F9HA 3X1ZA 2W0MA 1CXZA 1RJ9A 2IEYA 3TR5A 1T0HB 4C0HA 3FMIA 1FNNA 3EPJA 3O8DA 2GCOA 3PUVA 2W2TA 1KSHA 2QMHA 3TE6A 3IHWA 1MABB 5IDVA 2JLUA 1IJFA 2ODNA 3BGWA 3OAAA 1MRNA 1PLLA 3REFA 4O0MA 1OKKD 1XD9A 3RSOA 4G5SA 3BB4A 4Y0VA 1W0KD 5A4JA 2Q3MA 4EKDA 2WKRA 1LS6A 2W0SA 3BRWD 4JLAA 2IBMA 3Q5DA 4MGKR 4LSGA 1EK0A 4TSFA 3U3MA 4DCTA 2H18A 4ZDIA 3WHKA 3THXB 2WHXA 1DAEA 2BKEA 3CUEF 4NCNA 1K5DA 1ODFA 1LTQA 4WW0A 2VF7A 3EC2A 4QBIA 4AG5A 3WHLA 3AUYA 4Q7KA 1GG2A 2EWWA 1YHNA 3EASA 5G41A 5HR5A 1BMFD 1AZTA 5FPHA 4DJTA 5AUQA 3CPHA 3KQLA 1DAIA 4QJ5A 4CRWB 1N6OA 2UKDA 3E1SA 2G83A 2OUKA 4TL8A 2GZAA 4TMVA 4HAUA 2FEMA 3M0EA 2WWIA 2IXEA 5AUNB 4PAMA 2W6JA 5JHHB 3T12A 4QXAA 1W0JD 4II7A 4AWXA 1Z6TA 1XMVA 4OQLA 3CM0A 4HDCA 5CK4A 2Z83A 3RS0A 3IPYA 1XEWX 3H84A 3DMDA 3K9GA 1SXJB 4JJZA 2E9SA 4JSTA 5AK0A 1U8ZA 2ZRHA 4LJ5A 1XWIA 2WPDD 2Q0HA 3T1TA 2FZ4A 1XEXA 1H65A 4ASUD 4IDHA 1M34E 1L4UA 4NYMR 1WB9A 4XH9B 1E0SA 5DYGA 4CEJB 1R0XA 3Q5EA 2A3RA 4TQAA 2ZAMA 1E79D 1ZD1A 3K0EA 2XSZA 2VHTA 2IUSA 3VX4A 4D80A 2C9CA 3VAAA 4HAZA 2R9VA 5FL7A 3TMKA 5L3QB 2PH1A 5JWRA 3FKSD 1YRBA 2NO9A 121PA 3BH6A 1SULA 4TLBA 4UNNA 4NU0A 1I2DA 2AD1A 2QUZA 4PC7A 4B35A 3N70A 1YR6A 1FUUA 2FF7A 1TU3A 4BASA 5E7IA 1CJMA 2FU5C 3EA5A 4FXPA 5BXQC 4M1SA 4P4SB 1RRFA 2ZRAA 2O52A 4ZCMA 1OH6A 1F60A 1W47A 4MDFA 1C4OA 4WZBE 2IT1A 4YXWD 4B43A 1KDPA 5K8IA 5IK2D 4LZZA 1D2MA 3VX3A 1FTSA 1W48A 2ZJOA 3U2QA 2VSXA 3TGPA 3GLHE 1FUKA 3QE0A 5L3SA 2DWQA 1BYIA 2ZANA 3K9LA 4P4UA 4PSVA 4M21A 1F2TB 4HZIA 3ZGXA 3RABA 1VMAA 3CWZA 4IVPA 3EPHA 2AD5A 3J81k 1IN4A 1E9CA 3IO5A 4JLOA 2QTVB 3NBXX 4X8LA 1OV4A 3L82B 4EPWA 2GJ9A 3B82A 3MMPA 2VRWA 3SZRA 4B3BA 4PC6A 3TQFA 4IOKA 1P6XA 3T15A 2D2EA 4I1OA 2Y8EA 2IYSA 4Q4AB 4DLXA 1KI2A 3C41J 4KBFA 2PJRA 2QPAA 3DO6A 3LXRA 1JXMA 2EFCB 4HAWA 4M9QA 5FFMA 4FMDF 5K8TA 2R6CA 4KFUA 2CK3A 2CE2X 2KI5A 3GLIB 1BS1A 3OFND 1E9DA 2CVHA 3F3YA 4LBYA 1M7GA 3O8BA 4OI1A 1R5NA 1XMIA 2J45A 5IF9A 1E4VA 2JEOA 3TLXA 4AKHA 2REXB 2ZQ5A 1QG2A 4JIMA 5FPKA 1E2QA 1IQPA 4NTZA 4LHWA 5EP4A 1D6JA 2BEKA 1QF9A 3P32A 3P20A 3QBTA 5EXPA 3U3JA 3ICQB 2CCKA 4KYIB 3I92A 1Z06A 3GEEA 3GD7A 4M9XA 4IW3B 4RZ3A 4B2PA 4ZDWA 1ZD9A 3FMOB 3W5JA 2DWOA 2ZTSA 1X8JA 4W5WA 2FSGA 2WVJA 1BO6A 2BCJQ 3IIJA 4NHOA 4CEHB 3BB3A 4JL6A 4DSUA 1KJZA 4Z8XA 4A4DA 3RS3A 1NSFA 1J99A 1E98A 3EW9A 3WY9A 4XWOA 4DSTA 2QM7A 2XOKA 4V0MA 2QGNA 3CR8A 3SJAA 1W4AA 1KZ7B 1GILA 3NHAA 4AYTA 4D6PA 2VA8A 2ZITA 521PA 1FPMA 3VR5A 4ZKEA 5EUMA 1XTIA 5FBWB 3WMGA 2OT3B 4DLTA 3HU2A 4TMKA 5E95A 4DCSA 3ZZTA 2WSSA 3B1XA 3NXSA 1LF0A 3CLVA 1R7RA 4I81A 4KFRA 5EXTA 1H8HD 2UZIR 4W9MC 3AEZA 2VSFA 3KFVA 4LUCA 2IEZA 3KJEA 2ZJ8A 4ZIRB 5KTYA 2CCGA 5E3HA 3QVUA 5JJLA 2NPFA 2Q9BA 4B2IA 3CNNA 3TIFA 3LXXA 3U7EB 1W4BA 2DR3A 5FI0B 2CLSA 4HUQB 3WP1B 3KQHA 3OEED 3I61A 2VP4A 1IN8A 3PITA 2Q21A 1LV7A 3AP3A 4LJ4A 1CF4A 2C2HA 2NTYC 2OAP1 2VP2A 2QA5A 3NWJA 4PX9A 1E2FA 1ZM9A 2PCJA 1TUEA 4OK5A 4Y0AA 5TXGA 3CRVA 3HR8A 3QEJA 2RGDA 1N0UA 1PUJA 1G5PA 4BLPA 1YVDA 4DLUA 1KYIA 1KJWA 1LW7A 3BWDD 1I4DD 3CX8A 1VHLA 2ZJBA 2ZYTX 1E2HA 4Q7LA 2IYYA 4HYYA 4GL2A 1EFHA 1QZXA 3AVUA 2C9YA 2IX3A 4JKIA 5GADl 1TUIA 3FWYA 1P4SA 2ZSAA 4GPTA 4B3GA 2ZI9A 1OLOA 4GMXA 3RWOA 1KO8A 4LBVA 3F8TA 4LYHA 4Q1AA 4XD7A 2WOJA 3TH5A 3A4NA 5D3MB 2D3WA 1T3HA 1R10A 3SYLA 5CITA 4XOIA 3LBNA 5DI3A 3T35A 1Q1ZA 4DC9A 2ZSDA 4Q9JA 2RAPA 1GKUB 3TW4A 2ZI5A 1J7KA 1X8KA 1SHKA 3V9PA 1DG1G 3IEVA 3GLHB 4LYFA 5FOTA 3SS8A 1LB1B 3TBKA 1SVWA 4RD4A 2GCNA 4LYJA 3RC8A 3BFVA 4IXNA 2GEVA 3WXMA 3KKMA 1GKYA 3K0AB 4C0LA 1MKYA 5L8VA 2YZ2A 1Q0UA 4N3NA 1VG1A 1WF3A 2MMCA 4C7OB 1DOAA 4UNQA 1DAGA 4F93B 1A2BA 5TY0A 3FHCB 3W90A 1S3GA 2QORA 5DGXA 1G4AE 2XAUA 4DVGA 1P60A 1KJYA 3SJCA 2VHCA 1DAMA 1XDBA 4IJMA 3DHWC 1DG3A 1ZD8A 2VO1A 5KSZA 3I8SA 2B7BA 4PZLA 1E2LA 2JJ2D 4DB2A 1DADA 3QXCA 1TQDA 4UNPA 1OXXK 1Z47A 3BD9A 3P26A 3X1DA 4M1KA 2FGJA 1HE8B 1ETUA 4A2PA 2YOGA 1QHHA 2YWEA 2ERXA 4HZUB 1TQ4A 3A36A 4F91B 3M1IA 3LQRA 4IXMA 4TTPA 2FJUA 2RGBA 4U7DA 1II8B 1MO3A 4A9AA 4G5QA 1V43A 2UVQA 3SHFA 4V0OA 5FBLB 4EPVA 1OIWA 2Z4SA 4PHGA 4OI2A 4RD6A 2WJYA 4JL5A 2IWRA 3ZVNA 2HDNB 1WDTA 1NLYA 3QXHA 5LPNA 5CDFA 2IUUA 2SHKA 2BBSA 4WAUA 3UATA 3K8YA 4Q9HA 2QMEA 3U4QA 4M22A 2V7QA 1XJCA 2BCGY 2FPKA 5AJYA 2NMVA 1P73A 3K9HA 3QKUA 4P32A 1N5JA 2PZGA 4D4MA 3P4XA 4JT4A 4WBSA 3A6PC 5BYKA 5KU1A 2WIAA 1JQJC 3MWJA 4YMUA 3B2EA 2OILA 2GCOB 4MRRA 2OG2A 1AJEA 1W4RA 3B1YA 5KSYA 4BPBA 2PZEA 4BEBA 3K0CA 4OI0A 1DVRA 2ZR9A 4R71A 4TN1A 2CMKA 3L0OA 1GAJA 1VYTA 4GP7A 4WZAE 4Z1MD 1QVRA 3D31A 2N46A 1P9RA 3ZS8A 4MDEA 3Q85A 4PZZA 4A8JA 2XEXA 4NYJQ 1GM5A 3BOSA 2J46A 4ABYA 1E1RD 2EU8A 1RE0A 5TDHA 1X86B 2GRJA 4FW9A 4NYMQ 2DFKB 4BQSA 3X1WA 4D0NA 5GVRA 3NBZC 1UEIA 3KXIA 3AUXA 4OK6A 1G7CA 3TVDA 4P0TA 5A0FA 1TPZA 3PUYA 4RJLA 5JRZA 4TZ6A 2GCPA 4TLCA 4HATA 3MWLA 4KVAA 3VR2A 1GL6A 4ZKDA 2J87A 3QJYA 4FWTA 2A5FA 5JFGA 1F2UB 1OW3B 2VLIA 1FMJA 1QDEA 4V0NA 2F43A 4OHWA 2ZSBA 3WYAA 5KSOA 2X8AA 2QT0A 5KPDA 3LVRE 3QF4B 1OKKA 5F2EA 4D81A 4C0SA 5KDOA 1W0KA 1IAQA 1Z0KA 4F38A 2J59A 4F4JA 2I1VB 2RKOA 2FWRA 2BDTA 4A0GA 4MUAA 1QHSA 1XEXB 4KODA 3IUYA 5JEEA 2G3YA 621PA 3RLFA 2O8CA 3H1TA 3AGPA 4EJSA 1PV4A 2HJGA 1EFTA 4RFSB 1AGRA 4BGDA 1OT3A 3AP1A 4Q7JB 3KJGA 2V3CC 3A4MA 2CDNA 2FDCA 5JLJA 2GXUA 2IHYA 4LHXA 1OIXA 1NSTA 1XZPA 1YZTA 1CJKC 5CM8B 3GLGA 3U44B 2A78A 4FN5A 3IBGA 4KSCA 3B5JA 4MYHA 2QTHA 4URXR 1AS0A 2R2AA 1W0JA 5GJBA 3PR1A 3PENA 4C9BA 3AVVA 2Q3HA 4RZXA 4C0JA 1XCGB 3L0PA 1XPRA 1XXHE 1G3RA 2QGZA 1E1QD 1NF3A 3IBYA 4GDFA 2Q9CA 1ZU4A 2VL7A 2WPDA 1KI7A 1P5ZB 1ZP6A 4LYAA 5FBVB 3SU8A 1V5WA 4PSKA 4D0LB 3AF4A 4WA7A 4ASUA 1NLZA 3KUDA 1Z2AA 1Z3IX 3UG7A 3WMFA 4KFSA 5CIWA 3QBVA 5HKKA 1KNXA 1W49A 2OEPA 4IVQA 3Q9LA 1LFDB 3WRYC 3VNVA 1E79A 3VTKA 2ZRGA 3FMPB 1R0YA 4B44A 1RPZA 2P5SA 3O8RA 3B1WA 3KB2A 3EIQA 1E9SA 3FKSA 4TMXA 4V0LA 4Q1BA 4AY2A 2PX0A 1Z6AA 3CNLA 4HI0E 2YVUA 1XTKA 1U99A 4N0EA 1R8QA 3KKPA 2A5DA 4NMMA 1TF2A 4AD8A 2AHOA 2ZE6A 2PEYA 4D0GA 1U0LA 5BN3A 3TSWA 5JJIA 2EVWX 5FOXA 5JMTA 1TQ2A 4A82A 1PJRA 4JKYA 4YQFA 2OZEA 5KUTA 1E0AA 1O3YA 3W9YA 3GJ3A 1G5RA 1SXJE 3L8ZA 5CK5A 4DT1B 5FUYA 4YXWA 2EYQA 2IF0A 3I1FA 2JIZD 5IK2A 4A2WA 4DLRA 2WWGA 2GXSA 2VHUA 3MG9A 3W6OA 1RFLA 1FTNA 3GMTA 3W3ZB 2IYVA 4NCIA 3KKOA 1XD8A 2AK3A 2ZJAA 2V8OA 1DTSA 2QU8A 3QG1A 3VFDA 4A0HA 4TLAA 3AM1A 2QQEA 3EA0A 2ODBA 3EIEA 1JNYA 2AXNA 2NO7A 2RMKA 1AM4D 4HLCA 3TUJC 2JLZA 3R8FA 1NMZA 3KUCA 1IM2A 5FI1B 2G6BA 1UBFA 1T5LA 3K0FB 4DLZA 1GDDA 2VEDA 2CLCX 2R62A 1AZSC 3CRRA 3I73A 3THWA 1XTQA 4B33A 3QEOA 3AVPA 3T06B 3B60A 1DE0A 1SXJD 3OIUA 5JWHA 3GJ6A 3GFOA 1HV8A 1P62B 1G17A 5CLLA 4JVNA 4V03A 2FFQA 4LBZA 3A8TA 4M1YA 4OHVA 1H8ED 2AKAB 221PA 3OFNA 2J7PD 3L43A 2W6ID 4MRPA 5TVKA 3SEAA 2HF8A 3PUXA 5C4GB 1OPXA 4JLJA 4R2IA 3I5XA 2QAGA 4NONA 4RKEA 5JHGB 2VHQA 4Q5IA 3GJ0A 3K0CC 2Q3FA 4LRWA 2W2VA 3C5HA 1NY5A 3MWYW 4HLUA 2PT5A 2IA5A 1R5BA 1KAOA 4EUNA 4LPKA 2IYLD 5E4FA 2F1IA 4A8JC 3GPLA 1CTQA 2GZHA 3PEUA 2QZ4A 2WSMA 3LY5A 2KE5A 4TQUS 2HEIA 2GXQA 2ODEA 5KDLA 2ZVPX 2ORIA 1KY3A 2FG5A 3AKCA 1KHTA 2EWVA 2YWFA 4NPHA 4KVGA 4P33A 2X19A 1GUAA 3RSLA 3TR0A 2BVNA 2HV8A 2H16A 4LJ6A 3DKVA 4LDJA 2QN6A 4Q18A 4DCNA 2KSQA 2YYZA 2FMXA 1MO4A 4O2LA 4M9SA 3T1OA 5SZKB 4YMTA 4MA4A 5DISB 4K8OA 1G64A 1CEEA 1W36B 2IYWA 2Z4RA 1N6HA 4QFMA 2AWNA 3HJNA 3M6AA 4A92A 4KSBA 1NG1A 4MQBA 1M74A 2B21A 2GILA 1H8HA 4Q19A 5HPYB 4HAYA 1U0JA 1UF9A 2WWXA 3BBPA 3SFVA 4AIIA 3SJBA 2QPOA 2BMEA 4MKHA 2ZI3A 3UPUA 3GJ4A 1E9AA 1N5LA 1E32A 2J0VA 1P2VA 2RHMA 1RYHA 1NLFA 4FWIB 1XXHB 4IFBA 5BWMA 2F1JA 4PQYA 1IJEA 1OXSC 1UPTA 3OEEA 4DIDA 4UQOA 4EJSC 4ARZB 2BM0A 1MT0A 1QVAA 3TAHA 3RRZA 4U00A 2EFHB 2MSDB 2VF8A 5EE1A 4TL7A 4GSYA 2XZLA 2ZRIA 2GJSA 2ZJYA 3THYA 4TLDA 2GAAA 4L8GA 2ONJA 4RD1A 1CS4C 1SVIA 1TU4A 2H5EA 5AWFC 2GEDA 3T5GA 4EPXA 5C1BA 1XCPA 2QE7D 3LW8A 1R2QA 2LKCA 1G41A 2PL3A 3CF0A 3RS7A 3ECCA 1MOZA 2QQ0A 2IL1A 2C5LA 2QPTA 2DYKA 4ITRC 3QIAA 4Z8YA 1U0HC 1EX7A 1JR3E 1FX0B 2AFIE 4Q4JA 2JLXA 3NDBB 1KDTA 1KO4A 1P7CA 1VG0B 3ZDQA 4JLBA 4MYUA 3OIWA 1HQCA 3AKEA 5FTKA 3TAUA 2NOAA 3TSOA 5H68A 2ZS9A 2XZOA 4EPYA 1TF7A 3NKVA 2WAYA 1G8GA 3IPXA 1OF1A 2GJ8A 4F4IA 1OE0A 1ZVQA 2ZYVX 3P1JA 5GJVC 1T5IA 2Z5FA 3NIBA 3ONWA 5KNBA 3CO5A 1KI3A 3W6PA 3SYKA 2OM2A 1SKYE 2DWPA 3MAAC 3RANA 2A5YB 2GKSA 4EFLA 2OLJA 3CRW1 1YU9A 1TMKA 2ZRJA 4CDGA 4TYPA 2QROA 2P0EA 1NRJB 2EQBA 5C4MA 5FTMA 5AUOB 3LAWA 4AC9A 4B3DA 2ZE5A 2C9OA 1YZGA 3LRPA 4Q9KA 2AK2A 2XB2A 1KI1A 4HUTA 1S96A 4KBGA 2G9NA 4DSOA 4PQRA 1UBEA 3C7KA 5FUXA 3QNUA 4EQ6B 5HZHA 1YR8A 3X1XA 4TMTA 3VR1A 1KK1A 1NBME 1Y3AA 4KV9A 4P3YA 1ZUNB 3U6BA 1VYUA 3GJ5A 3REGA 2JJ2A 3DOFA 3IKJA 2YINC 4PC3A 3KXLA 4QNMA 4IFEA 4TTRA 3RDPA 4DEXA 3SDZA 1IXSB 4D26A 2ZI7A 2PZFA 3GEHA 3KTAA 4NE2A 4DLVA 4JL8A 3VNUA 2AL7A 4DIEA 1FQKA 5B57C 4GT1A 1F3OA 3ZS9A 4G01B 4LJ8A 4FMDB 2X2EA 2VSOA 2C96A 4I1UA 4QBFA 3ZD6A 1XZQA 4TYYA 3ND8A 1EFCA 1RRPA 4BLOA 1KOFA 3SI7A 5B30A 4DCVA 3FGNA 3IGFA 2NPIA 3OE7A 3HYTA 2H17A 3FHTA 1PLKA 4RKFA 2OBMA 4OBEA 1S9HA 1TTTA 2FSHA 4U5XA 1OH8A 1XMJA 5K8UA 2HUPA 1SGWA 2I1QA 1X6VA 2YJTD 3A1UA 4YDSA 2WMNB 1Q44A 3FYHA 2IC5A 4B73A 1NKSA 5LD2C 2WWYA 1ANKA 3IIMA 2W58A 2ZRBA 2B8WA 2OSBA 2V1XA 3B6EA 1FNMA 3QPWA 4UXIA 4B3FX 1M2OB 4M0LA 3I5YA 3U7GA 3EC1A 2QBYA 1W4CA 2W2XA 2QAGC 2ATXA 2K5UA 2IW3A 2JAQA 1GFIA 1J90A 4PFSA 4LOAA 1NN0A 2IF2A 4M8NE 4HLUC 3PEWA 4D82A 3T1VA 4Z1MA 4BRUA 2J5XA 4BZQA 3LX5A 1DPFA 1G3MA 3FOZA 2QP3A 2PCLA 1VPLA 1Z22A 4X8OA 5KHOC 4G3XA 1E1RA 4MYTA 1CULC 4LHYA 4Q1FA 2J0UA 3AP2A 3GQBA 4DDTA 2J0QA 1E99A 4O3MA 4CIDA 3VU9A 4C2UA 3S1AA 3ZD7A 1W44A 5JRJA 3W6NA 3OHMA 1FP7A 5FOWA 3VQTA 1XBTA 3DDCA 2ZROA 4AK9A 4ZI2A 4OYHA 2XB4A 2QY9A 2ZRCA 4PHTA 2QAJA 4NYIR 1LNZA 5JSZB 4GFDA 2B7CA 4ON9A 1YZQA 1Z63A 4PHFA 2GK6A 5BYJA 1TX4B 2NO6A 1ZM2A 2FFBA 4URWR 3SJZA 2RGGA 4XVRA 4YMWA 4A6PA 2BV3A 2WAXA 4PPGA 5GJCA 4S2EA 2LKDA 3ASZA 3C14C 4S35A 2ZUDA 1GRRA 3R9WA 2XTNA 1GVNB 3EPLA 2P6NA 3FFBA 5JZVA 2J1LA 5CYOA 5HE9A 2IS4A 1T3LA 2KWIA 3HDTA 1NG9A 1R6BX 2CBZA 4BFTA 3PCRB 4FCWA 3U61B 1FOEB 4LK2A 4PAQA 2NZ8A 1Z07A 4N1AA 2W83A 3R9XA 1ZM4A 1YZUA 1NN1A 3ZZUA 4CZ2A 3I4LA 2BIFA 1ESNA 3ADBA 4HDQB 1SKYB 3W8NA 2ATVA 1OFUX 2QT1A 1Z29A 2QMOA 1NVVQ 3N2IA 5H70A 3AF0A 2OCBA 4MYCA 5K8LA 1HE1C 3GLFA 1G20E 4IEIA 3O47A 4PR0A 1HQYE 4URZR 4CEIB 3DMNA 4LI0A 5JWOA 4XSHA 3O8CA 4XTCS 4QGHA 3CWQA 2XZPA 3E2IA 4QNRA 5CIQA 2YC4C 1E1QA 3IO3A 4MKFA 4JSYA 4A0FA 2RGXA 2GF9A 2ZYWX 3F0TA 1MH1A 5E7MA 1E2MA 3TSZA 4E07A 4M2LA 2AWOA 2BWJA 4FINA 2O8BB 3IQWA 1E2EA 2JCSA 2DFLA 4HDOB 3QSYA 1XF9A 5D3QA 2WICA 2TMKA 1JEDA 4C0BA 3KQNA 1P9NA 3ADKA 4QM7A 2G0NA 2V55B 3CKLA 3KXKA 4GP6A 4OJQA 2P5TB 1ZU5A 1G291 3EZ2A 3I3SR 5JS8A 3UWKA 1MABA 2W6JD 4PXAA 3MRSA 4TYNA 1E2NA 3L0IB 2QEQA 3THWB 1AN0A 3RWMB 1L7VC 4URUR 1DELA 2H7VA 3K0SA 4JLKA 4RCYA 1D2EA 1AS3A 3BAFA 4WZ6A 4YDHB 3Q7PA 3U3KA 3CR7A 2FEOA 4HSEA 3THXA 3CF6R 1X3SA 4EFNA 1QHNA 2WJGA 3ND9A 1KSJA 1CLUA 3AKYA 4KO8A 4Q66C 2O8EA 2ZREA 3IDQA 1HURA 4UJ3A 1RVDA 4LV8B 2J7KA 4PO1A 3AVXA 3MGCA 4DSNA 2G1KA 2B6HA 3KJIA 1JJVA 4A2QA 2CJWB 3K09A 3EAQA 3TK1A 4C0AC 5FL7D 4I1SA 4D4KA 4WXPA 2VP9A 3EWSA 2VP0A 3NTUA 3DL0A 4B2LA 3QKRA 3LFUA 1Q12A 1ZM7A 2YOFA 4IOLA 1E9EA 1EWQA 2PT7A 3UKDA 3H4MA 1P3JA 3AF2A 4ACBA 1DAKA 2FE4A 4L16A 1QHYA 2RHDA 2HXSA 1FQJA 2EYUA 4LJ7A 3RNLA 4GMDA 4Q9IA 3PXGA 1XCMA 4AI6A 1SXJA 1XD2A 2A7QA 2VPPA 1ZNXA 3BS4A 3R7WA 1G8YA 3SBEA 3QKTA 4B71A 1JQLB 3B78A 1EFUA 3AVYA 1H8EA 5A5GA 1W46A 6Q21A 2G88A 2J7PA 5IT5A 1A5TA 1WQ1R 1KKLA 2CE7A 2WJHA 1ZCBA 2W6IA 1YZNA 4DLSA 4FD2A 1IOZA 1KO1A 2REBA 1CR2A 1XFAA 3DM5A 4YC7A 1U8YA 4Q4LA 3L8YA 2ERYA 1G6OA 1XPOA 2GETA 2OE2A 2ZRPA 1RJ9B 1N5IA 1WMSA 4JT2A 1M6NA 1N6PA 2P6UA 4YONB 5HCIA 1UKEA 4NCHA 2ZI4A 3U3RA 2XTMA 2ZYUX 5DSZA 3KDSE 5EE5B 3B9QA 4PTLA 2PMDA 1Z5ZA 5E7JA 1TADA 4L5BA 3T34A 2HLDD 2ZRLA 4KXFB 1YE8A 1RW4A 1BYUA 3FMFA 4MKGA 4X8HA 1OXUA 4OK3A 3HWSA 3VKWA 1AQUA 4V0ME 3MFYA 1KGDA 2V6IA 2R8RA 2YNMA 3H0KA 4AG6A 4O2RA 5B64A 8OHMA 3BXZA 3B1ZA 2FZLA 2NGRA 4H1UA 2WJJA 1QG4A 1KMQA 2JA1A 1O87A 2IS1A 1ZUIA 4X8MA 1CJTC 2A30A 1NN5A 1F2TA 4E03A 4ZI3A 2HCJB 1KSGA 2GAOA 4PQFA 4BFXA 1AS2A 1KK2A 2H57A 2GF0A 1SVMA 3AH8A 3EG5A 4BFUA 1Z28A 4I1VA 5F98A 4B6FA 4FI3C 2BJVA 4UJ5A 2V54A 2OLKA 4GBMA 1JPNA 1Q1BA 4Q02A 3MWKA 4Q4AA 1R8SA 1G18A 1HY3A 4XIGS 4F92B 3SHWA 1EXMA 1K8RA 3B85A 4RD0A 4KI0A 1GNPA 3EARA 3DM9B 2FPMA 2KBEA 5KOYA 1D2NA 3BC1A 3G5UA 1G8FA 1Z6XA 2VIIA 3D3QA 3GLIA 1T9HA 4H1VA 1TAGA 1ZBDA 1ESMA 3LDAA 5TV2A 2O8FA 2P6RA 2WTUA 1J2JA 3TQCA 3R20A 4QHYA 4LJAA 3NEJA 4HLQB 4OL0A 2QRZA 1SVLA 2JLRA 1TEVA 2NZJA 4NKRA 1SKQA 2IXGA 1NL3A 2QE7A 2Z0MA 1BMFA 3BH7A 4I4LA 1RC8A 3PEYA 4WOPA 4LHVA 1G1MA 1WXQA 4OQXA 3W34A 3K70D 1N6KA 4KLNA 2QSZA 5F9FA 1NY6A 2Q6TA 1S2MA 2CNWD 5AJWA 4IOJA 2O8DA 1VCMA 5ELXA 1KMHA 4CEHA 1S0UA 4ZDJA 1F5NA 1W5SA 4BFWA 4K81B 5J40A 1I4LD 2E1RA 1JJ7A 2RGEA 3HPQA 1E3MA 3NBFA 3RS5A 3I62A 5BW8A 5EXSA 1OB5A 3LNCA 1G5TA 5BQ5A 2WWHA 1K6MA 5G3YA 1VECA 3ZVLA 3KTAB 1FMLA 2JLSA 2ZPTX 2ZRMA 4Q1DA 5AJXA 1AKYA 1U9IA 2ZUBA 4PPNA 2DFTA 4DCUA 3AF3A 1FFHA 3UANA 1DAHA 1KTVA 5L3SB 1MO5A 2O5VA 2CHGA 1DEKA 2ZRNA 1NI3A 3TKLA 1PUIA 1W2GA 4RD2A 3GP8A 1W36D 2ORVA 4PO8A 4G5RA 4B74A 3LLUA 3ZIAD 4D4LA 2D4HA 4M4SA 4N0DA 2PBRA 1E69A 4US2R 1XEWY 4CW7A 4TZ0A 1JAHA 1N5KA 4DHEA 1UM8A 4ZIRA 4QM6A 2V6JA 4GOJA 3FHOA 5FOSA 3T1QA 1IN5A 1SZPA 4CYMA 4BFVA 4C2TA 2I3BA 3RAPR 4NCKA 3CH4B 1R4AA 1IHUA 1DARA 2OFOA 3ZZ0A 4HUQA 4R7ZA 2ZRFA 4ZO4A 2OXCA 1DO2A 3E5HA 5CYPA 1ZCAA 1OJLA 1G16A 2BOVA 3C4JA 5HE8A 1JEEA 2O0JA 4XVQA 2G1JA 1KKMA 2A9KA 2D06A 4QC2A 2JDID 3LH5A 4EAQA 1NJGA 2BMFA 1N0VC 2N42A 4KFTA 4NYIQ 3K09C 4ERNA 3R9IA 1GITA 2ZJZA 1XEFA 3EZ7A 1T3SA 3T5DA 1RRCA 1QBKC 3AQ4A 3C16C 3H86A 4HB2A 3FDIA 4LY6A 3TRFA 4DRZA 5SZJA 3WBKA 1S3SA 2FPLA 2GTPA 1T8UA 4EPTA 1GNRA 1VG8A 1KZGB 3CZQA 2BMJA 4NH0A 4TT3D 1JECA 5EP3A 4DZZA 1Q57A 2D74A 4CT5A 2GVZC 3AVWA 3MLEA 3PEVA 3BK7A 4TMZA 2HXYA 1NVWQ 3HPRA 3HU1A 4HLDA 5KSPA 2CL6X 3V4RA 1SXJC 2EFGA 4KYUA 1NP6A 1N6NA 5AR1A 4ILEA 5M04A 2WBLC 4IOMA 1C1YA 3LWNA 3NC0C 3DKPA 5CDFE 2JJ1D 3KKQA 4OI4A 1VYVA 4Q4HA 2LCFA 1IXRC 1W2HA 4YMSA 2IYUA 3T61A 2EFEB 3WYGA 2REOA 3EZ9A 4JLMA 2OBLA 2IYZA 3GLHA 4PZYA 2BEJA 3IQXA 3WRXC 5J5CA 3D6TB 4RZ2A 3U60B 3B7GA 2R65A 5SZHB 2A5GA 1M7BA 2GNOA 3EIHA 1RIFA 3K0AA 4Q7MB 2ZJ5A 4C7OA 2WV9A 2ZI6A 3SE0A 1Z08A 2C78A 3MSXA 2L0XA 4IHQA 2OBNA 1COWD 4W5HA 1W1WA 1OIVA 2CVFA 2ECKA 2QI9C 1ZMXA 1EX6A 1G8HA 1KNQA 5JI3E 4CT4B 3RYTC 2IS2A 4OJKA 2NQ2C 4FMCF 2XNDD 1BIFA 4Q9LA 1E9BA 5KYKA 1VG9B 2QNRA 4ZCLA 4DWJA 1U98A 2HJVA 3LBIA 5FPTA 4C0QC 5DNYB 4Q1CA 4BFYA 1AA9A 5G53C 4HB4A 4BFZA 5FTNA 1E2GA 3B13B 1Q1QA 1E2DA 1NIJA 4JLDA 1X1RA 4NBSA 2CHVA 2F6RA 3LV8A 2YC2C 3Q3JB 3ZVMA 4HZUA 4NCJA 5J47A 4XWAA 4JS0A 2WZQA 2HT6A 4US1R 3R8CA 3LQQA 4NP6A 3U7FB 1II8A 3VHLB 4DLWA 3OEHD 3FB4A 2DCUA 5DN6D 2GDJA 4EDHA 2DY1A 3HU3A 2NO1A 5H1YA 4QRHA 1WBBA 3AV0B 1JR6A 1IXZA 1G4UR 5JCZA 2E87A 1HEIA 4FMBB 1CR1A 4LGMA 4NL4H 4M1MA 1M7HA 1KK0A 3RHFA 1ZNYA 3PUZA 4Z54A 1Z6YA 3GCGA 5DI3B 3AF1A 5EJEA 4KAXA 1S9DA 4CF7A 1NMXA 1IONA 1CRQA 1KK3A 1CJVC 2VP5A 2V9PA 5G40A 2D7DA 3FFAA 3ZLJA 3GFPA 1GL7A 1GRQA 1Q3HA 4IDQA 1CP2A 2BMDA 4A1FA 1AGPA 3GLGE 1Z83A 1T8TA 4BRWA 2ZSEA 3QG5A 5FTJA 1K5GA 2ZU0C 3NEYA 1RRGA 3A37A 4GZMA 3VHXA 2XGJA 3MJHA 1N25A 5FTLA 2ZE7A 4E5UA 2WWFA 3BIFA 3PUWA 2O0KA 721PA 4C0KA 2ZR7A 2JGNA 2BC9A 2FA9A 2GWHA 4OQMA 2O8EB 4QL3A 1UEJA 2FN4A 1E0JA 1G9XA 1OSNA 1UDWA 2X1VA 3SBDA 1GKIA 1U9IC 2BHRA 2FX3A 4GOXA 4AYWA 4BLTA 3MD0A 3AVTA 3DZDA 1GZSA 2ZSFA 3KFXA 1CBUA 4H9GA 1JPJA 2HF9A 2F1HA 2GBLA 1Z0DA 1F2UA 1KI8A 3Q8XB 3PG5A 1KSFX 1S1MA 3SNHA 5G3ZA 3QKRB 1QHHB 4R2HA 1QHGA 2ZS8A 4US0R 1YZLA 1GTVA 1KO7A 1SVSA 3ZVRA 4B34A 2IYRA 2FFAA 4C3ZA 3A1VA 1ONBA 1JR3D 3QF4A 5C46F 1UJ2A 2WJVA 1EFRD 2IUTA 1LS1A 4QGFA 2CEAA 2GESA 3K9NA 3NC1C 4QBGB 4B6EA 1XD2B 2DB3A 4KU4A 4NYJR 3R7WB 3A4LA 1HT2E 1BH2A 5JJKA 4W7SA 3K53A 2WWWA 3TJZA 1RZ3A 2I4IA 4MUBA 1ZNZA 1D8TA 1JBKA 4ACAA 4EIWA 4UKDA 1OYYA 1C9KA 3B1VA 1ZNWA 1LF5A 5HKKD 1ZW6A 1UADA 4GNKA 4BUJA 3U4QB 4K46A 3QXJA 3QPUA 4RFSA 5B58C 2XXAA 1M8PA 3OESA 4XSGA 3E70C 1KI6A 1OHHD 1NIPA 3EXAA 1F48A 1U90A 5EQTA 4DKXA 1JXOA 2RGAA 4B75A 1KI4A 1Q20A 1P2UA 2FFHA 3DEFA 2VH5R 2FOLA 2QENA 3LA6A 4YMVA 5JECA 4NZYA 3GEIA 4G0NA 4AKEA 3U44A 3MCAA 1NN3A 3RS2A 4OHXA 3LBHA 1GL9B 5EP2A 2R6GA 4TL6A 1G7SA 1MV5A 1N2CE 4HAVA 4JBXA 4L4UA 2HT1A 4A8JB 4AKIA 4LC1A 3U5ZB 4MGYR 1UDXA 2IHBA 4MGIR 4O25A 1JB1A 4QG7A 5KNDA 3ASYA 1NBMD 4FCTA 3A58B 2VHJA 4ZDKA 4G5GA 2CHQA 5DHFA 2C03A 2YV5A 4TQ9A 3WYFA 3U6KA 1Z6GA 3OIYA 2OCPA 1QRAA 1WRBA 4JLPA 3SN6A 1IN7A 4MH0R 2JLVA 2VYFA 5EZ5A 5EZ6B 5AJZA 1Q21A 1UBGA 4KJZA 2OXRA 5JI2E 3Q72A 1WBDA 1N3BA 2PMKA 1L4YA 2ANBA 2QTFA 2F43B 5FR2A 2NG1A 4PO9A 5EE0A 3QY0A 4JVLA 4L9WA 3QOFA 3SC3A 1OH5A 1FW6A 1LVGA 5SZIA 2PEZA 3CNOA 5DE3A 3UMRA 1HUQA 1YQTA 1YRAA 2ASEA 2D2FA 2HLDA 4POAA 1XPUA 1F6BA 2Z6VA 5DIFA 5C18A 4Q48A 3ETLA 1E2PA 4TTQA 4TWZA 1XNJA
chains in the Genus database with same CATH superfamily
5JW6A 1KEEB 1Y34E 3EH2A 1ZD5A 3RK1A 4DT1A 1MNQA 3VZBA 3ZD8A 2FWPA 3RT1A 5L95A 1EP2B 4OCZA 3GBSA 4FJ1A 2O8FB 2O8CB 4EJSB 4UHJA 3TFWA 3ZJUA 2VZ9A 2XV1A 3DPUA 4DUGD 2N0SA 3MW8A 1X7HA 3BN3A 1IY1A 1CZHA 1UJBA 3H9JA 3OPXA 2DECA 4AZ0B 3RC1A 2WHYA 4BAGA 4IHJA 421PA 1D9XA 1ZN2A 4CDRA 1NC3A 1J0BA 3G82C 4HO1X 4HKTA 3RRMA 4GI7A 1F8FA 1EYZA 1IEQA 1C30A 2X77A 3PDHA 1XHFA 3O3NB 5JMWA 3SYMA 1V7CA 3UMVA 3SFZA 1SUDA 4IGIA 3DMHA 5P21A 3LX8A 4TSKA 4WL0A 2J5RA 5JS6A 1Y4ZA 4BFSA 1B00A 1QQ7A 2X0FA 4MUYA 4CLEA 3IIKA 1SQSA 1RKUA 1I80A 2ONKA 2ARKA 4UEJA 1CR0A 2C0CA 4JWKA 2B4AA 1YQUA 3OIVA 3IP8A 821PA 1Y1KE 5KNDH 1X92A 1UBTS 4I4TF 3VTZA 4EHFA 4XR9A 1JH9A 4NS1A 5IJAA 4YFVA 1KI9A 3ZY4A 1SC6A 3GYBA 4R1PA 3ZH9B 1PNRA 3FBWA 3K1AB 1SQ5A 4O2AF 3FGOA 2R8YA 2ZKLA 5JFOA 2P9FA 4TPKA 4CLHA 4FFWA 4Q3OA 3WAKA 1YBHA 3NGLA 4TYWA 1TECE 2DHRA 3OD5A 4G0QA 3ZTTA 5D5HA 4TMWA 1VHQA 4I8XA 4RJIA 1KFEB 2W6OA 2IPNA 3W3AA 4NATA 3FIUA 4N5IX 3GRYA 3P9RA 1CUCA 4JUAA 1GTRA 3O1HB 3PL5A 1QH1B 4GLOA 1PEAA 4C2BA 4DC1A 2WFLB 5BV0A 1TFUA 1T9BA 3K1TA 3CF2A 2PS9A 3DO8A 1D09A 1DRUA 1VL0A 3T3DA 4RHYA 1XMSA 3DZKA 3WICA 1Y63A 1Y9JA 5L40A 1SU7A 1A1SA 2JFNA 4EUHA 1JI0A 4U63A 3TOSA 4XRRA 4ZT4A 4BGVA 5K6TA 1KDOA 1Q1AA 3BDIA 2QP9X 4BNMA 2ACVA 3HV0A 5EFZA 1IN1A 1VXOA 1HNNA 2GTHA 4WOKA 3JZAA 3FF1A 2QWXA 4K3VA 2OZKA 4BJ5A 4MWSA 5AOVA 3KWJA 4UMFA 3UK0A 4UCFA 3OKFA 5KVAA 2IQIA 4B47A 3ZXYA 2NSYA 1JEQA 1GGNA 1ZL2A 2GPAA 3GZ4A 2FH5B 3K1JA 3OCYA 1QHIA 2XZDA 3K96A 3PC8A 1TL7C 4AURA 4ESVA 1IN6A 2O3UA 2OL4A 3DE4X 2C3YA 5E38A 5T64A 1SU4A 5F7OA 5CM9C 3RK0A 3K71B 3EZFA 2R6AA 4BNJA 2OV2A 4NNOA 1XMQB 4L6IA 2IUFA 4I6EA 4MMXB 1ZC4A 5BR7A 3PUIA 4V1CA 4QGAA 1DCTA 5JO0A 4O4IF 2PLNA 1J9ZA 5D2CA 3HCBA 1JU4A 1OFHA 1PJZA 3X3HA 4CI0B 1HE5A 1N2CB 1NURA 4YLGA 2P2GA 2ZAGA 4DAOA 1FZTA 3W8RA 1PN3A 3MK31 1N5RA 1V5FA 3RRYA 2OHIA 5JCOA 1PWEA 4BWVA 1LY1A 4HV4A 4Q4HB 1Y81A 3DMTC 3G9XA 4WCFB 2A2ZA 2XWSA 2GN0A 1J8YF 2OHFA 1ZMTA 4R3UC 2IHZA 4DNXA 5I7VA 3G2MA 3NR2A 3R76A 1TO6A 2VK2A 4OQ4A 2QX8A 3AUAA 1BGVA 5J3JA 4W5QA 4NK5A 2L18A 4E5SA 3TD9A 3C48A 1VCIA 3IJEB 3L8DA 5DH9A 4X93A 2NO0A 5IC6A 3NRJA 1J06A 3QVGB 3MGBA 4KITB 3JPYA 4IM7A 4TT3A 3C15C 2SKCA 1SWVA 2JCGA 1OLUA 1XR3A 2REQB 3QPCA 2PD3A 3DTTA 4JLNA 4C3VA 3ZDEA 1FX0A 4FYPA 1M8GA 2QJOA 2P8JA 5CA0B 2IYTA 1JH8A 4KV7A 1KEZA 2FSUA 3I9LA 2GPBA 4D43A 2D0IA 4URYR 3IEUA 3PNLA 2ZIAA 4RFVA 4F7WA 4DR2B 4GICA 3BRQA 2RARA 4J0QA 3PTLA 4QQFA 2XF2A 1Q5PA 2VTVA 1AXEA 1RQRA 1FU4A 1BOFA 1TYZA 1RCUA 4DYHA 3FDXA 4E5VA 3BZUA 4ECAA 1E4YA 2WLTA 1KC3A 1FUIA 4I4NA 4WOCA 4X7BA 2IEDA 2C59A 3HXPA 3L06A 1TUGA 3CLKA 2KQUA 5J1SB 1A2KC 3VR6A 3R7AA 1RAEA 2C95A 3WK7A 3HHPA 3UIEA 4BZXA 1H2XA 5DSXA 1NTOA 2DZDA 3IP7A 1X8XA 2C98A 4CEJA 1FDSA 1W25A 5EKTA 2GBFA 2QXUA 3UTCA 4Y18A 3ZIUA 4KCGA 2WRZA 1J23A 3HEBA 2HD4A 3H2YA 3M3DA 3SMQA 4A10A 1P0PA 5IVPA 5DM0A 5L3QA 5AM1A 4JXJA 3CNQS 1MFZA 1OMOA 1SG0A 1Z75A 4IKEA 3KSDO 5TGDA 2ZVQX 1EFPA 3VNRA 4MVCA 2GNAA 5AHOA 4PHHA 5GJWC 3KCQA 3HKBA 4JBNA 4D4IA 2QRJA 4G5OA 4IG9A 3K6SB 1JEOA 2XB6A 4CLRB 2K2QB 1I14A 1XTRA 4P84A 4NJEA 3UC9A 3M82A 1J8VA 2PSJA 3GB9A 4FSHA 1U94A 4PC1A 2IV2X 4PPQA 4NMXB 1ZGAA 2XKJE 4IDPA 2O7SA 4OGWA 3OZXA 4UXHA 1RAFA 5L3VA 3WLAA 2J32A 1XDUA 4PLVA 4G5YA 4IVRA 5JIBA 1XMOB 1BEUB 1XTVA 1NAHA 4UAUA 3RFXA 4UFNA 2FK8A 5EI5A 1L2TA 2ODQA 1WDMA 2ZJ2A 2A1UB 2QU7A 3F4BA 2UXBB 1EG7A 4FPXA 2F00A 3TZBA 2AG5A 4OHBA 1J42A 4MCJA 5BSVA 2V0NA 3FVQA 1D03A 3R3YA 2VJMA 1CDEA 1RC1A 1LBIA 4YAGA 5FR1A 4YRKA 5IEJA 3A10A 1P2DA 1RP7A 2ZJFA 3HL0A 4H7HA 3BGDA 3OEHA 5CTAA 4QBTA 2HCBA 3BX1A 4TV9F 3LLMA 2AJCA 1K6IA 2QMUA 3CPJB 4QUHA 3ZQ6A 4P31A 1A3CA 2QOEA 3CE9A 3FOWA 4TZKA 4C4PA 3JD3A 2ZUUA 5ITZB 4CIBA 1NX9A 3FTQA 1AH2A 3IP6A 1OVGA 4KQJA 3PT5A 1L5LA 4D3DA 4NQZA 1EG2A 2PV0A 5HKBA 1BFKA 4OXRA 1CQJA 4N03A 2OOSA 4AJPA 2GJ4A 4C4OA 1M6WA 1Q6YA 3AUFA 3FVTA 3V4VB 5FH9A 2NSJA 4WV3A 4YFYA 4DQXA 1E20A 1B73A 1W4ZA 1XRMA 4UHEA 1Z36A 2CW5A 1B16A 2IK8A 2DPHA 2YWHA 4GRAA 4S3MA 4BFLA 4EO7A 2W4IA 2C8KA 4EYQA 1G0OA 3NORA 3WLNA 4RQAA 1UUFA 4XGNA 2BEWB 4EW6A 5DLQC 2J09A 3Q8KA 3U3OA 2VYVD 2YIDA 5ECWA 2EFDB 5EE9A 5JXIA 2ZS7A 4LOKA 4F1KA 3L18A 1PR1A 4E7PA 3URKA 2R1VA 2DBZA 4OX9B 1EM6A 4O4LB 1XZEA 3PVSA 3KQQA 3B6IA 1NW5A 1L5VA 1YE5A 2GUWA 3E58A 3HA5A 3TBHA 2UZ3A 1K98A 3V8EA 2BGGA 2DKFA 3VI4B 3PF9A 1P6QA 3LFTA 4LZNA 3I32A 3ONVA 2YFKA 4N49A 3FE2A 1XALA 4WNIA 2BKXA 5FL3A 3UHAA 4BQPA 2FB9A 3BCRA 3MIZA 2I80A 3QW2A 4CU2A 4B4OA 2F4VB 4AO7A 4OQFA 2XBMA 4RHXA 1CJUC 4G2NA 5KSWB 1XSEA 3F9RA 4PYNA 4B76A 1KI6B 5FTWA 2BGTA 3GGSA 3ZQ4A 1QV6A 1E5VA 1S3IA 1HTWA 2OPHA 3U1TA 4ZZ1A 5LP6B 1JV2B 3AYZB 3FXAA 2ZJ6A 5IF3A 4OMUA 2AN9A 2JBAA 1J6UA 1CS0A 2AZ4A 1JA1A 1W0CA 3QPVA 3PVCA 4WI1A 1JPVA 3IHLA 4ZQHA 5FPSA 1KYWA 2Q45A 3R5TA 1WULS 5ULLA 4DM4A 2DUMA 1Z4NA 5H9VA 4UXJA 5JSZA 3CZMA 2XF8A 4JJ8A 4E22A 5AVWA 3OPQA 2QF7A 3K3PA 2D7JA 3Q15C 1EWRA 4C88A 4TV8B 4E09A 2W2QA 1FNBA 1K27A 1WU7A 2GLXA 4QVKA 1JR3A 2ZEJA 2H92A 4M9ZA 5T8KC 3CWCA 1HMPA 1Z2OX 2AMYA 1I24A 1ES9A 4RCZA 2C99A 1NVXQ 2JJMA 1P4HA 1UPCA 2OFPA 1M6YA 4QGGA 3P2IA 3P2KA 4XTRA 2O3SA 4XCXA 4YP5A 5CXSA 5CB4B 2FWNA 3BE4A 3WLTA 4JVMA 4WFIA 4WVFA 1A9TA 3G59A 3NW9A 1ZKMA 3FHJA 3QX9A 2OHGA 3VPBA 4AWBA 4RHCA 3I6ZA 2P2ZA 3FPAA 1O58A 4B32A 2FWJA 4D3FA 4GOKA 3WNDA 2JLYA 4Y30A 3UAYA 1JEYB 2X0DA 4WE3A 5GWXA 1VCOA 2WJZB 4MUIA 3CONA 3F6PA 4HGZA 2QRNA 4J2HA 3ICVA 1I3NA 2R5WA 5ALPA 2OMEA 1PYGA 3JTMA 4G1UC 3WGKA 4BPRA 5KYXB 1B42A 1CVLA 1DC3A 5A5DA 2XT9A 4BZWA 3E82A 4B3HA 1GGEA 4EHDA 3LVQE 1EHIA 1CEQA 2HA3A 2F9MA 4FQ7A 3DZCA 4QKQA 4CEHB 2R96A 2LPMA 4F04A 3SR0A 2R1TA 4X71A 2O2YA 3TRFA 1IY0A 1VBNA 3KSAC 1JDSA 4C2UA 1H23A 4J7CA 4L2IA 4U6NA 4P54A 4LOLA 4ZVUA 3FN4A 3OPMA 5I8WA 4E21A 3CLTD 4IO1A 4ZAFA 1I5OA 1QWSA 1Z15A 1R0WA 3TI7A 4RSGA 4EHAA 3TW0A 2DB3A 5DGIA 1IRXA 1C3OB 4MZDA 2VXBA 5FWNA 3OICA 3HU5A 5FWAA 4HADA 1E9VA 4OJTA 3R7DA 2G77B 2CGEA 1MO6A 1YB1A 5EE3A 2MCFA 4C07A 1MC8A 1TOAA 2CXQA 4MQLA 1Z0JA 4A36A 1UZLA 3CPSA 1TNDA 2JASA 5KQLA 1RJDA 2OO7A 2W37A 4GKKB 3B7WA 3CPEA 2UYOA 4ES6A 1JJIA 3OWOA 1WCV1 3RYHA 3V1TC 5H7XA 3RKUA 1NVVR 3Q3VA 1UBCA 5GY7A 3HO1A 3MJEA 2XJ4A 4KPUA 1XEAA 3LIIA 4PG4A 1H1TA 1EEXB 3IELA 1R12A 1TE2A 3BXPA 3K8QA 1T8PA 4R1LA 2AR0A 3RYIB 1J5XA 3AVQA 3BH0A 4HC4A 4BKMA 3FNEA 2BONA 3RC7A 3ICEA 2ZLBA 1MC4A 2V7EA 5B37A 4ALIA 3WDMA 3GVXA 4HT3B 1KH1A 1NUSA 1DQZA 2VP6A 2QM8A 4D8VA 1N2HA 3M6UA 2N1BA 3KR9A 4EECA 2GKOA 1FEZA 2W00A 2ZWOA 3AG5A 3EQ9A 4H7PA 4B3TB 2WMYA 4UBLA 1Z68A 5B2EA 1R0ZA 4PSAA 2Z30A 2B30A 2C2KA 2GPYA 2ZJ4A 3GFTA 2PGDA 3MWFA 3PXUA 1YJQA 4MIYA 1HQKA 3MA0A 4JJFA 2PFKA 4DWOA 3PQCA 2G0TA 1EUYA 1AK2A 2B4YA 3M4JA 1G19A 3F5MA 2PX3A 2C2ZA 3G23A 5KZMB 4UOZA 3A9VA 4JMPA 5LJIA 1ZIOA 1NUPA 2OPBA 1ZK1A 3CR3C 1ZD3A 3EF3A 1VCNA 3GY0A 1XA3A 4I8IA 2D7CA 5E6UB 3HSYA 3OZAA 1I2MA 3R3SA 2MSCB 1CVRA 2RC5A 1FRQA 1WSAA 5EMKA 3PV0A 2YKGA 2FY8A 1RQLA 2BZ1A 3E1KA 1BFUA 5IXYA 4NECA 3MJRA 5ALMA 1OJ7A 1QMPA 1UXKA 3DBIA 1LXCA 2W2KA 5GOTA 4AYXA 3TNJA 2R8ZA 4ETWA 3TLYA 1JALA 1R8YA 4QYXA 3WHPA 3BERA 4EUFA 2BFOA 5FUWA 3P27A 5KBYA 2P1ZA 4FGJA 1JEAA 1F4VA 3RVBA 1L1FA 4PCVA 4JYZA 1URPA 3OC6A 4FNGA 1EB8A 3HY4A 4G9GA 4RZUA 4WOBA 4X91A 3KKKA 5C1IA 3RRXA 4A6XA 3OTOB 4JLWA 2JHCA 4HVAA 1IZ0A 1L4NA 1WUJS 5HDBB 3ZU5A 5FAKA 5F9HA 1ADYA 1M3SA 3AERA 3HY6A 1FMFA 3BMQA 1EP3B 5LYJA 5JXHA 3W4JA 2RONA 3R3UA 4B31A 4YMLA 1Q0HA 2ECQA 1ZOOA 4C76A 2JGDB 2CMFA 4TM7A 2NU8A 1T0HB 2H9IA 3TR5A 3QE9Y 1Y1RA 3FMIA 1FNNA 4N5DA 4HVLA 3AUJB 5C7LO 4MAAA 4F72A 3EEOA 1D6SA 4PNPA 1KSHA 2X9NA 3TE6A 3IV9A 4IG4A 4YAWA 2JLUA 3BGWA 5CBPB 3AF6A 4IGFA 4RE6A 1MRNA 4YALA 1JYSA 2OB2A 1R64A 1OKKD 1XD9A 1Y37A 4BNWA 5A5FA 3RSOA 1LLUA 4JQOA 5DTQA 1FVOA 2Q3MA 4EKDA 4EY4A 1ESDA 4BP3A 3H5AA 5K0CA 2BHTA 4GXTA 4FILA 3VBCA 5K05A 4NOLA 2HK6A 3JZDA 3THXB 2WHXA 1NWCA 5FI3A 1TVKA 1BMQA 3CUTA 1T29A 4DR3B 3K92A 4IWXA 3N0WA 3QVXA 3EC2A 5F5XA 5FUMA 3NWBA 1I0LA 2JFPA 3BQMB 1GG2A 1R0LA 2G4LA 1QGZA 1C4XA 3DCJA 3LXMA 2C4NA 1OXMA 5F3DA 1LV8A 2WMDA 2GS9A 3ECAA 1BMFD 1V1MA 1YB2A 3OLCX 1Q11A 4QELA 4JJ7A 5HOEA 4B4KA 1A5SB 2C4WA 3MMSA 4Q3CA 4HFJA 4V0SA 3KQLA 1QU3A 4CRWB 4QJ5A 5IZCC 2CSXA 2GK4A 3P9SA 4B46A 3S3TA 1WUYA 2G83A 1G20A 4TL8A 1JYEA 3PRJA 5JAOA 2FEMA 1JE1A 1HMYA 4R6XA 1AGNA 4G63A 4R5HA 5AUNB 2A88A 2HSEA 4PAMA 1RXIA 5JHHB 1MX1A 3KWFA 4II7A 1Z6TA 2LBPA 3OLXA 5BMVA 2Z83A 4P53A 4RPKA 2YV2A 3DE3X 1N33B 3DMDA 1YVRA 3K9GA 4JJZA 4JSTA 4AXBA 1U1EA 2ZRHA 2GEBA 1OFGA 2FXIA 3SLKA 1QGAA 3C5EA 2BGKA 2YXLA 4PHCA 1OWOA 4WKNA 3T1TA 3OHSX 3GMDA 3GRUA 5IWCA 1LWNA 1H65A 1D1TA 1L3BA 2N3ZA 4ASUD 4CMEA 6ABPA 4PR3A 1F8GA 3F4LA 3SX2A 4NABA 1A8IA 3D59A 1E0SA 3G5MA 3PQDA 1R0XA 2VDMB 3MWDB 5ESWA 4BN5A 3IAS6 1CZKA 1ZD1A 3K0EA 4LZOA 1TYAE 4KWTA 4D80A 2IUSA 1YNOA 4JV5B 1AUVA 3ORHA 3VAAA 3GWGA 3WGGA 2CUNA 2O2HA 3PIDA 3GUCA 4HAZA 4L4XA 2GPTA 1DC5A 4C06A 4QDJA 3OCCA 3D4IA 1G6KA 3TEFA 1W88A 4F46A 2QTNA 3FKSD 1GZHB 2ERCA 1GPLA 1SULA 3BH6A 4ZK6A 5BORA 5TEVA 4I6GA 3E48A 1V2HE 1YR6A 1FUUA 2I1LA 3EQ7A 4O5AA 2GEJA 3U7FB 1TU3A 2OV6A 3PE3A 3F5DA 3PEFA 4FXPA 3VAZA 1U4NA 4BJ6A 2FN9A 3TTXA 4BWGA 3CNBA 2HQSA 4LFCB 5I4KA 3H13A 3CUWA 3LC2O 4P4SB 3FLMA 3QVTA 3UB4A 3JQ9A 3I45A 5I7HA 1O57A 5E9QA 4L4ZA 2A0KA 2AH5A 2HRDA 1QIEA 3NIFB 3ONEA 1IBCA 4HBZA 4BZZA 4JR1A 5IT9A 1CY1A 3CS3A 4WGFA 2PA0A 3CX4A 3EBOA 3RG2A 4HPXB 1WPXA 3PJFA 2VS1A 2JFHA 1FTSA 1W48A 2PIDA 3R4CA 3GLFA 3JAKA 4OY3A 1HR0B 1L7MA 1BYIA 3DDHA 4P4UA 1R0SA 1VGRA 1KR5A 4FDVA 3MQFA 4NRDA 4LDPA 2AMFA 2CHUA 4IQ4A 3VC1A 1FDVA 1F2TB 1MPTA 2BI4A 4M21A 2EJTA 3ELUA 3IAM1 3RABA 3VH3A 1R1DA 2ODPA 1KZHA 1GEGA 3UWPA 4F8EA 1POXA 4MI1A 4UQPA 3D8SA 4CE6A 1IN4A 4IUYA 1WLYA 1E9CA 1V8ZA 3HO8A 2QTVB 2XNHA 2AF3C 2HLHA 1Q0RA 3PQEA 5ITVA 2XKKA 1TAUA 1F14A 3L1UA 2GJ9A 5AW0A 2PSEA 3EYAA 4GSKA 4PC6A 3TQFA 4CIAA 5A2GA 1M5UA 1FS6A 4I1OA 2Y8EA 3GX1A 3FYDA 1H2WA 2VJLA 3WIEA 4DLXA 4MV6A 3W8EA 2HBYA 1A9ZA 4M9QA 1Z25A 1JXMA 2EFCB 3QXGA 4EY3A 5T4HA 3GCWA 4I50F 3ER6A 5DLPA 1IOVA 2K2WA 2R6CA 4KFUA 1Y42X 3RIEA 3ZC3A 3HCWA 4W5TA 2CK3A 4TKVA 3DJYA 4RZQA 4NXMB 3O8BA 4RULA 1XMIA 4LYYA 4KNWA 5M7EA 3TLXA 2AUMA 1ZWKA 3PNPA 5ILQA 2YWJA 1QG2A 1S2DA 4JIMA 3SYTA 4C7KA 1AY0A 3R0VA 4W1PA 2JFZA 2WM2A 4YRMA 1D6JA 2BEKA 3OZDA 3P20A 4RPCA 4IFTA 2ZWPA 3I6BA 3HVRA 3CYFA 3I92A 3MD9A 3GFBA 4O29A 2QX6A 2QD5A 4IW3B 3U9SA 1JU9A 2CBXA 1V0JA 1VE3A 1O95A 4JHLA 3FMOB 3NBMA 3B9BA 2DWOA 2ZTSA 1MQ9A 3E9YA 3DW3X 3F96A 5SYAA 2J6HA 3N2GA 3IIJA 4NMLA 1B2RA 4HGRA 4OB8A 2XUDA 4JL6A 4GBGA 4DSUA 4Z8XA 4A4DA 1IPHA 5IAGA 1UP4A 3DMRA 3VI3B 5KVSA 4S04A 2A84A 2DCMA 4XWOA 2WZBA 3BG5A 5E4JA 2QM7A 2JI6A 1KZYC 2XOKA 4ZQIA 1I33A 3B5EA 1OVMA 5D87A 3SJAA 2BELA 4WXEA 1PL0A 1DG9A 2DWUA 1JA0A 4LY3A 4J0DA 3R3JA 4A26A 4X3PA 2OZVA 1G8SA 1FFYA 3WSTA 521PA 3ZUPA 2HPZA 4C87A 3QKWA 3VR5A 4ZKEA 2CZCA 2DLDA 1QYCA 1XTIA 5KU7A 1B26A 2I22A 2OT3B 1MV8A 1VA4A 2E18A 2P30A 3HU2A 4DLTA 3QX3A 4YNBA 3H8SA 3W6UA 3JQAD 3B6MA 3L7OA 3NX4A 1SC9A 2P1DA 2JJQA 1NR5A 4AO6A 1Z4OA 3K0KA 3PPYA 1LF0A 4NC9A 4MPDA 5F5LA 5MF6A 1T4CB 4I81A 2O1WA 4QM6A 1H8HD 2UZIR 3EJ6A 1J33A 5DM1A 2CXHA 3JXEA 4FGKA 4RKYA 4DWVA 3AZOA 3R75A 4ZIRB 3C98A 5JNVA 4YUAA 5E3HA 1YBAA 3R24A 4OUDB 1H2HA 1KZ4A 3PDCA 3OJCA 2NV0A 3CNNA 4M60A 2I9KA 2R8OA 3PDIB 3TIFA 1TYDE 2FKAA 3U7EB 1U7ZA 2OYSA 1M6VA 1SKAA 1UBOS 2BDUA 4HUQB 3SPXA 3W2TA 1P1BA 1IN8A 3L7CA 3PITA 2FN7A 4Y2YA 2UZ4A 4LJ4A 1JS1X 5H59A 1MJFA 3QFHA 1CF4A 2OAP1 2NTYC 3JARA 3PLNA 1EMDA 1ZJYA 2QA5A 3EXFB 3NWJA 1SIBE 2PUTA 4N8SA 1TUEA 2O5RA 4GEGA 4UU7A 1USIA 5FO1A 2JI4A 5TXGA 4B7CA 3CLRC 2VYNA 1JQAA 3ANMA 2PSSA 9LDBA 1G5PA 2HMUA 4DLUA 1Z8HA 1KJQA 1KYIA 3AUUA 3L79A 1LW7A 1Y4SA 3K6KA 1I4DD 4Z9BA 3ZYZA 4BO4A 1VFNA 5K0FA 4HDAA 3RE1A 3WIOA 3F3KA 2YY7A 3UWMA 4JH0A 2ZYTX 1E2HA 5J2TB 3B12A 1AZLA 1BDBA 2QL9A 3BMXA 2ILTA 3GFFA 2DRIA 4N9QA 5L9AA 1PK9A 2C9YA 2GHRA 3AVUA 3B3AA 2IX3A 5CRIA 1QDLB 5GADl 1AK9A 2N9UA 4Z7JA 4KE6A 3ZKWB 1L1EA 4C7VA 4B3GA 1WHSA 2IU3A 2QVBA 1L6RA 2ZI9A 4LNHA 4GMXA 3SMVA 1BD4A 1U0GA 4KR9A 4F8YA 2I87A 2PWAA 1R88A 4LBVA 4UAVA 1UK9A 3I53A 2CV0A 5KC8A 1LBHA 3X0DA 2MSNA 1U3UA 3G88A 2WQ6A 5AFSA 3KB8A 3A4NA 2OGWA 1J9GA 1T3HA 1U2ZA 4XOIA 3T35A 4JP1A 4Q9JA 1XWWA 4XD2A 2ZI5A 4J49A 4OIFA 3BWXA 3V9PA 2K87A 3G6KA 1MAVA 4WKOA 1YB6A 4CMHA 3IEVA 1JP7A 4Q4DA 2EZ8A 5FOTA 3LUCA 2HNBA 4FGLA 4C43A 5ER9A 1SVWA 5ARCA 4RWEA 2HSWA 2PNJA 1D6NA 4Q9NA 1GKYA 2ZIUB 2XDQA 2VDJA 2IZZA 2C1XA 4N3NA 1X7XA 5CVVA 2FFJA 4ALJA 2B61A 5LQAA 2A9JA 3QVMA 2MMCA 1YS2X 3HVKA 1M1NA 2YBDA 1A2BA 1ZGBA 3TCNA 4DIUA 1YXMA 3AJEA 4K1XA 3W90A 3E5RA 3O3MB 3QVKA 2EHDA 5DHPA 3ST7A 1FMCA 3BCUA 1UC8A 1HTTA 4YRSA 4AJOA 4UU8A 1W9MA 3SJCA 2GB4A 1AT1A 2WFMA 3OOYA 4WHMA 4LA4A 1G55A 1YKGA 4UMDA 5BQOA 4OAOA 4UTRA 4N76A 1MIHA 4PZLA 2ZZMA 1XWFA 2DE0X 3TB4A 5BNTA 4DB2A 1DADA 4YS6A 4Q05A 3H1AA 2BI8A 3NHKA 3QXCA 4D57A 4UNPA 3X1DA 3UTDA 3VOSA 5D6NA 5BSHA 2ZIXB 2HRRA 2XD9A 1HE8B 5D3KA 4HNUA 5IKXA 4HS4A 1LQ2A 4N7MA 4AIRA 3SIRA 3HUUA 4KTVE 1XA0A 4WXMA 5DNVA 1QP4A 2ERXA 3GJQA 3U4GA 5BP7A 4PCAA 4BMYA 2GSDA 1P0FA 3M1IA 5DBOA 3L1KA 5T3UA 4TTPA 2RGBA 4U7DA 2FPXA 5LIRA 3A9WA 1MO3A 1VCHA 4WASA 2YV1A 4G5QA 2UVQA 4PZ0A 3P2JA 2AIRA 3L4BA 3QYFA 3SHFA 5FNVB 1OIWA 4PFQA 5JNLA 2GPNA 1U1FA 4RDHA 4RD6A 5DJ5A 3V3KA 2BKVA 4JL5A 1Z6PA 3ZVNA 1NLYA 2VHVA 3QXHA 1M0EA 3MOIA 4OX9Y 3SSNA 1YGPA 3MOSA 3EHDA 4X9XA 4BVJA 1F38A 3UATA 4HQOA 4YAEA 1XDGA 4M54A 3Q2KA 4ND6A 2J07A 1CCWA 2QMEA 4MR8A 4PAGA 4QPCA 3ROGA 1ZY2A 5AJYA 5D51S 3NWEA 3UB3A 4FWBA 1PP4A 1N5JA 1XZKA 1GU7A 4CIXA 2PR2A 2D8AA 2E4AA 4KQ9A 4JT4A 3T3IA 4D4MA 4HNVA 1AKTA 1X39A 2PT6A 3G89A 1PKXA 4ZOBA 2G28A 4Q6BA 1MEJA 1EUCB 3BF7A 1W4RA 1F7VA 2XDYA 3ROKA 4BEBA 1XAIA 2FLWA 3GFRA 4R71A 4P0PB 3L0OA 4OMFG 3GGPA 4WZAE 4Z1MD 5T6MA 1NBWB 1OFVA 3D31A 4KH1A 1DKLA 4MDEA 4N6NA 3Q85A 4FC6A 4V39A 1KYTA 4H7KA 2XEXA 3A26A 2GM4A 3IBTA 2OQRA 1EAYA 1HLPA 1LVHA 3BOSA 4Q9DA 5EMHA 1UAGA 3ZY2A 3OOSA 1RQ7A 3HQ4O 4RANA 2AEMA 1NE2A 5HOQA 2PYDA 4YJDA 3RT7A 5LBTA 1X7ZA 4KACA 3EVGA 1I9CA 3GW8A 2PMWB 4NYMQ 4QUEA 2WU1A 3X1WA 4E2ZA 4MP8A 4C22A 4C6SA 2CYCA 1SO8A 3MSCA 2O4CA 4H3KB 2PZMA 3NBZC 3WYBA 2BZGA 4P4NA 3KXIA 5EKXA 1G7CA 3MRXA 1T3ZA 4X3OA 2P4QA 3GLVA 1OBOA 2VQDA 5A0FA 3TINA 5A5GA 1Y8QA 5JRZA 3E7WA 2GCPA 2V74B 3MWLA 3QU9A 2JARA 3VR6H 3SXUA 1MH9A 1C14A 2H6EA 2JFVA 1YA6A 1V45E 2FWAA 3PUKA 3KYJB 3UXYA 5AP9A 4O5OA 1GLGA 2ZR8A 3LWBA 2BPOA 3OT1B 3S2UA 1FMJA 3UHPA 1QDEA 2XQFA 1I2BA 1RZUA 1ULAA 3BWBA 4KJXA 3DZHA 4PTZA 5F73A 3ROMA 2EZTA 3BD6A 4PIVA 1Y7IA 2NYVA 7AT1A 5HIIA 2ZSBA 3BAZA 5JRDS 1N0IA 4LF5B 2X8AA 5ERXA 5AW5A 3QMMA 3RVKA 2VF5X 3PKIA 3QLJA 1NRIA 4OF4A 4NJOA 4D81A 5KDOA 1MB4A 3LHSA 2FJPA 3CIFA 4F4JA 2RKOA 2HJWA 1XTPA 1WXXA 3RU2A 2ZFUA 4K6FA 2O23A 4JBLA 4A0GA 1C0IA 3ORFA 4FHDA 3IUYA 4PX3A 4YP0A 2FSVC 2XE6A 4DJJA 1M33A 5JEEA 3T4PA 1BD3A 621PA 4UM5A 1PV4A 3OX1A 1SPBS 2B82A 3DBRA 3CMMA 1EFTA 4FIZA 3JD4A 4P3NA 3TKAA 3UKOA 3NT4A 4RFSB 3R0ZA 4HZGA 5BNZA 1JSXA 1NZFA 3K1YA 1D1SA 3C3XA 3IMFA 2H85A 3AEQA 1R6UA 5EZSA 2DHDA 2GXUA 3NHUA 3N2ZB 3OX2A 1C1DA 1PIWA 1GA4A 4DLPA 2PUWA 4LHXA 1UJ4A 2Q1TA 1SKMA 2AEEA 2Q2OA 1KVQA 1TKBA 1U7OA 4JNCA 1P9OA 5HCUA 1J8QA 1WO8A 1ID1A 3DT9A 3PK0A 4EZIA 4J9VA 4KSCA 3WWCA 1ADFA 3L7AA 1F20A 4MP3A 2QTHA 2Z04A 1AS0A 1W0JA 3H2SA 3UT5A 4W4TA 5GJBA 1BROA 3O93A 3PENA 4HMOA 4U0JA 2VRBA 1GCAA 2XPCA 3LECA 1M73E 3L0PA 2QNBA 3DLBA 3H5NA 2AZTA 5HGJA 4GDFA 1BSVA 1BS2A 2R8BA 1EGHA 3QWAA 2Q9CA 4GI1A 2PV7A 5E4TA 2CLOB 4PSKA 1IJKA 1I3KA 4BJHB 2RAUA 3P2MA 5E2IA 3GZNA 2YY5A 3RROA 1R4MA 3D0RA 1JILA 3DBHB 3KUDA 1Z6ZA 4WBNA 1Z3IX 1GNLA 1O8CA 4MKZA 5CIWA 3TCKA 2IPAB 4L4SA 3ILYA 4O4HF 2NAFA 3ICPA 4CPDA 1LFDB 3CW8X 3WRYC 1P4RA 3K9BA 4X1KB 2IKSA 1MZPA 4E1BA 5J59A 3DTVA 4HWTA 1XZFA 1RPZA 1VGQA 2WI8A 3ESDA 3KB2A 5DKFA 4JEIA 4MA5A 4Z0HO 4DGSA 1Z6AA 2C9BA 2Q5OA 4CQLA 3GUYA 4G0XA 1NXOA 1U99A 2BFPA 3CZ4A 3KKPA 2P6PA 1FQWA 3H11B 1FYWA 2PEYA 3JX9A 4JBGA 4JGGA 2F59A 3STWA 3U3XA 3VZPA 3OHPA 3F6CA 3KV3O 1C8KA 3DULA 4G0YA 5FOXA 5H16A 3TPCA 5JNRA 3RW9A 4PYIA 2JHAA 3N76A 3MT9A 3T3MB 4QOFA 5ALRA 1KZ1A 4Q7EA 5CK5A 4DT1B 5FUYA 2X0JA 1ISHA 4A2WA 2V4MA 2XB9A 2JIZD 3QTTA 5IK2A 5KYTA 2VK4A 3MG9A 2Z5GA 4RLSA 4KIFA 3A6KA 3RF6A 3UK7A 4ZVNA 1ESCA 2PZLA 3W3ZB 2X2PA 4N3CA 1KDZA 2J3MA 3ILXA 3JRWA 3N0XA 4YA6A 3ENKA 3Q12A 1QTRA 1DTSA 4YX9A 3MCTA 5TT0A 3VFDA 1QC5B 1ILWA 1MAUA 1XE3A 5REQB 3RBVA 4FX2A 1DV1A 1PG2A 3EA0A 2IGTA 1ULZA 4XYBA 2AXNA 4OA5A 2AVNA 3A4TA 3TTTA 3C1UA 2QTAA 1YL5A 3EZNA 2JLZA 5LD2C 4RTOA 1FLAA 4HEQA 3W5BA 5KYWB 1GRCA 4EQZA 1UBFA 3EXG2 4KO1S 4EKIA 1MLDA 2V98A 3THWA 2R62A 5G02A 3NBKA 1XTQA 3QEOA 1TO2E 1Y98A 2PS0A 3OIUA 5JWHA 2YCLA 1X3LA 3KS9A 3BXFA 1G17A 3G79A 1GUFA 5CLLA 4DJDC 4YV2A 2H1HA 1TCBA 4X95A 5K0BA 4LBZA 3T3NA 2H1SA 1WQ4A 2GT1A 4M1YA 1XCOA 4MQ6A 4O4JF 1ENPA 3OUZA 4OHVA 1M6EX 2AKAB 4DARA 4EP1A 2FWBA 2J7PD 2IBTA 3G7SA 1DDGA 4MRPA 3SEAA 1EVJA 3I37X 3EWNA 2ID9A 1FDUA 5DEIA 3A4YA 1HOXA 2LZ0A 4B7ZA 3WGOA 2YZ7A 5J1TB 1KERA 4P5EA 2Z9CA 1EX1A 3GJ0A 1TT7A 4LGYA 1GZ4A 1I36A 2CJYA 2Q3FA 1FP2A 2Y1DA 3K0CC 4JBIA 3BL6A 2BP7B 3C5HA 4M7OA 4RAOA 1PEYA 2PT5A 3K16A 1N9KA 2OENG 2NACA 1Y6QA 1FFAA 3CKMA 3GH3A 3LSTA 3OMWA 4EUNA 3GRAA 3H19A 5F52A 4LPKA 4WJZA 1X9GA 2IYLD 4ISBA 5E4FA 2F1IA 3HBNA 3WL4A 1DJNA 4BGUA 3GPLA 1K4YA 2QZ4A 2RIPA 2WSMA 4XR4A 3LY5A 4MHSA 3SR4A 3DDUA 1Q92A 2WM8A 2CD9A 2OLEA 5KDLA 5K3SA 2P7HA 3DLAA 2ORIA 1IHYA 2CMHA 1G8MA 2FG5A 1HRDA 1Y5NA 2EBUA 1KHTA 2I3ZA 4N7RA 3Q5GA 4KVGA 4P33A 1G21A 4C7BA 2IELA 3PJGA 1QXSA 2H16A 1H6AA 1JEQB 4RZSA 1HG0A 4KGVA 1USKA 3E7XA 4B0PA 3MOGA 5IJ0B 1KFCB 4P4LA 5K0NA 1ENYA 1QIFA 5SZKB 1Z2DA 4HSGA 4PRYA 4B7XA 1DRWA 1YD7A 4NAHA 1L5NA 3GHHA 2WB2A 3PEEA 3ITKA 1CEEA 4OLJA 4OYYA 2Z4RA 5CFZA 1N6HA 1QQ6A 3FSEA 5C8ZA 1U9CA 3B3JA 3M6AA 5ITSA 4PF1A 4LK3A 1DT3A 1P6UA 1F9EA 1PFQA 1M74A 3C1TA 4LDRA 2Z2YA 4MQBA 2WJPA 3A1FA 4RK6A 1IY9A 3ZZMA 4UUBA 4LOJA 4ZOLF 3WKCA 2FG6C 4GYYA 3PX7A 1LLCA 2UVPA 3PICA 1ODCA 4TTTS 3SJBA 1NF9A 2QPOA 2XADA 4GVLA 4MR9B 4BJ1A 2ZI3A 3N8NA 1SD5A 3GJ4A 4RPGA 3WDKA 1E9A