1AQNA

Subtilisin mutant 8324
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYCGSNVKVAVIDSGIDSSHPDLKVAGGASFVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPCASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPAKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSICSTLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords SUBTILISIN 8324
publication title Large increases in general stabilityfor subtilisin BPN' through incremental changes in the free energy of unfolding
rcsb
source organism Bacillus amyloliquefaciens
total genus 102
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1aqnA00
1HT3A 3WIUA 3VSBA 3EE6A 2P4EA 1GTL1 1ST2A 1AV7A 4BWGA 3GT3A 1WVMA 3OSZA 1BFUA 4OMCA 2WUVA 4YN3A 1SVNA 2ZRQA 4MZDA 5B1EA 4JP8A 4Z2AA 4DWWA 1SUPA 2X8JA 3ZXXA 1TECE 3F49S 1TO1E 3WIVA 4K8RB 5ARDA 2Z57A 1KE1A 3DWEX 2WWTA 3A3PA 3DE2X 1GTJ1 3D9QX 3UNXA 3CNQS 2SNIE 1BJRE 1T1EA 1AVTA 4AKTA 1PJ8A 3QTLA 4HX2A 1AQNA 1S2NA 4ZARA 1C3LA 1GNSA 4NE9A 3Q5GA 1Y48E 1BE8A 4NE7A 3A3OA 5JMOA 2WUWE 3GCWA 3DW1X 4LVNA 5JXJA 1SUEA 2SECE 2IY9A 2W2PA 2PRKA 1GA6A 3AFGA 1BH6A 3Q40A 1EA7A 1SELA 1WMEA 3PRKE 1CNMA 4CFZA 5AQEA 5B1DA 2ID4A 1SH7A 1AK9A 1NDQA 1Y34E 1TM3E 4CG0A 1TM1E 5CW1A 1V6CA 1SPBS 3QFHA 2Z2YA 4KB5A 1Y3CE 3CO0S 1TM5E 1VSBA 1SCAA 3LPAA 2DUJA 3I34X 1GCIA 1IAVA 4H6WA 2DP4E 3SICE 1P7WA 1GA4A 1JEAA 5ARCA 1OYVA 3HJRA 1SBCA 2WV7A 1IC6A 4KPGA 1A2QA 3DVSX 3WHIA 4OMDA 4RYDA 2X8JB 2Z56A 1KE2A 3TI9A 5ARBA 3L1KA 1THMA 1GT91 4CFYA 2ZWPA 2SBTA 1OYOA 1ZVKA 3EDYA 2QTWB 5FFNA 1C9MA 3H42B 4J94A 1S02A 1YJBA 2W2OA 3DE4X 1XF1A 2PKCA 1WMFA 4LVOA 3DE0X 2ID8A 3SQOA 1LW6E 1KDYA 5SICE 1GA1A 5JXIA 2PWBA 3GT4A 2DQKA 3I30X 3GCXA 1P7VA 1TO2E 2B6NA 1OT5A 2XRMA 1TK2A 4ZOQI 1Y4DE 4WOBA 3D43A 1AF4A 1T1IA 4M1ZA 4GI3A 1SUCA 2GKOA 3BPSA 1TMGE 2W2QA 3EIFA 2W2MA 1DBIA 1SN7A 1SUBA 3DE5X 4B5LA 1Y3BE 3DVQX 2XTJA 4C3VA 1CSEE 2HD4A 1SBTA 3TI7A 1R6VA 1BE6A 4KG7A 1SBHA 3DW3X 1S01A 1Q5PA 1Y3DE 3WQBA 1ZVJA 5I9SA 1Y9ZA 1SCJA 5JXHA 3DYBA 1SBIA 5K7SA 5AMXA 1AH2A 5AVKA 1Y4AE 1R0RE 2Z2ZA 2Z58A 3A3NA 1T1GA 1P8JA 1SBNE 3AJ9A 4OV6B 4H6XA 4C3UA 3I37X 3P5BA 1C9NA 1GTG1 2ZWOA 2IXTA 4H6VA 1YU6A 5JXGA 2E1PA 1DUIA 2PQ2A 3BX1A 1KDZA 1R64A 1EGQA 3DE7X 1KDVA 3VHQA 1SCNE 2PWAA 3ZXYA 1YJAA 4FONA 5AVJA 3DE6X 5FBZA 4I0WB 2PYZA 2W2NA 1GNVA 3LPDA 1WSDA 1TM4E 1SIOA 1AU9A 1PFGA 3BGOS 1BFKA 3PTLA 5FAXA 2V8BA 1PEKE 1MEEA 1YJCA 3LXUX 2PMWB 4DZTA 4DJ5X 4AKSA 1TM7E 1WMDA 3LPCA 1SUAA 1UBNA 3T41A 3VTAA 2Z2XA 3TECE 1Y3FE 4NMXB 1Y33E 3DDZX 3VYVA 1SCBA 2ST1A 3F7OA 1NDUA 1NLUA 3F7MA 2SICE 1MPTA 1SIUA 3I2YX 3VV3A 1SCDA 3VV2A 1SIBE 3AJ8A 2HPZA 2G4VA 4WOCA 2Z30A 1ST3A 1Y1KE 1C9JA 1SUDA 3QMPA 1V5IA 3DE3X 4HVLA 2TECE 3DVRX 3DE1X 1PTKA
chains in the Genus database with same CATH superfamily
4AMBA 4JFRA 2E55A 1NPYA 3CR8A 4LZOA 3LBIA 1ODFA 4OKNA 3RAEC 1H2ZA 4MQFA 5EE0A 3TQOA 3GO4A 1TYAE 2I6FA 1N2JA 4LWOA 2R68A 2IHZA 5DI9A 5E8RA 5FHRA 1VPWA 3WGGA 2P4EA 5E9JA 4F46A 1B2LA 1X7YA 3JVVA 5CFLA 4B44A 4KV9A 3WSVA 1PDOA 4Y2PA 3N2LA 2BM9A 2GN4A 5A0VA 3PDHA 1GNQA 3COWA 2HPAA 1UAGA 1O08A 2P68A 4EGJA 1N33B 1Z56C 4L78A 4BAGA 4UBOA 5C5EA 4QYSA 2WFLB 3S2ZA 2H16A 5IDXA 4LJ6A 1FVFA 1HNNA 2AUMA 2PV0A 4TL9A 3QPCA 3HNOA 1I6MA 1YTLA 3CUEF 1RJGA 1FUYB 1Z07A 1ZD2P 5FPQA 3UAYA 1U80A 4R98A 1XTTA 3EVFA 4R0VA 3PYMA 3QXSA 3PLAE 4N47A 2FRDA 5DN6A 2QN6A 4KRYA 2GUGA 3B9BA 4REMA 4YI3A 3D6HA 4HTFA 4DCVA 1Z37A 2W7TA 5BN1A 4GM4A 5REQB 3ILHA 3C3KA 4QXOA 2DTXA 1XAIA 2XB6A 1V2GA 1VHJA 4JR1A 3E23A 4JVMA 3BXXA 4Q0MA 4K5QA 4O8CA 1HEUA 5JANA 1YQ9A 4YMTA 3HU3A 2J9FB 2OXCA 4XR4A 4EYOA 1CD5A 4BJ3A 2ZROA 2EZ4A 1NUHA 4YNBA 5IYZA 2ZYSA 4BMCA 4FFRA 5HRCA 2FA9A 1O1YA 1PUXA 3T3IA 3WYDA 3QX9A 1WKBA 1QHHA 1Y4ZA 4RD2A 2VTBA 4TLCA 5BN3A 4DQDA 3DTYA 5IDQA 3AF5A 5JO9A 3LZCA 4S1NA 3KZNA 2AUNA 2K7ZA 3IIIA 5DGDA 4BRUA 1M1YE 4FFBA 3H4MA 1V6AA 1EP2B 2F8SA 2QTLA 1WXIA 1YR3A 4QJ5A 3TBHA 1BE8A 2W2LD 3F4KA 5EP4A 1UDAA 1ORVA 4IXMA 4EMBA 5LQAA 1U9YA 3ZWOA 1QO0A 3DTVA 3QU7A 1M6VB 4XLZA 3ZW8A 2P1ZA 1FP7A 3T7CA 5BRAA 1NYTA 2OAP1 3FHTA 1JFFB 3CB4A 4IF4A 3BB4A 4KXMA 4QBTA 4Z0HO 5KSOA 1QNLA 1JHPA 1EZZA 2QLBA 3HGQA 1N6LA 1YH3A 3BF7A 3OPVA 3PR2B 4A6DA 2YFHA 4UTVA 2LCIA 3IMCA 2UYHA 2O2DA 1A69A 4N7JA 4EDFA 2YWGA 1ZCZA 5ILGA 1Y5LA 4M54A 1II0A 5AK5A 1VE1A 1VM6A 2MYTA 2ZUFA 1E7QA 1R9NA 2ZANA 3QW2A 4H0FA 3KPJA 5BT8A 2I4NA 3CLTD 1Q21A 5IAOA 3PFGA 1E0KA 1DKMA 1HDIA 1ZI8A 3EY4A 2IOHA 3REQB 1DXOA 4HZUA 1J07A 5C8YA 3ASVA 3MLAA 5BYBA 3T4UA 4PLCA 3WIEA 3DVAA 3ZGNA 1Z8HA 2B98A 3HR8A 3BMCB 3I72A 4A0QA 1Q0TA 3KB8A 5A62A 5EQDA 4LXIA 4JUDX 1SO8A 2C4HA 1GNRA 1WMEA 4IJ5A 3W8DA 3ROMA 5FH9A 5SY6A 3WLHA 121PA 2CXUA 1K3FA 1N2CE 3SXPA 4EUFA 2ABWA 1C9DB 3OJLA 3A0RB 3FSGD 5B1DA 1OTYA 4PZDA 4R83A 1FXUA 3W3AD 2QNRA 3CZAA 4DDHA 3T9DA 1HRKA 1I13A 4UARA 5FO1A 2MCFA 4JLBA 1BNCA 1NM5C 3HNPA 4HNRA 3EXIA 4I08A 4F5YA 1CW2B 1RTKA 1TZKA 4G67A 4M1OA 4YDQA 3RKSA 1ZK0A 1K5DA 1YZLA 2RARA 2JJ1D 1JTVA 3FSRA 1WOYA 3HEAA 3HYLA 4MO9A 4OATA 2J6BA 1GKKA 1XLVA 3PPYA 1W36B 2V1XA 3CX8A 2R1TB 5HQ3A 1IK6A 1XELA 521PA 4UTNA 5K8CA 1NJ6A 4MGIR 1DEKA 2B8JA 2QLTA 3FKSD 3P0FA 4Y2GA 3V8PA 4D9NA 4E51A 4G4JA 2XYVA 1IZ8A 2DRIA 4PSKA 3EDMA 2MIIA 2P2GA 3I2IA 3L7DA 1L4BA 4BZPA 1IM5A 2JH9A 3M70A 3LFTA 2Y0BA 4DN6A 1MC8A 2OCBA 4UFNA 1MRNA 1ZRMA 4B32A 3HJTA 1OI3A 3JAKA 1P44A 4AX8A 4URWR 1TF7A 2OHOA 5BP7A 2FQQA 2AVNA 1U2GA 1U7ZA 1XZAA 3HB4X 4EPRA 3U13A 2NSJA 3I32A 3JATB 4FYVA 3EHDA 5B55A 2R6AA 4A4DA 1M10A 1C30B 3MWKA 4RVSA 2IYSA 3E7XA 3G79A 3GUCA 3OJOA 4M21A 3UT0A 1ZBQA 2VJBA 3ZLTA 4JKYA 5LQCA 2YMPA 5CA1B 4B7CA 3C8ZA 3LWZA 1H66A 4OMDA 4OP1A 4RYDA 4URHA 5ESRA 5DX8A 4DV5B 2B0CA 5FX2A 4DIFA 3P45A 3GRPA 7REQB 5LD2B 1EAYA 2W6MA 1U8UA 3W34A 2C97A 5IJ0B 4YCBA 3M9LA 4BNDB 2GM4A 3OM8A 2O5EA 1YKGA 4PYKA 3REGA 2WKQA 3M5CA 3QU4A 1OASA 1XTSA 3GP5A 2Y1FA 4V03A 3DLBA 3O75A 1U6JA 1E3WB 1UDCA 3HB1A 4ZQIA 2RGRA 4OK6A 1YJ5A 4E3WA 3Q98A 3FPLA 2GEVA 2WTAA 1Q44A 2XE7A 2XGGA 2YXEA 4KGDA 4QULA 2W5UA 4QGHA 3ZEIA 1TYEB 5EINA 1N2EA 2VPIA 3A1VA 2Q3MA 4FMCB 2Q3JA 2H11A 1YZQA 1U63A 2XKBA 4NZOA 2R85A 2FPKA 3IR6A 3SIXA 4Y2RA 1Y6JA 3OC0A 3H2YA 3V4PB 4EUHA 1M2GA 4X91A 2GK7A 3SQOA 3ZYCA 3DDWA 5A3JA 1LLUA 3ZDAA 2VKTA 5AXBA 4E2ZA 4L5AA 2J4DA 1M7GA 2Z0MA 2I4TA 2O7SA 3H2BA 3PC8A 4TGLA 3T5TA 4ZJYA 1X92A 1N2ZA 1K27A 1M1YA 3T7KA 4A03A 2HJGA 4MWZA 4RCZA 1L5GB 1UAAA 1HDGO 4HB4A 1JI0A 1F5SA 2O50A 4B3XA 3TW8A 3FFXA 1DC4A 2OZLB 5FR2A 2YL2A 3ZGLA 4K9MA 3KJZA 4ZI2A 1KYWA 2DBZA 1DOHA 3DKVA 3H86A 3CNNA 1HZZA 4M46A 3ZBPA 1C41A 2J0VA 4FSHA 4NJEA 3ZY5A 1Q7CA 3L4BC 1OA1A 4NL4H 2FZWA 3FDJA 5HE9A 2PU7A 1FE8A 2GN9A 2PK3A 1M67A 1Y4DE 3Q0IA 4ND1A 4Y0NA 5ECYA 5TPWA 5AM3A 2XHEA 3JRXA 4X95A 3MTJA 2CB0A 3PFWO 3NM4A 1CZKA 3K0EA 3RU7A 5LIRA 2I22A 1ZXXA 1VCIA 3D6MA 1B74A 3EQ8A 3HB5X 3IIMA 3IXMA 3KO8A 3EIHA 5AKGA 1KK3A 1S9DA 2HXYA 4QUBA 4B2IA 4L8YA 4RTQA 3DULA 2V7EA 1GYRA 4QVKA 1NWHA 3DTNA 5BWNA 1V11B 2IXDA 3WY9A 3ZDEA 1RI3A 2CXTA 1K66A 2CHUA 4PGFA 4LWZA 3FRHA 4YRRA 1SCUA 2DLCX 2QRVB 3HEMA 5I8ZA 3H3JA 3C41J 5TMDA 1V5EA 2PO5A 1PG2A 1IUKA 1ECJA 2GBGA 1Y89A 4QGSA 2TMGA 4A8JB 4EVQA 1GUAA 3H7IA 1X1CA 2CBGA 4PM4A 5DHUA 4BVKA 4DVJA 2JK1A 3U5TA 5D84A 3HUDA 2X0NA 2FQYA 1N2CA 5L9AA 3ORYA 1NR5A 4OHOA 1U02A 4DCSA 4YUWA 1NXXA 4BHTA 3MJRA 2DH6A 4KIGA 3HKBB 3FPFA 3PR1A 3VR6A 5FBKA 2BM0A 1JEEA 4MR8B 4MI6A 3AHGA 2BLLA 3OX2A 1M8FA 1S01A 1UKZA 4BRWA 1DS6A 5J2TA 3PRHA 2PX8A 2K5UA 2C7VA 1HQDA 4AJKA 1W4ZA 3N0RA 5DZSA 1Q3HA 5SY9A 1DQYA 1TCUA 4B5KA 1J09A 2N3ZA 3GC6A 3K0CC 4NR0A 3OFND 4JQCA 4WV3A 5JXHA 4Z5XA 4QFCA 1EWQA 5IABA 4MYDA 4UEOA 2PD4A 5ECGC 1TCAA 3KYBA 3K9WA 2HLDD 5DTEA 5B4UA 2IH2A 4MPRA 2KJQA 1Q3TA 2MOKA 2XCLA 2XWBF 5CK5A 1CQJA 1KHTA 2GRAA 4ZQFA 1LC0A 5GONB 1N5OX 5AQ1A 1CCWA 1EM6A 4RPIA 1ZCBA 2WHXA 4ETWA 2PT5A 1NXQA 1G20B 2BW0A 3E8SA 4LX8A 3OETA 5JPDA 2O1XA 3U3MA 3HKDB 1SBNE 4FUQA 5EJAA 5ULLA 3GX1A 4DUGD 3ICQB 4OX9B 2BFFA 4Z51A 1TEVA 4C3UA 3BK2A 1GWNA 6ADHA 3UWKA 2LW7A 3T0FA 2E37A 3OO0A 2GN8A 1ZKDA 3RYIB 1R6AA 5BWOA 4BN4A 4AUEA 1G8KA 1U2EA 1E2LA 4QPNA 1IXSB 2HGSA 5TJHA 4NK4A 1DZIA 2AI3A 4LVCA 4RTNA 1PWEA 1VA5A 2P3LA 3QI2A 1VP3A 4IUYA 3ZE1B 2DWQA 4B3IA 1N32B 1RXSA 1ORTA 5EJFA 5KYNA 4CBVA 2D8MA 3L8ZA 2D0IA 3ZG6A 4BDSA 4GP7A 5L3QB 1R64A 4RD1A 3W5BA 3FCAA 3QLTA 2GPBA 1IHYA 3PDIA 4X3CA 2V7QA 3CNEA 4HWSA 4ZVPA 2ISCA 3OQVA 5DGIA 1EU1A 3TVYA 2WSLA 4Z49A 1PR6A 1BS2A 4PQRA 1LPAB 2C7QA 4GHWA 1FNCA 5G1OA 5BR7A 2JVJA 2R96A 4J9UE 1XPUA 4C4PA 4DSNA 1V3QE 3S70A 4E07A 1TMKA 1U7XA 3B1JA 1KDVA 5KOJB 2I4MA 3KTFA 2H5EA 1RMQA 2ZYAA 3VKFA 4BQPA 5I47A 5NULA 1PTJC 13PKA 2Q6TA 2XUDA 4US2R 4DLYA 2R8XA 4D4GA 1PR4A 3IBFA 1UPXA 3TYXA 4U7PB 1MAVA 2I2AA 3DBOB 2H1WA 1Z62A 4ZO9A 2ZS9A 3NHJA 4HDAA 5C8YF 1EGVB 3PFHA 2Q2OA 1XCGB 2YVUA 3QEAZ 4E08A 2OV4A 1DNPA 1KKMA 4PW0A 5A7HA 3WNCA 4B46A 2A9JA 4YX9A 2REOA 1YCGA 3CLVA 4WA7A 3IELA 1IRXA 1PHRA 1EK1A 4H60A 4Q01A 5F76A 3VHXA 4Z7QB 2W42A 2D1QA 3CCFA 4O4IA 1O6FA 4TUYF 4B09A 3DBLA 3OF2A 4LZWA 1SHLA 5JHGB 4MSUA 3FZNA 1DBWA 4DXDA 2J7PD 5F4BA 2QRZA 5NLLA 1AV6A 3B36A 1XAHA 2JKVA 3OTIA 3AO0B 3PFNA 1WY7A 3K70D 3ZW9A 2VDPB 4D92A 1VE3A 4QLBA 5C4IA 2G7MC 3JQBA 1MEEA 3D4LA 2MSKA 2VWGA 3PIIA 2W6CX 2NO5A 4LYHA 3H1BA 1MUUA 2NZUG 1PZGA 5ALRA 3PENA 1HYGA 2P6NA 2HHCA 1WM1A 4RDXA 1WW2A 3ECSA 2BSAA 1UEXC 2B61A 4W5OA 1N9ZA 3KNZA 2YRFA 2DPYA 1H1LA 2AJBA 4X41A 1JXOA 4MJ7A 4DR5B 3PCRB 2XMRA 3AP1A 3EDOA 3KJGA 2BWJA 3QG1A 2Z2XA 4MWBA 2OLEA 2H59A 1NUPA 3YASA 1P75A 3OCYA 3VVCA 2EW8A 2HU7A 4DA4A 1KYTA 3RUHA 4B9AA 1NI4B 2Y0CA 3SIRA 4NBKA 1WOMA 3ZWBA 2VZLA 2WTUA 2R00C 5E6RB 4G5YA 3ENQA 3KQSA 1Z5ZA 1EINA 2OMKA 2XCOA 3HKCA 3ZHOA 3ZX5A 4AUNA 3E7DA 5J40A 5FA5A 2VTVA 3G5MA 5JJCA 3CX6A 3MT9A 1W6RA 2BGMA 1BW9A 1QHXA 1W5TA 2QVLA 3ONNA 4GRIA 1SZCA 3PR3A 4MQEB 4R69A 4RXUA 5IH7A 5KYYB 5D01A 4EI9A 4Z0NA 3I2KA 2JH3A 1GUZA 5KWJA 1E20A 4KK3A 4I6GA 2QQFA 2HYIC 3CR7A 3DV2A 1VPEA 4AG6A 3HV0A 4CDNA 5LZ2A 3EMDA 4R7ZA 4C6RA 1SIUA 2I6XA 2C2MA 1ZRSA 1P4HA 4ZCRA 3I4FA 4YS6A 3L93A 2EL9A 2FPUA 3PJEA 1WF6A 2MSLA 2ZRMA 1NV8A 3SSOA 1RQ7A 3IQHX 1IL0A 3RHTA 3ZHUA 2C94A 2OFXA 3GRKA 2PL5A 4ZHQF 2OESA 2AKAB 3L8FA 3FR8A 3MMPA 4L8FA 5CCXA 1D1PA 2D7CA 1PR3A 2GNAA 4Y1RB 4DLAA 2YC2C 5H81A 5FOSA 4DR6B 2PR7A 2DE0X 1RAAA 1AKNA 5EJ8A 2PZAA 1G38A 4C7JA 4YMSA 2W98A 1KYXA 2IXGA 3BZBA 4IR7A 4C0LA 5IXSA 4FIZA 5J2UA 4L8GA 3T9AA 2VNKA 3LQ2A 4HQNA 5ALDA 3AFHA 3KP1A 5LQNA 1XDSA 2XDWA 2NZ8A 1LVHA 1E1CB 4IDNA 2D00A 4JLOA 5GV8A 4IKOA 2PUCA 2HJWA 4R8SA 3E27A 4LF4B 2H9IA 5C37A 4XJTA 3FD8A 5BORA 1HFEL 2O0MA 4PFKA 3H5VA 5FPTA 5GJWC 2R6FA 3H1TA 3TH5A 1R50A 3H1EA 1AV7A 3K1JA 2EFEB 4A5OA 3E1SA 3I6IA 5K3OA 2FW6A 2FPRA 1KARA 3I42A 4EG7A 1Z06A 2FUG6 2NO9A 4J90A 5C46F 4JSRA 4RXTA 1QHEA 3N76A 4F60A 2QP9X 1ZAKA 1Z3IX 1SZJG 1XZEA 2BAGA 2GAOA 4DIDA 5AHOA 2Z9BA 4NFYA 3WGMA 5J2UF 3BMQB 4KUEA 4LRUA 3OH8A 1EX9A 1SD2A 1FS4A 5TRTA 3EEQA 1PNTA 4JJ7A 3ANXA 1MV5A 4DDMA 1XZGA 4CMGA 5BW8A 2MINB 4MDHA 3GLUA 5JWHA 3ZGYA 3KLPX 1DAGA 4C6TB 1MTZA 2LV8A 3A4VA 2G83A 3GEEA 1E3SA 2B35A 3SQMA 1QH0A 4C3OB 2E4XA 4EO9A 4XUDA 2QX7A 1AUVA 2FMHA 3OEHA 4NZMA 1SVKA 2HL6A 2WU0A 1XCOA 3CNQS 3EASA 1H22A 1KKLA 1J1ZA 1CY2A 2COKA 3OE7A 4CETA 4QTZA 3O8RA 2PSHA 2VHVA 5CB4A 3IC5A 1F2DA 1A98A 3PCTA 4G01B 5FP0A 1J0AA 1JHUA 1DAIA 1BJRE 3JARA 3AR6A 1FPQA 3FH0A 4IGIA 4JLDA 4Y8VA 4BO2A 5HK8A 5JZVA 2IWHA 1S8OA 4QOJA 3EMKA 5AVQA 2ZIAA 2IWRA 3WQRA 1YUNA 1OOEA 2B7CA 3QTLA 4YGXB 4EZBA 5HRAA 5LSAA 1P5ZB 1S2NA 1CWUA 4F9EA 2XWJI 5IAGA 5EWJA 3DOIA 1XTKA 2EKDA 4G8CA 3VU9B 3GJ0A 3N28A 2W6JD 3V2GA 1JB9A 4ZTZB 4IDEA 5DO9A 3LUHA 4BU0A 3TUZC 3R0VA 2QG6A 2JBAA 2QTCA 1QR2A 3LHKA 4JLAA 4MYSA 1QGDA 1X7ZA 2WYVA 3PQ3A 1XRLA 2R7KA 3UHFA 4MI1A 1Z7EA 1DRWA 5J2TF 1LY1A 3HVUA 3O03A 5AK0A 2GHQA 4X45A 4BKOA 2VQEB 1LSJA 4UW9A 3D3NA 3BE5A 2ZCUA 2NUTA 2NM0A 3DV9A 4FXPA 5LZ9A 4MV6A 2JH8A 1GLVA 4ZAYA 3R0JA 4M49A 1Z4KA 3EEFA 4PX5A 5CRIA 1E4OA 4QOSA 1P4RA 1L5HA 2C04A 3ROPA 2GJ9A 3JR3A 3STVA 3BT7A 4FHDA 3NPAA 2OECA 2XITA 2O7RA 3A05A 4OQMA 1ADGA 3B1ZA 5H3CA 1H4TA 2P35A 2CL5A 3EXFB 1IOVA 5F5LA 2ZDQA 3QWHA 1SUIA 1EA7A 1ZONA 2KLHA 2XXJA 3B12A 4J7UA 1SELA 1E64A 5DHQA 5AUPB 1H93A 1MC1A 3DMTC 4JP2A 1TZCA 3PSHA 4ND8A 4WNAB 2P1RA 5JMPA 5JDCA 1FDIA 3H7AA 2WIJA 3WLFA 1PFQA 2PL9A 5CJPA 3BWDD 1FNSA 4RA9A 5I5EA 3W6NA 2IEYA 1PQWA 2A3NA 4WY2A 4ZA2A 4HDKB 1XZMA 3R7WB 5EUMA 4AMZA 1VYVA 1ZHHA 8MHTA 5EFZA 1A04A 2BGRA 3HDHA 2FN4A 3D8UA 5DJ5A 3SYRA 1AK9A 5D3ZA 4IOKA 4AVYA 1PK8A 3I5AA 1D1QA 3QBJA 1KL7A 4W9NA 5ALYA 1U0FA 4G26A 2F3RA 2Q0QA 3TLXA 4YY3B 3ML1A 4FMDF 3WFIA 4RHTA 2UVPA 4RPKA 3F3SA 3V8NA 3WO1A 4PGGA 2IDJA 4XA8A 4ZN6A 2DJ5A 1KPGA 3WBJA 3ZV4A 5L3SB 4JQOA 3NORA 2F9LA 3M33A 3T35A 2HBYA 2WWHA 5JSUA 4GR5A 4PYOA 3PQFA 1SD1A 3T5AA 3R8XA 1PO7A 3HC7A 4RK0A 3H8WA 4MUJA 4ZVSA 4YLEA 3GEGA 1DQRA 4AJHA 4YIHA 1KQPA 1NY5A 5A03A 1JQKA 1TJPB 2FX2A 3BJIC 1F60A 2JLWA 1SXGA 2XVAA 1K6IA 4EJSB 3HWSA 2JI7A 3V1KA 5H4GA 2R7MA 1TUBA 3W8FA 4CUZA 2C2HA 1ML4A 3OOEA 1S1MA 1L1EA 2QN9A 2VA9A 4ZGGA 5L6MB 1U0NA 1OKKA 1Z7BA 4B7AA 1GEEA 4PLWA 4XX0B 2MMGA 1N5DA 1W4RA 1JHDA 5CLIA 1CTQA 1DKPA 2OHIA 4LV8B 6GPBA 2HC9A 3N2KB 3VSCA 2ZJZA 3ABZA 1JA9A 1G3RA 3JTEA 3QBEA 2OTCA 4I1PA 4KDRA 1Q11A 1OD6A 4I4NA 1UJ2A 4FX2A 2JGIA 4FINA 3DFMA 1R16A 4ZKDA 2VWPA 4LGMA 4O4IF 3MWDB 4ZI5A 3KJQA 4OXIA 5E4YA 4LDJA 2FV8A 1VLQA 4CHGA 1LZKA 4ENPA 5U1PA 2CMHA 1WB9A 2WAMA 3D8BA 3GXOA 1NQAO 3BB1A 3V1UA 1PRYA 2I3AA 3DTTA 1YVRA 2J3EA 4I9NA 6ABPA 1KO7A 3LVRE 1O4VA 4MV7A 4Z4FA 4REOA 1JVBA 1R0SA 2ZIEA 1PG0A 3ADDA 4LGYA 2JCSA 1WUHS 1Z4LA 2G72A 5ALHA 1E9RA 1GM5A 2HCJB 1BHSA 1Q7TA 5TT0A 3QPUA 4F2PA 4MLZA 4YP7A 1EWTA 5MF6A 4YCNA 3VJRA 2REXB 5FBWB 3DZGA 4BE9A 4Z3DA 3HMQA 4M1KA 3EA4A 4AZ0A 4TLAA 4L0QA 1SUFA 3CZRA 3LPMA 1R15A 2HCFA 2VG8A 3DEYX 4IXWA 4C22A 1S3GA 3TW4A 3QFFA 3LRPA 2PKCA 3FTPA 3EQ7A 4PC2A 1CUAA 3OMXA 4K03A 2LDBA 2GNOA 5JO0A 2QI9C 2Z6VA 4P31A 4K6GA 2V9CA 2JA1A 1HOXA 4KN8A 2CV0A 1FFDA 2GGSA 2YJ6A 3P96A 1EVKA 4Q3AA 1MA0A 1DEXA 3KOMA 2V7BA 2HFJA 3G49A 1R88A 2BGLA 4LDAA 1KF0A 3A4IA 1H1TA 4AUKA 1KJZA 3QOWA 1LPSA 2ZTUA 1E9CA 1FMLA 3IEMA 1PJSA 5AIAA 4HDNA 1GFWA 1REQA 3IPXA 2W00A 4Q4CA 2CKMA 5AW6A 2C8KA 2BE7A 3CG0A 1DKNA 2CL7X 2Y8EA 3T3GA 2G28A 3N8HA 1S2LA 4OUDA 2QUIA 2A84A 1II8B 1K98A 4FWBA 1JDZA 4H7JA 2DBVO 1U0JA 3ZJYA 2H29A 2Q1UA 4OA8A 1V4BA 1XRSB 3AM4A 1ZHFA 4WASA 4Q7LA 1QWSA 3I9OA 3NLLA 3K53A 4M1ZA 4H7HA 1L8XA 1XE3A 3T5DA 3TKLA 2W11A 1L8AA 4M1TA 2I9PA 3B70A 3TKAA 3PUWA 2DECA 2NACA 4WKOA 3TFQA 4LHVA 1YAJA 4ZYZA 1YQEA 1M6WA 1RWXA 3ACCA 3OM9A 4AO6A 1PYDA 5HX7A 1SVWA 4NCHA 4RTJA 1VJ0A 4KWTA 1S7GA 4JN6B 3BRSA 4RESA 5F4ZA 4AYTA 2P2NA 2YN2A 2C3MA 3C1TA 1GCUA 4YR9A 4ZVRA 1WQ3A 1X77A 1HQYE 2NZWA 3KK0A 2VC2B 3NBFA 2W6ID 4H08A 1KQNA 4ON9A 3USES 1QGYA 3MOIA 1IY8A 1YB1A 3PJGA 4QFMA 3N0VA 4XOUA 4WY8A 4AO7A 3DF9A 2OXTA 3WMRA 1IBMB 1NC3A 1N5MA 2HO5A 1K4KA 2FN8A 2IQ5A 4KVFA 1AA9A 2D8AA 3RODA 3UO8B 4RNCA 2XI4A 2G4CA 3SZGA 4RK7A 3TRKA 4ZFNA 1E6KA 4UQPA 1R6VA 3UPUA 3IR7A 4B17A 3S68A 4Z7JA 1J0CA 5J4VA 1LJ8A 1W35A 4HKTA 3EAQA 4YJHB 2J7KA 2LVBA 4EG6A 1O97D 2G82A 2PE5A 1NVXQ 1QO9A 2R8YA 1TA0A 3DH0A 4DLWA 4ZJPA 1SXJC 2KE5A 3JD0A 1AUXA 1B15A 3TZQA 3A9SA 3BSWA 1NU8A 1Z36A 3TPZA 1SU4A 1IM8A 1KOJA 3WQBA 1D2HA 4RO0A 1KIFA 3KQHA 1JLKA 1SULA 2JAQA 2P6MA 4O25A 4IJUA 5BSKA 2A6PA 1SCJA 5IBCA 1R00A 2ZWAA 1NQWA 2EFCB 1COZA 1X39A 1YBAA 2I4LA 2YS7A 3LT0A 3CZPA 3OJ0A 3Q10A 3INYA 1VBMA 4V2UA 4FT4A 2YFKA 1POXA 1QQTA 2FXVA 3A6LA 1JG2A 2D74A 2O7VA 2EX4A 2GAIA 2IHJA 1XZQA 3BK1A 5FPSA 2Z8YA 2QQGA 4AMGA 1E9SA 1JHAA 2IGBA 2XDYA 1EZ1A 1M6YA 2Z43A 1DEHA 1ATIA 1U0TA 3D6UA 2JASA 3EQ6A 3GCZA 2E4ZA 3ISTA 3LBAA 1GRRA 1WSBA 2FPGB 2WINI 2MSEB 3ONEA 4JXJA 4EFMA 4TLLB 1SPXA 1B3BA 1GHTA 4PYQA 1IN5A 1BDMA 3RJTA 1NUQA 4CLDA 3RUDA 2IS2A 2M6SA 2C57A 3EGDA 3UH1A 5EEHA 5INTA 1ZZEA 3GPBA 1DIGA 4HWPA 1Y0BA 4FW8A 2R2GA 1M2KA 2FEOA 4GLOA 4EMTA 3GK3A 4DREA 2O8DA 1N75A 4H9GA 4C0HA 3CNBA 5CB4F 2I3GA 4BNYA 2BH9A 2HQRA 5IZCA 1XK6A 5C7IO 4FUTA 6YASA 1DQNA 4P4TA 3IT1A 3P9ZA 4ZIRB 4AXXA 1WNTA 4HQKA 4Q1DA 3U1BA 1HTBA 4D9GA 5I6DA 1YZYA 3MELA 2V5VA 3IQXA 2J3QA 4FN4A 1O54A 4U8GA 4JI3B 4ZCMA 5LMUB 2ZRIA 1C8VB 4A6XA 4B3DA 4CF5A 4GE3A 2Z5GA 4NAVA 4AZSA 8ABPA 4E5YA 2JAUA 1BVYF 2LP4Y 2J3LA 3C2QA 3K6JA 3ROGA 1UMKA 1QVVA 3WGZA 1PGNA 1Z35A 4UOZA 1QMGA 2WFLA 1DO8A 1BXGB 4QOEA 2A5YB 2Q7DA 3S1AB 3D81A 2NZXA 4B9EA 5D51S 2DLDA 1KFBB 4II2A 3PF9A 1F9EA 4C2AA 2VJNA 4Y3UA 2YHIB 4IYRA 3HU1A 1AKRA 3PXBA 5AP9A 5FL7D 1OBHA 4NEGA 8AT1A 1RFGE 2GZ1A 1CNEA 3UOAB 3EZGA 1V6SA 4JP5A 2HU5A 2G9ZA 4UTXA 5DB4A 4C89A 2HLNA 4HEA6 2G0NA 4DKXA 2JCVA 2H7YA 2VJMB 4LJAA 5ALNA 5ER6A 4CNBA 3AVUA 1TZMA 2A4KA 2J4FA 3KVYA 3B8HA 4FE4A 1B2RA 3I04M 3CT4A 4LJ8A 3RIMA 4BLPA 4OTZA 1L2TA 3PGVA 5FBZA 3W2FA 4MV3A 2ZS7A 2D5BA 2IU4A 4XLLA 3H9QA 2IDZA 3K92A 1EHIA 2I99A 2JGNA 3OQJA 2W2NA 1Z5OA 2GQ0A 1WSDA 2J9FA 1H4VB 4DVGA 2ID7A 1AU9A 1Z16A 2H6EA 1K0UA 4MP8A 2RD2A 3OVMA 3DBVO 1LPBB 2C5GA 1QFJA 1QVRA 2KLBA 4UAUA 3W1EA 5FOVA 3G13A 3R0XA 3ICPA 1XEWY 2DBRA 2Z83A 2Y0EA 4H16A 1G4AE 5THXA 1ARZA 1YE3A 4Z9FA 4AZVA 3CF4G 1JIXA 1Y3AA 4OH1A 4FB4A 5L4SA 3I8SA 4AO8A 3MWLA 4K7JA 5FOXA 1PW7A 1XU9A 5BSGA 3ZQJA 1GXSB 4C7OB 2V5UA 3BG5A 4IY1A 1YJCA 3DPSA 5JRZA 5F12A 3Q7SA 1B76A 2YY7A 1Z5PA 1AQIA 1M6VA 4QXMA 4DYVA 2PKRA 4UTRA 3OZUA 2HLPA 3TPCA 1JFFA 3IDSA 2RIRA 4HN4B 2OK8A 4OQDA 3FHJA 1PBTA 1BS9A 1ZK2A 4WNIA 1SUAA 4R1MA 1A9XB 2UXDB 1ONPA 1ZN9A 3INTA 1UXKA 4YAWA 2PLRA 1L4KA 4DW8A 2ZYGA 3IP9A 3PVZA 4O2LA 2AA3A 1G5FA 3NALA 3FPJA 3CWCA 4PX2A 4ZQBA 2PTHA 2JNWA 4ETIA 4NAUA 2N1MA 1IFXA 1STOA 4NONA 4MWTA 4J43A 1KI6B 1FLNA 4TTRA 1NJ2A 1KFEB 5JMWA 2CLMB 4JQZA 4OHPA 3F74A 5GADl 4P3YA 2HPHA 2RGBA 4JUFA 4LXXA 5U4QA 5IT9A 4G56A 5ICCA 1BKSB 4L0DA 3MJHA 3R7FA 3K4QA 2NPFA 1NVTA 2O8VA 2R8PA 4Q4DA 4HFJA 4U0JA 5EPUA 2BFBB 4I4IA 3P4YA 3QPDA 2XAAA 2E5LB 4YH1A 3OI7A 4IVQA 3RJZA 4IZ6A 3ZCXA 1X9IA 5HKOA 2CWWA 1CQWA 2QN1A 4HXEB 4RLSA 5K05A 2JCYA 3RSZA 1VLZA 1KA9H 1EVIA 1UBOS 4ND5A 3BMOB 1DJPA 2FR8A 2X8WA 3AKEA 4C5CA 4OJTA 1ONOA 4V1CA 4FSDA 4LBVA 1UJCA 1RRFA 4MUKA 1UWKA 2JS7A 3AVQA 4ZANA 5F2OA 1QRRA 3KPUA 2BE9A 4ZEXA 2PZEA 4DRXB 1UJMA 3O92A 3SR0A 3T94A 4XM2A 4MULA 5C31A 3C74A 1F8FA 3QMPA 4IOJA 5CIWA 2PKEA 1XTQA 3KWLA 3MPUA 2HHAA 5EMHA 3AR8A 5LLDA 1PN3A 2VO1A 2QT1A 2YMMA 4OFXA 4OMFG 4XGKA 5UKDA 4TSFA 3H4TA 4NH0A 3OM1A 3B6MA 1QTIA 1OQAA 4LJSA 4ZGWA 5BY2A 3OEEA 1G20E 2VYND 2QUJA 1V8PA 2BDEA 1KI2A 3EPLA 3O93A 2CZCA 3LY9A 2BZSA 3OIGA 2X41A 4CMEA 3WP1B 4KVAA 5I9LA 4X64B 2IV3A 1QV6A 3K9NA 2X8AA 3D2CA 4U00A 4MVJE 4YXWA 5K4GA 4C05A 4BYMA 3L7LA 3JRNA 3CIOA 4NTZA 5HIJA 4WDQA 1YULA 4DT1A 5TDHA 4DLNA 5LMNB 4IIGA 7MHTA 4FQ5A 4JP8A 5MDHA 1T0BA 1URPA 4QPJC 1XZIA 3COSA 1GU7A 1A5TA 3DD5A 1P1KA 4DL9A 2FAXA 4NCJA 5CA1A 1KI1A 3VOBA 3BVPA 2QEQA 3IT3A 3QJYA 3QWAA 4YCMA 4PPYA 1WB5A 3CEAA 4C01A 7REQA 4F04A 2CCKA 2WT9A 4QJIA 5IJ0A 4TXJA 1R5BA 4BNDA 4OHMA 1U2RA 4B80A 4ESOA 1W1WA 4IQ8A 3TLEA 4K86A 1D7OA 4EEXA 5CA0B 2OV1A 3ZVNA 3JQAB 3LE8A 2C2KA 1E3WA 1YV9A 2MSWA 5DU2A 3E9RA 1T13A 3LXXA 1USIA 4MINA 4OK5A 3VKVA 3GROA 5ICSA 1A8SA 3SC4A 4B3JA 2TRSB 4RENA 3IO3A 5LA6B 2XCTB 1NFRA 3MINB 3T3EA 1ECCA 5LWHA 4DFDA 3JWIA 4JB0A 5FOUA 2C5LA 1HA3A 2PA0A 4IZOA 1H6BA 2ZBQA 2Y0PA 1RHQA 3W5UA 2QT9A 1OX4A 3IUEA 3WX0A 1W25A 1I30A 1OAAA 1OILA 2WVGA 4R9NA 3NMUF 1DDGA 1M75A 3P26A 1W85B 4QUEA 3WK7A 5CNIA 5HSGA 4N3CA 2HLHA 1BWQA 2XUFA 4MS4B 5EJ2A 1SXIA 3HACA 1VB5A 1L5FA 3FCCA 2OZLA 3UAGA 1F0PA 2OCDA 3W7BA 2ONCA 4B73A 2B4QA 1V1JA 4W9RA 3VVMA 1V41E 1WCYA 2IYTA 1T29A 3SFVA 3SHFA 1N0VC 3BWYA 2HSGA 1OXTA 3OOHA 4M86A 2CHFA 3MXOA 1SQGA 3DFFA 4P0TA 1CUDA 3SN6A 1SUEA 1UJ4A 4P58A 4CMIB 4TVKA 5JRJA 3PNMA 2O6HA 3FYUB 2ASVA 2IY9A 3LKDA 2ZATA 5K3CA 3CLSC 2D5AA 1AKUA 2KPOA 5DCWA 4OOEA 1SB9A 2XNDD 2F55A 3CKMA 1V11A 4RANA 2ZGVA 3L6UA 4V1CI 6NULA 4F38A 1QPZA 3OOSA 3FNRA 5LWQA 4YP6A 4RIFA 2O8EB 2QMOA 2UAGA 4OXKA 1EG2A 3RVBA 3GAZA 4R54A 1I5RA 2Y92A 3DQQA 3MYRA 3V8RA 2XVZA 4FFOA 3D4OA 3SHWA 4DS3A 4YRIA 4U6QA 1VPVA 2P2YA 3FZGA 1EQ2A 3GJ5A 4JLVA 3WDSA 1Z6XA 3BGIA 3PGKA 5KU7A 5CPBA 3G1TA 3L1HA 4M88A 4GQBA 5HCUA 4D4LA 1E5TA 2J3HA 2WJZB 1ZJ5A 5B5SA 3TSAA 2QTRA 1E9AA 4YP9A 4LMAA 3Q2OA 3EC1A 1OXMA 1Y34E 1TM3E 2RHMA 3CXUA 4O8ZA 4F5DA 4XUEA 1I2CA 1R18A 2OWEA 2WSBA 2Q2NA 2RK3A 3D4NA 3Q3VA 4LMPA 2YWXA 1M5UA 5T3UA 1FW6A 1FDUA 4MDEA 2GAJA 4LZJA 1PKEA 3MT8A 2H52A 1HC7A 5K51A 4L2IA 5E7QA 1QF7A 2QTHA 1SCAA 1GU1A 3D7KA 1R0CA 4RY8A 5TQJA 4AB1A 4A92A 5F7XA 3X2FA 4LJ4A 4M7WA 3ZCVA 1ZJ6A 1FBNA 1NP6A 3LPAA 3IAM6 5ALEA 4HI0E 4ZAVA 2AH5A 2GDZA 3K1ZA 1Y4UA 2G1JA 3MPOA 4RD6A 4B3CA 3ND7A 1T6XA 4TXMA 3RVRA 4C20A 4RTKA 2X8BA 3OZCA 3ULKA 1G7TA 2Q41A 3T4PA 4FHEA 1U3VA 1UK9A 3MMNA 1G20A 3O21A 1DJNA 4CIBA 1QOZA 4P92A 5JQGA 3C15C 2EBFX 1CVLA 3LCJA 4ZQEA 5SV2A 4CN8A 1ODLA 3HKDA 1YQWA 3C8UA 1TTHA 1QM5A 2WDPA 3DV0B 3M6WA 2D3WA 2J3DA 2ZUUA 1YA4A 3MGBA 3PB3A 3PUYA 4XYGA 4RUKA 1E7YA 1IC6A 3B6EA 2IUYA 4EGSA 1NVEA 3L92A 3RYIA 2IV2X 4WN9B 1RYYA 3B1WA 3RVDA 1P2SA 1RXCA 2YYAA 3N3AC 5DN6D 1ADYA 2FSHA 3ZEAA 4AWXA 1A1VA 2Q3LA 1YFKA 3QUAA 4HN2A 5LQRA 1D2AA 1OLSB 2GPJA 3D7SA 1DCMA 2ECQA 2RFLA 2YJGA 3AETB 4JJEA 3UANA 4BGUA 2Q5FA 4NECA 4EG0A 4ERXA 4CTMA 5AW5A 2PS3A 2Z2KA 3NX4A 4EHHA 3TFOA 3L7MA 2QL7A 4N6GA 2B20A 3IIKA 4HD8A 1GP2A 3P27A 3CGWA 1L9XA 4ENSA 1WUJS 4N76A 5L3QA 1OX6A 1TZBA 1R8YA 3EAGA 4BCDA 4ZYWA 2SBTA 2O6LA 3L82B 3VUEA 5JISA 1XZLA 3HH8A 4J8PA 1UMDB 4WINA 2XYRA 3H42B 4IXDA 5KMGA 1I3OA 1I51A 1KTVA 2CXRA 1E3IA 4RLQA 1WVIA 5FBQB 1LDYA 2YV4A 3EZ2A 3OE4A 4G5XA 4I5EA 4FHGA 1HFJA 1P6QA 3KM0A 2CVQA 3O91A 1FRNA 2PDAA 5EQFA 4BVEA 5KOJA 4E0BA 1OH6A 3FUUA 1RYFA 1ULAA 3I9FA 2FDXA 4PQGA 2B9EA 3TJMA 1IOLA 1R5JA 2EWVA 4HS9A 1GGMA 1QO0D 1Z6AA 2CJYA 3DTVD 4G84A 3RS4A 3PGMA 2XKJE 3RIHA 2GHRA 4WE3A 4UUOA 2WKRA 1GN9A 3H1AA 4D46A 2FEPA 2EWWA 2FF5A 4X63A 3H16A 3DKPA 3P9YA 4B35A 4L3OA 1MKYA 3RYCB 1M6NA 2VFAA 4AF6A 4C0JA 2QN3A 3DQPA 3H9BA 3OCJA 2JLCA 1XZDA 4ARZB 4B3TB 3JQ9A 3TLKA 3A1CA 5KVAA 2A0UA 2ZRPA 3CZQA 3WLPA 5I51A 4BNLA 1JE1A 1KZ9A 4XIGS 5E6SA 5BWCA 3G3EA 1XLTC 2FY8A 2OG1A 4C0KA 3H1GA 2QRKA 4YHHB 1LWNA 4CEIB 1F7UA 2LTAA 3HYSA 2WJIA 2FZGA 2ILVA 2PKWA 3FKQA 1A7UA 4R68A 4Y9SA 2KS6A 4MUGA 4MWCA 3UG7A 1XF9A 2XJ9A 5AIBA 5AI8A 1Q7EA 2VJOA 2GN2A 3GPCA 1I36A 5KOYA 3M5WA 1PJ3A 3TVDA 2RI6A 2ZE7A 4K46A 3EXG2 3RG8A 1AC5A 3DZFA 3IUYA 2W6ZA 1DTWA 4BUJA 1RWQA 4LF9B 5IF9A 5K0LA 1LU9A 2QI9F 2ZRDA 3EOZA 5EXXA 2XA9A 2GBFA 4EVIA 3K6SB 1TEHA 4X62B 1XEAA 3QKUA 1N2XA 1CETA 1T5IA 2AEFA 2P62A 4ZALA 3G89A 2DWPA 1N7GA 2V1UA 5LOVB 1NI4A 5D5HA 3O8CA 4EX6A 2EERA 1E2JA 1H69A 3HCWA 4IIHA 5E6RA 1JT9A 4AICA 1XKXA 4GGOA 1NF9A 3AY0A 3SC3A 1RWNA 5KUTA 5JEEA 1WWKA 3CPJB 5C8XA 4GKAA 1GNTA 1DG1G 1X14A 3T1HB 4MQEA 1CYEA 1E8MA 4HQLA 1JIIA 2RKBA 1AB5A 1JKMA 3E22B 4WUTA 3EEOA 2RGAA 1MU0A 3NHAA 4KDCA 1SU6A 1XL1A 1ZH0A 4IQ0A 2ZM6B 3UH0A 1DRJA 1PR9A 3NXSA 3MTGA 2NTJA 4IX9A 2GYVA 5F3RA 1WP4A 2BHLA 3RVNA 2WUDA 5CXSA 5ESDA 3KDAA 3L7OA 3ABQB 3C45A 4FYJA 4RC9A 5K7SA 3VOTA 2PT9A 4DLUA 5SYAA 2HJVA 1MO6A 1HDYA 3LDHA 5K2MA 2XE6A 5CD9A 1LQTA 4FSXA 4AJ2A 5CA1F 2F9MA 2XT0A 2YWHA 3D6AA 1FQKA 5LBUA 3ZU4A 4JI4B 4QNNA 1YRWA 3PL1A 2OBNA 2CE7A 2C5FA 5IHPA 4GNRA 1D5CA 2IIPA 3ZCSA 2IL1A 3AONB 4OB8A 4BIIA 1BZYA 5AUNB 3PQ4A 5HZGA 3F6CA 3O4IA 4Y1RA 1ZMBA 5CCDA 1YUBA 1WO8A 4LWPA 3O3MB 1CDEA 1IUOA 5C18A 3VISA 1UDRA 4G0YA 3U2QA 4KR6A 4XOIA 1BU5A 1E6LA 4D56A 1QOQB 4G0XA 4JL5A 4IMIB 2ZZNA 1NLFA 5JRDS 1RRVA 3VR4A 5MFZA 1QGED 3THYB 4FMCF 3SNHA 3KSUA 5EP1A 4E2YA 1C9NA 2XNSA 2QVCA 1NIPA 1E1CA 3RC2A 1D2CA 2VUSA 1EB8A 2CNKA 4Q93A 4UBIA 1ZAYA 1EFCA 3QVGB 2OOSA 4GS5A 2VXYA 4OQNA 3UIEA 2Q1SA 4P5EA 1JB1A 1KQGA 3AJDA 1KY3A 1KJIA 2CUZA 1TQDA 2BEVB 1SG0A 2XBLA 3JASA 1D3AA 3FPAA 4YCAA 3QK7A 4R3UC 3RHZA 3AI3A 3UWMA 2FG6C 4OQXA 2Y68A 1SGWA 2I2FA 1CUGA 1LI7A 2W0SA 2XTAA 4PZCA 5KQMA 3B8EA 2O8CA 2P4SA 1YXMA 2QTAA 4TV9B 4EENA 5H70A 3A1SA 4HJXA 1GARA 1RPAA 3DKRA 5JSKA 4ZI7A 4FYWA 2DFPA 4UE6A 2YDYA 4ZVKA 3L6RA 2J31A 4UNRA 2YWFA 5GTDA 4C2UA 4V38A 3O1JC 4J1TC 1GQFA 3SEAA 1PS9A 1YWGO 2OBLA 1SVOA 2MINA 4EZIA 4TQ9A 5D5PA 4OPMA 3CTPA 3G0HA 3DCYA 3EA5A 3CWQA 4C6TA 2AXNA 4QEKA 3ROFA 2PRYA 1FUKA 1QB8A 3CW9A 5EJ4A 3L4KA 1FA9A 1VL1A 1ZHOA 3CEHA 1ZM2A 3C5EA 3GZNA 3NVDA 2QYHA 2XTMA 1U8FO 4I8IA 4QDTA 1DG3A 2IBSA 5ALLA 4NCXA 1YQXA 3VZPA 1H65A 3LT2A 2OQIA 2AMFA 4B6QA 4E5PA 1OB5A 4YRLA 4HAVA 3HS3A 1TMYA 3GZ4A 2P9GA 4INPA 4ZDKA 1U7TA 2VQ3A 4PXSA 1G6OA 4KFTA 4TRRA 1XFAA 2ZZKA 3NTVA 3QVUA 3AIKA 4CM6A 2IOFK 1CE8B 4Q03A 1XZPA 5JZ9A 5DT9A 4TTVA 2FKAA 1TADA 3TSWA 2HZBA 4G89A 5DHPA 4CLRB 4DJ5X 1Z75A 4E6PA 3K4PA 3BIJA 1ZIDA 4GWKA 4B82A 3W4KA 5FWYB 2HF7A 3WNBA 3VAAA 4M38A 5AW4A 3PP8A 1GPNA 3BAFA 4NZZA 2P2ZA 2PGJA 3K3PA 4HX9A 3IP5A 3RC9A 2WFZA 1NJ8A 5CT5A 2CZQA 2OBBA 3FHCB 2XEXA 4K9PA 3GEDA 1YVEI 3LWNA 2I1LA 5TQ2A 3VR6D 2CSXA 1JSXA 3D3EA 1MJGA 3U26A 1US8B 2LZ0A 1AGPA 2X40A 2NYVA 2VNIA 3HCBA 1IY9A 1MO5A 5HFNA 4L6IA 3C4VA 4TTSA 1IY0A 3HSYA 3VYVA 3ZS8A 3EXFA 1KJJA 1BXRB 3BTOA 3M7IA 2C7BA 4HSGA 2JIZA 5JQGF 4WNAA 3W9UA 2QR5A 2YZMA 1VKOA 4GX2A 4DA6A 5T41A 1FYWA 2ZIXB 4Z2YA 2J48A 2QMZA 4C29A 2A9KA 1ML3A 3MBIA 5EFOA 4M7RA 3V48A 1UF9A 1ZX1A 3F7MA 3AB8A 1G5RA 2P79A 3MCZA 4HDKA 2B34A 5AYVA 4B2LA 5EJ5A 5M2QA 1ZL2A 3OUUA 4KVZA 1L7VC 3KQNA 2BFPA 3HCEA 4R9UC 2CNOA 3NFRA 3M6LA 4JLMA 4U3JB 3CX7A 3VR5H 3ZGVA 3UK2A 1R3UA 4ZV7A 1FX1A 3K9GA 1N8SA 1SIBE 2Q5CA 1LKZA 3EZFA 3LYLA 1KBZA 2C2OA 3NOXA 3C6ZA 2IE0A 4NHEA 4Q1CA 3TQHA 2CYBA 3UAOA 3Q8LA 1OZ0A 4J1QA 1IONA 1I3CA 4GC5A 4HLCA 3UN1A 2UXCB 4IHAA 2VAXA 5FTLA 1BWPA 2QM3A 4N3NA 1N6HA 4QBIA 5IHXA 2FOIA 2QNIA 2RAUA 3KSDO 3O90A 1G2IA 4FX5A 4LOLA 4QPDA 4ED9A 5BSHA 1V5IA 3AKYA 3VR2A 1UPCA 5L3SA 4FWTA 3H2IA 1E7MA 3EFEA 4KMRA 1EPUA 4OGLA 5BMVB 3U40A 3ONWA 2FB9A 3A58B 5E7JA 1SKAA 1JU4A 4MEJA 1NRWA 1X94A 4IO0A 2Q3FA 1I1NA 4XSVA 3VSBA 5ALQA 4NMWA 1M1UA 4DBLC 1OLOA 4GOXA 3TOSA 2ZSFA 1BROA 3L84A 1QIFA 3BIXA 5HQJA 4OQ4A 4QTUB 4TL8A 2V7QD 4COKA 4DA7A 4HADA 1MX9A 4JP1A 3EGCA 4CMKA 2F8TA 1XO1A 1B0UA 2PT7A 1XQVA 2B37A 3BTVA 4FXOA 4PLYA 4XX0A 3D8HA 4M8KA 3EXHB 5LJLA 1DKOA 4BFUA 3BWEA 2Z6AA 4PINA 6CHYA 4XYMA 3W3ZB 5CDGA 3E8MA 4JCOA 5B1EA 5AHWA 3V46A 1WD7A 4JI7B 2YIVX 1AN9A 1HO3A 4D8VA 1DGQA 1I5OA 4UUMA 3MWDA 2H7VA 5F1YA 2ZM5A 1DMSA 3RHSA 4IILA 4PQFA 3HE3A 1SXJB 2ZYHA 2ANBA 4PRZA 3A8TA 4QAJA 5JD6A 1TECE 3ZE8A 4WXRA 3SJAA 5D3QA 4CKBB 3A1WA 2I2DA 4NENA 4TYMA 3U9LA 1LW7A 2Z57A 1OFVA 2O1WA 3UAWA 1BOFA 4B6JA 4ZO4A 3QWFA 3SYLA 1QZZA 1B7GO 3M9WA 4BQNA 5FD8A 1UFRA 2X0EA 3WMWA 3UNXA 3ZK9A 2H3EA 2AQHA 3A9VA 1U4OA 3D2LA 4EB6B 5FI3A 2C4TA 3FMGA 3KVOA 2HSEA 1NNSA 3WZLA 3AUYA 1GTZA 3FVQA 5JROA 1QHYA 4BN5A 3F1KA 1WXHA 3ABIA 3PC3A 4QUDA 2OGTA 1A96A 2B4RO 3H2GA 3CVXA 5F77A 3WRXC 3NHMA 2UZ0A 2AR7A 1UCFA 2B5WA 4RHUA 4MGHA 3U7GA 1U8ZA 1P7YA 1NJSA 2P6UA 4LDNA 1XQ9A 2XF8A 3IKMB 3NWEA 3OP1A 4GC9A 1YR7A 1JDSA 4YMHA 4KE7A 4D7AA 4EGFA 2JIDA 1VI5A 1EB9A 3NHLA 3PE4A 1I7PA 1MEJA 1IY2A 3WMFA 5J47A 2HRBA 5AUQA 1RC0A 2VDRB 2Z8ZA 4EOGA 1QYDA 1XX6A 1XDUA 5JOQA 1U04A 4I36A 1J9EA 2DJIA 5F1OA 3DDHA 3H4VA 4H0NA 4J16C 1RQRA 4UVEA 3DO5A 4B8WA 1DV1A 1SOVA 1B14A 1X15A 2J0UB 2LUOA 4MW2A 4E09A 5KYGA 1Z47A 3DPIA 4TN1A 2HREA 2VYQA 3LT4A 3UATA 3D7NA 3ZU3A 5EZ6B 1S4QA 5CU7A 4P5PA 1JS1X 3FUTA 3G8BA 3HP7A 1RYNA 4MKRA 3F6PA 1CF9A 3TRJA 2RG7A 1SKQA 2VKQA 4AKEA 2Q1TA 1S2GA 5JNRA 4QM7A 2ZJYA 3F9CA 3FIUA 3ONFA 4PEVA 1SJ9A 2YJ3A 1HX7A 1I2DA 5FPYA 3ORRA 5CFOA 2NQ8A 2HA7A 1IJEA 2HHHB 1M1XB 1DQPA 3MF4A 4WL0A 3EDQA 4FDTA 3E7PA 3EN0A 2AE2A 3TIVA 4I50B 1QQ7A 4Y2SA 3GJRA 3TQQA 2DBYA 3L0IB 3FFAA 4FGWA 2Q4EA 2B1RA 1ICIA 4QUGA 4XPIB 1ZL0A 1QVWA 1UBHS 1R9MA 1E5VA 1DJMA 1VL8A 1XALA 2PTGA 4RU1A 5DRTA 5FBVB 2CUTA 4LXHA 1X42A 2FRVA 2F3PA 2XDQB 1T5TA 4UPDA 2Y1KA 4XH9B 4MCAA 4PC7A 4ND3A 1QDLB 3CJQA 2R1VB 2W2KB 4QDOA 5DTIA 3VU3A 3UK7A 4JC0A 4RD4A 3ZC3A 4PX3A 5AUOB 2PMDA 4UHCA 5J9FA 4BJ1A 4YJHA 4I1SA 4DC0A 1I1QB 3WIDA 4PF1A 1LUAA 3B1KA 1SPBS 4HDOB 4MV5A 4I1UA 3OJCA 4JC4A 3ISVA 2AN5A 2IZ7A 2A1UB 2OLKA 1YQQA 3OWHA 4XGQA 5H82A 4R0MA 3W1WA 2BYTA 2XCIA 1U28A 2JGFA 1NT2A 1TU4A 1UBSB 3J80A 2HXSA 1TM5E 4MWDA 2KB0A 1C8LA 3P4XA 4YJGA 4K0RA 1TIPA 3ZVKA 2Y1GA 1P73A 4QD3A 3KXIA 4QASA 1O95A 2EGHA 1J8VA 2KX7A 3EW9A 2P65A 3HXPA 4ZI7F 3I23A 3OT1B 4KPEC 2PMKA 3T15A 1N5IA 4MIYA 1O9GA 4FFWA 1KI3A 1RRCA 1TAUA 4M83A 2NU8A 2FPGA 3CZ9A 4LMRA 1E7RA 1DOZA 3LECA 3G82C 2VTKA 4GVPA 1JRLA 3RC1A 1HDRA 2YYZA 3AZQA 5KTYA 1XMIA 2O07A 1PWXA 1YNOA 5JAUA 3STYA 3P0EA 1KFCB 3MLBA 5A06A 1KMNA 2RCYA 5COBA 3UGKA 5T8KA 3ZJUA 3R9WA 2BSXA 1RKXA 1GCGA 1JFRA 1LD3A 1E92A 4ZIRA 1ZA1A 3EGWA 1TVMA 3Q11A 2N47A 4YRKA 1YRHA 2LE0A 5LIPA 3LD9A 3NHUA 2D59A 1U9IA 1A8PA 2C03A 3UJ9A 1VXOA 2M6RA 5DBOA 1CDOA 3BZWA 2ZRCA 5A0TA 3OE7D 4LXYA 2PL1A 4LV5B 4DOMA 5BV8A 4AW9A 2RJOA 3LVBA 2IJGX 3IBGA 2C9MA 2NQTA 3TTUA 2AUTA 3PNYA 2LIVA 5AWFC 3GGSA 1EWYA 1OYOA 4GYJA 2XQIA 4NPAA 3TR6A 3WKDA 1BXGA 1NW7A 2IF2A 3S1AA 3HDJA 3DZHA 4RZXA 3SEZA 8OHMA 2JIRA 1CF2O 4LCJA 2G5GX 2C8LA 3H8SA 1OFUA 2YHIA 3UV6A 4DSZA 3N2GB 1L5NA 2RE8A 4BECA 4NOJA 4QDUA 3TRIA 1O87A 1XAJA 3CZMA 3IB6A 3ZQ4A 2ECFA 1GYPA 3LQ1A 4OHCA 4TXNA 3WJ2A 2VJMA 4I9GA 1FL9A 2J5BA 5CM9C 1XAGA 3JQ8A 2OD7A 3BREA 10MHA 2RHGB 2JIQA 1VP9A 1UOOA 2EFGA 3CS3A 4ZK6A 1Z17A 4CEJB 2WVAA 4F6CA 2C58A 4PFSA 9LDTA 4U2CA 3J81k 4NMLA 1HTTA 4F0JA 1WPXA 4OF4A 2H1RA 2ZP1A 1E0AA 3THWB 1JDVA 3GT4A 1L3BA 4QT4A 2F59A 4RACA 3KOYA 4O2BB 5TE9A 5FLKA 4HGQA 4UC0A 5EUBA 3R4VA 3TXAA 3OIUA 5A04A 4HH0A 4E5SA 1EVJA 2G9UA 3W6ZA 5KQRA 1XPRA 1GQOA 2DCMA 2ZT6A 1VMDA 2ZJ6A 5JE8A 4F45A 2TYSB 3G17A 4NP6A 5K4AA 2M6LA 1NNEA 1HE4A 1ZMRA 4ER3A 1ZFNA 1AF4A 3OBIA 4A16A 1RDFA 4MRNA 5JNSA 3G2LA 3ZHCA 1P33A 3P2MA 1GXSA 2BP7B 4C7OA 3L79A 5IASA 2IBMA 4QQ8A 2W93A 5DSTA 3U3JA 1ZIPA 3CF6R 3HBNA 2PUEA 4JC8A 4NBWA 3IOMA 2BI4A 2C3UA 2GSDA 4IQFA 3WRYA 4GG1A 4H1WA 4FGKA 3C7CB 1NTRA 3W5SA 2F3UA 1A9XA 3DJFA 4KV7A 2YCLA 1E5XA 1SUBA 1CFJA 3LYUA 2BF7A 4NRDA 4A6PA 1PW5A 3AEUB 1U2TA 1T9AA 1PGJA 4D41A 3T95A 4LQLA 5FBLB 4G81A 2ZXUA 5I4IA 1YHNA 4ITVA 4EUKA 3IAFA 1SKBA 5IS2A 2QUHA 4RVUA 1AM4D 3BGSA 4J4BA 3C6YA 1RM5A 4MI9A 3RU2A 2QTGA 3D3JA 4YP0A 5D3MA 1CUHA 3KEFA 4YQEA 4KG7A 4C14A 1TZJA 2BY4A 4NJMB 1A95A 1G9SA 2PU5A 3QVKA 4GLLA 1QUEA 3BEOA 5LCXA 3KQKA 1OBFO 3SZOA 3ANTA 4RE5A 4K3UA 1NPDA 4DF3A 4L72A 2BFBA 4O4LB 4Q4HA 4DIUA 1UK8A 1K8XB 1P81A 5DM0A 2BKXA 1JLLB 1CBUA 3N8IA 4LYEA 2EAUA 2E49A 3DSRA 1LS6A 1C3OB 3O26A 2J3JA 3SMQA 1G0OA 1ZVJA 1NN5A 4OP3A 4I8DA 3S7ZA 2X15A 3KEMA 2CZGA 3QHQA 3V2IA 1U98A 2NU6B 2ZUCA 2B2XA 3LLUA 1X1BA 5G4LA 2CSUA 3LA8A 2Q8NA 1J20A 2JJMA 2VN8A 3MBKA 2A0YA 3S6JA 1TPYA 3KT6A 3DOHA 2GD6A 3QNWA 4LS3A 4R2HA 5BQ3A 1W93A 1Q15A 2WM9B 4QWMA 1ZD4A 2I78A 5A5VA 3T5MA 1W0JA 4W5QA 5KYKA 1FP4B 4PO8A 3JAWB 4DRXA 3RJMA 4OOFA 1F8GA 2OXEA 1IQUA 2QAIA 3KB1A 3FYCA 4BCBA 1K63A 5AM5A 5FUQA 2CEAA 5DYGA 2HRRA 3B3GA 3GAFA 4YJ3B 1U1IA 5B58C 4AZ3A 1HV8A 2WB2A 3DVLA 5A1TA 3U4CA 3I0ZA 4QYWA 5KJ6A 3FWPA 3EMVA 4J0CA 4PYJA 2JAHA 4DG9A 1L5QA 4AS3A 3FMPB 1ISFA 1E62A 1ORHA 2BCGY 1C9KA 2BMAA 2ZWOA 1X7HA 1YE5A 3R0QA 3TG8A 4Q47A 2A0WA 1ENOA 1E8DA 2DVMA 3QYJA 5K8JB 4KO3S 5KKAA 4C4YA 3RLFA 3R6WA 4BGDA 2OWDA 4EUSA 1RM3A 4HGYA 2XYHA 3AB3A 1TKRA 4CG2A 3CW2A 5DKFA 3AF2A 5DN9A 2WWWA 1U1EA 2JAOA 1KEWA 4MAFA 3T9CA 1Z4QA 3PNKA 5T4HA 2WYHA 3SE7A 4Z4CA 1NXTA 2EC5A 3C87A 3PL5A 5CFMA 1U2SA 1T2DA 4EJMA 3KKOA 1CLEA 2PFSA 2I3ZA 1RI4A 3BAZA 5TMPA 1F17A 1VOTA 2I66A 3H87A 3LC1O 2GBLC 1L7QA 1NASA 3EOAI 4EPTA 4M37A 4TV8B 4GZ3A 2X0DA 4L4RA 5EIFA 1VKJA 3VDMA 4F9FA 3EXEB 2RH8A 4CGZA 3HCCA 5KHLB 5I9TA 1IJBA 5CDFE 2F43B 5B2ZA 1C2TA 3IOBA 4KQ6A 2WUFA 1TQ8A 2PYZA 4RKWA 3EWNA 4RZ3A 1A9RA 2R87A 3ESXA 5J1SB 2ZOSA 4P86A 1SQFA 1TM4E 2DQYA 2BR3A 4UBJA 3ER9A 3JR7A 1U7OA 1QYVA 2G9RA 4I4CA 4D43A 2HO4A 1N3LA 4LI3X 1P2FA 1FTGA 3H5WA 3E4CA 3MINA 5LA6A 3STHA 1FVHA 3UPDA 4F7DA 4NV0A 4KAAA 1GKYA 1N6RA 5KSYA 1BMFA 4WLEA 1EM8B 1NVAA 1QZTA 1P91A 3A25A 4AY6A 2A5JA 2GXSA 5JATA 1SAYA 2G71A 1GNPA 1DL5A 4RZQA 4PZLA 3W06A 1KAHA 4CL0A 4OLJA 2NNWB 2IP2A 5AHKA 1DSSG 5D2CA 4XKJA 3SM3A 2Y1EA 4BGVA 5HK9A 1W85A 2IZ5A 4G9EA 5LMCA 1NBIA 4D0NA 2F9FA 3NWBA 4EGAA 1AQ6A 2EIXA 4MS4A 4O1HA 3SK0A 2GJSA 4GPAA 3EOBI 1UXJA 5C0OE 5B7QA 2GI4A 4KAFA 3IMKA 3I53A 3NQ41 3KKPA 4EKEA 3RO7A 4HH4A 3P2EA 5IRCD 3MAJA 3PUKA 4XIIA 3AI1A 5D00A 3KSRA 1CT9A 4U7GA 4BJ6A 1M5RA 4ZC1A 4EI2A 1ZZGA 2G8LA 2NSHA 2X2PA 2EWMA 4LK3A 4NU6A 2CXPA 3T41A 1JKFA 1TIKA 2WLTA 3NBQA 4UASA 2HV9A 3UWPA 4B75A 3MJTA 5BNIA 3FYUA 3VPXA 4NMXB 3WKCA 2QYOA 2JLAA 1FYEA 1NMEA 4ACAA 1EVQA 3BQNB 1EUYA 4XLTA 1IBKB 2ACEA 4Z1MA 3H2KA 3P9KA 1A7KA 4EA7A 2IEZA 1ZMTA 1ZNXA 3IQDB 4MJ3A 4MIOA 4BUZA 4LE2A 1H85A 4MKZA 4Q9AA 4UM9B 1JBQA 1I4LD 1FSGA 2A0FA 2FK8A 2PSSA 2A5DA 2GN6A 4LHYA 4RKYA 3ZGZA 1C7QA 4GMHA 3FBWA 2ARKA 4LTDA 4BVBA 2ZRFA 1HT2E 3EVEA 4J6FA 5K0BA 1G2PA 1A8HA 1YCDA 2QYSA 2KM1A 1FYVA 1K6EA 1K92A 1RBYA 2CDRA 2ZBGA 5H59A 4DR4B 1Q0PA 2VH2A 5TMEA 1RWBA 3SS9X 1WB4A 2OSVA 3VV3A 2PUAA 4W8OA 3A11A 3S8YA 2OXIA 1CZUA 4ZU6X 3V1TC 3EG9B 3IURA 2YXPX 4M3NA 3U80A 3TJRA 2I4IA 2OFPA 4BFXA 3NRCA 5C80A 2G40A 3N07A 3JVEA 4R8RA 4EPVA 2HMWA 4RV5A 4F12A 1X1EA 3R3JA 4PAMA 4KMMA 4LW8A 1RZ3A 4FD2A 3MEQA 1W4LA 3ZD9A 5BXYA 2GT1A 2H2DA 4H59A 4MRAA 4CCYB 1GZVA 3RRZA 1T0PA 4BP9A 1TCBA 5DYIA 3ADCA 2QRMA 3D6VA 1HYHA 1Z4MA 4H3KB 2IS6A 3A3YA 2VBFA 3ZLJA 2ZUDA 4KQIA 3WYBA 2IBTA 2BCEA 2GFHA 2IUFA 2V8OA 1YUMA 2J07A 5EE9A 3RDPA 3M6VA 5J4KA 2B9VA 3SZRA 3ZLVA 1QXSA 2FX5A 3ZHQA 3NG1A 2YVLA 3L01A 3V00A 3L7JA 4LZLA 1G9XA 1NW6A 3MJDA 1XGKA 1JSCA 4PSUA 4YT5A 4DMMA 1KSJA 4J3JA 3GT3A 3D6TB 4BWGA 4D74A 3HPRA 4P2GA 4HRXA 5F73A 3I5YA 3ESZA 1PT6A 2NO0A 3QEOA 1L7BA 4FNMA 1JDPA 4L51A 4KL8S 1LLDA 2AFIB 3G9ZA 1TEXA 4RORA 5AW3A 1TIBA 1AURA 2BSQA 3I73A 5LYJB 1Z13A 2BISA 3CLTC 3STUA 5GZ3A 3ZXXA 3T0GA 1M9NA 4YMVA 1PVOA 1JZTA 1UKCA 2QY9A 1BE0A 3DLAA 2I65A 4HMPA 3AETA 4LX0A 1C0IA 4R5HA 5IEBA 3RWMB 2FPWA 4XSGA 2RCNA 4AULA 1N1DA 3WLRA 2BBOA 3KQUA 4QOGA 4PO9A 5JZBA 4KLNA 5COAA 3HCFA 3DLTA 1LV8A 4BYGA 2DCUA 1E2EA 5KJCA 4AS1A 2HADA 2X1LA 3T3OA 2W6QA 2GZAA 3NIWA 1KP9A 3FAKA 1UT6A 3ZCUA 1U90A 5A5FA 1UMDA 1QIDA 2VYCA 1U8YA 3C6MA 4MB6A 3TZHA 1U1CA 2DFKB 4KQ9A 1N2BA 5J5AA 2H9AA 5CDFA 1EQUA 2DWCA 2YXNA 1ZU5A 3DDUA 4HG2A 1ZVMA 3I39X 1BDBA 4P84A 4OJYA 3WK9A 3E2MA 3TB4A 3UMYA 4LF7B 1IBRA 1WCXA 2V4MA 3QKWA 4V02A 4DHWA 4I2VA 3Q8MA 1SC1A 2JFBA 1J8MF 4OI2A 1T6YA 3IEUA 4KE9A 1GPMA 4UDOA 1EFDN 2Q3EA 2R9VA 4CM5A 1XV5A 3JPWA 1N5JA 1OJLA 1P2TA 4MS1B 2ZJ7A 2DUMA 3P2JA 3I4CA 1XIVA 3G02A 3G7SA 4ID9A 5DSZA 3RAGA 3A28A 1A9SA 3VNBA 4W9MC 4PPFA 3WYFA 2OCPA 4ARZA 3NO4A 1E1QA 1C0PA 1IDN1 2NADA 3GRUA 2A9VA 2VEOA 3M6FA 3NWOA 1XZJA 2Y27A 4N1AA 4QYIB 3SLGA 1IN4A 5FV4A 2AC2A 1C4XA 1VMIA 3NAMA 2WVHA 4E2XA 4G1FA 1BDIA 1Y8QB 1L7MA 3DB1A 3HDQA 1FQWA 2PL3A 3A1EA 3FOCA 4CMHA 3K2EA 4MVWA 4CEIA 1LBTA 4MQMA 4N03A 1CJMA 2OUIA 3FRIA 3K8YA 3TOCA 3PA6A 3KFXA 2I2WA 4Z3OA 2C9YA 4KNYA 4JU9A 4U0KA 3P4UA 1NRJB 2V6JA 1P9NA 2EKLA 4R1QA 5ANRB 2RJNA 1OXXK 3INRA 2ZB7A 2NUPB 4QGFA 4DM7A 2ZSUA 2FQ1A 3CRMA 1BU8A 4RFLA 5JJIA 4KI7A 4WZ6A 3AUFA 3MA0A 1C8KA 1AZTA 2C2WA 1ZLXA 4M0KA 3K6SA 1E2IA 1HDOA 1U8EA 2PUBA 4UBNA 1Y42X 4BV8A 5IAJA 4Z3KA 2H4ZA 5AQEA 4IYJA 4ZCTA 1W9MA 3BWCA 4XD7A 4CG1A 2ZVPX 1T3SA 3AEYA 5B7PA 1KMCA 3WB2A 1Z6GA 1SFRA 1FFXA 2VDNB 4KCGA 2AEJA 3ICOA 3VPSA 1ZITA 2P8SA 2VS1A 3FFWA 2VP0A 5CP8A 4C30A 1BMDA 3GMDA 1L7EA 1ELOA 4V0SA 5JAPA 1Y9JA 3V3TA 3W6PA 4E94A 4P53A 5IP5A 4PHFA 5IVDA 5LM3A 1QF6A 3NHKA 2WAYA 4GZ5A 3E22A 3K2BA 3HFGA 4EPXA 1QYRA 4KB5A 1MP0A 1QK5A 5C1BA 3BTSA 1EG7A 4TSFD 2QNBA 1YZKA 4Q4LA 2JHPA 4Y2QA 4B6RA 1MENA 3PU6A 2OVFA 2VYFA 1CERA 3OEED 3PUZA 2PZBA 3JW8A 1T25A 3T5GA 2WZDA 3I9V6 1PFUA 4YCSA 2PLAA 2TMDA 4OMUA 5AI5A 5JYCA 4RTPA 1AA6A 1PYGA 4TXHA 3H9UA 1JJVA 3LHDA 4XVHA 5KKNB 1NG1A 1P1BA 2YQZA 3CGGA 1KC3A 3K1YA 1SZPA 4H6WA 4LCEA 4D26A 4ONEA 4Z4GA 3AIOA 1G3QA 1AY0A 1JQLB 2QW0X 2M2IA 4P83A 2P67A 4R01A 3SBXA 4BO6A 4YXWD 1XU7A 2N9UA 3A1FA 5KZMB 1TJYA 3HJRA 4U02A 3RTEA 1PJAA 4N8EA 2XF2A 4QLAA 3UCFA 4F4CA 1ZC3A 2QRQA 1OXVA 1HI9A 3SEFA 5I5GA 3L8HA 3EIXA 2GK6A 3N86A 4KN5A 4YRTA 4QQNA 5DNWA 1ZD3A 2JLBA 4V0QA 4YFYA 5E4TA 3TZEA 3RC7A 4N5HX 3QF4B 3ZZUA 4D6XA 4L4YA 3NNDA 3C3BA 4MW5A 3AR3A 1W4BA 3DVSX 4LZPA 3T54A 3BL8A 1KE2A 5ALOA 1WXFA 3ZGXA 2QM8A 4MPJA 2O0KA 2CJXA 4XZ3A 3ZWVA 4AJ4A 1B26A 3QPWA 2GYWA 4XVRA 3QVGA 2WAOA 1IZ9A 3PC4A 4GOLD 1UMCB 4KOEC 2X3YA 3MRSA 2BEVA 1RI2A 4O2RA 4JXXA 1GT91 2V6BA 3S55A 2WG2A 4DLXA 4JBYA 4NABA 1SRRA 2YFQA 3RRJA 5I3ZA 2O3TA 3N0TA 3CZ5A 1FX0B 2VUUA 3QH4A 4MVCA 1ZVKA 4TV9A 3DR3A 3MBOA 1YS9A 3PUIA 3K9FC 2F1RA 4ZRMA 1TT7A 3KR0A 4BL5A 1ISRA 2RH4A 4DGSA 1J8YF 4WQMA 2C0QA 4FJ0A 1O6GA 2OORA 4G3XA 1JW9B 1MC4A 5LYYA 4PZUA 1IXKA 4CT5A 1W87A 4D9IA 5JVDF 1XF1A 2J9RA 2AXQA 2M1XA 3QU9A 4OXYA 3LKZA 4D99A 1GT6A 4LE1A 4A0RA 3AUUA 4OH7A 5B36A 1VGRA 3DZKA 4KX5A 1P19A 2FW9A 4UDXX 4C1NA 3VPGA 2CDCA 3HJHA 5KO2A 3KAPA 2W6PA 1DWQA 2C0PA 1O94D 2B8NA 3COPA 3I62A 2QPTA 3P94A 1LNQA 2W9XA 1LBQA 5IW8A 1RI5A 4I9HA 1NJ1A 1Z74A 2QD4A 3WNZA 4G4SP 2J41A 3LGSA 4DCUA 1ODKA 1YACA 3M4YA 5DOVA 3PXEA 1QVZA 3T1OA 2NSDA 3TAUA 2BGGA 2I4OA 3KSAC 2PBFA 1GN8A 4O1MA 2QT0A 4OJNA 1H5NA 5AKHA 2JIOA 5ENZA 4Q7KA 3G0GA 3GPDG 2W2QA 4CLRA 1AT1A 1IQPA 4G23A 4OQZA 2W2MA 4UDYX 3ZCPA 4B6EA 3DUWA 4QU9A 3VNAA 3ZI4A 3B20A 5FTMA 5FWYA 4C7MA 1IJKA 5G0VA 4LOJA 3WL6A 2G1PA 5CXXA 3Q12A 3AEQB 3I83A 4LSMA 1SBZA 1TPZA 3CLHA 3JQDA 2JFWA 1YZUA 2WAAA 4PG5A 3VX3A 1MB0A 4B5LA 4Q4JB 1AUQA 1I2AA 5IJAA 3GEPA 4RTLA 1YFLA 4KWHA 3BULA 1OJ7A 3G59A 4LUCA 1SBTA 4OI1A 1LEHA 3IOYA 4P80A 1I5EA 2I29A 3NWJA 1J42A 4HLUC 1US8A 3QIVA 4IIUA 7YASA 4CIYA 3ROKA 1JDBB 2AB0A 2H1FA 3FNFA 3N74A 3EC7A 2JAXA 4PCUA 4OHFA 1P45A 3ZE2B 2OILA 2ZI3A 2HV8A 2XRYA 1DQSA 4N9WA 5GJVC 1ZLYA 1AKVA 4KREA 1E1RA 1BXRA 1FSPA 1V0JA 5KNCH 1LBSA 1XJCA 1DARA 5LJIA 4BB0A 1GAXA 3QUBA 2CW5A 4PV7A 4HUQA 3P2IA 3CRNA 2ZSIA 5AHRA 1MOZA 2ZIXA 4WESB 3R20A 4XQ0A 2J1LA 1CKEA 2WT8A 3DHEA 3FZEA 3U7FB 2HRZA 1XEXB 3KVVA 3DAPA 3Q3HA 4GXTA 3QOXA 1UM8A 2RHRA 3DMPA 3E9CA 3WK6A 3ZYZA 4C4XA 5KNBH 2Q9CA 3IUSA 5FTWA 3T3PB 4U3JA 3W5AA 2FZLA 4YJFA 1AH2A 1ZSVA 1ONNA 4BB9A 5KQSA 3WLJA 1HR0B 1P2VA 2P3QA 3AV0B 4KTTE 3UJDA 1SVSA 4DJDC 5BUQA 1R9JA 1GZSA 4NU8X 4CEHA 4D25A 3P0HA 3K09A 4S2UA 4DG5A 1EXMA 5JSYA 2WD8A 4L5YA 2HJ9A 3W7AA 2QUAA 4MVJD 4M2LA 3GJQA 4A91A 4W82A 5BMVA 5J4YA 3MCTA 4U7WA 1IXZA 4LZZA 3MJEA 3K70C 4NE2A 5E6UB 4MMYB 5ENVA 3FKSA 1DADA 5CD1A 1NG9A 4UVGA 5DM2A 1VECA 3NGMA 1YC5A 3MG9A 1NY6A 4N0MA 4OJKA 3FWHA 2WYIA 4KQ1A 2QMHA 3MHPA 2DX7A 5CNJA 3H9CA 4UEKA 3ZKWB 3EDCA 4HHEA 4GVLA 1A8QA 5KVCA 3X1YA 3EXHA 4WLNA 3T7IA 5JJKA 3D5QA 2VDQB 3DZCA 2PX0A 2RKOA 1GGEA 3FLMA 2X76A 3I5UA 4BS9A 2HCBA 4L0CA 1PL7A 2Z1DA 2FUKA 1KZ1A 1XLWA 1O0SA 1XJ0A 1PR1A 3BXEA 2CXXA 2KWIA 2QAJA 3E05A 5IUNC 2PH3A 3BRWA 1SCQA 1M0SA 5GVRA 2X6TA 2HDNB 5CDTA 2Z9DA 3QQPA 2PWAA 4PRLA 5F5NA 2PSDA 3NVAA 2BIFA 4HPWA 3TG2A 3QHPA 3I01M 1NSFA 2WJ6A 5HQTA 3CW8X 1JIUA 3Q3JB 4YAFA 3N7TA 2WM3A 4DDUA 1BJTA 3GV0A 4N0QA 1AOXA 2BBSA 2YZNA 3A14A 3BM5A 3PDUA 4NMMA 4F91B 2O8BB 1BEUB 1JE0A 1KVQA 3OY7A 3GFRA 3LDGA 4NCIA 1UXIA 3F5SA 5DFAA 4RHCA 4AJIA 2BI7A 4EB6A 5JTUA 1E3LA 5K2OA 3JQ6A 4NZNA 1JZSA 1N8NA 4Y9TA 1JNXX 3BSYA 3R74A 5FA8A 3IDOA 4QX6A 2XQJA 3RV3A 4C6SA 2QDXA 1WV1A 3EZ9A 3BXFA 5FRDA 1S3IA 2VHWA 2EX0A 3EW7A 3QA9A 3DEIA 2WIGA 2FJUA 3GT7A 1X7XA 2UKDA 3PHGA 3AF0A 4GOND 4KWIA 3NNSA 1BVRA 1USKA 4WGGA 1IN8A 1RXIA 2IF0A 2WYOA 5ER9A 3D0OA 5AFSA 2EF1A 4KE6A 4M9CA 2C9ZA 2P6RA 3D0KA 1TK9A 1TD9A 1PSWA 1WU7A 2Q29A 1JYSA 3FAZA 4LC1A 4TM8A 4DZTA 1T9GS 3IAHA 1RP7A 3AVXA 1H9CA 1UMBB 2P9QA 1LX6A 2ZIVB 1J06A 1RWVA 4EO7A 1BHO1 1N7HA 1X7GA 2WJ3A 2DEUA 2PG3A 5AVVA 5L53A 4BFSA 4MW9A 5IXJA 2J0UA 3Q7PA 3RAFC 5LUBA 1K0FA 4QAQA 4Y1GA 5BN4B 1YR8A 3W77A 4A8PA 3S5JA 4YRSA 1KJWA 1Z0UA 1GEGA 3S7TA 3VMFA 1ID1A 1YL6A 2P78A 1ISGA 5EXTA 4DY6A 5BXQC 1Y33E 3WA6A 1LTHR 2QUZA 4DMGA 4RVHA 2HQBA 2PZ8A 2BGKA 2XGOA 3HCPA 2Q45A 4ZOLF 5GM2A 3T5BA 5E38A 4D8WA 2R5NA 2VLIA 3TCNA 1YDFA 3NTUA 3EJWA 4R0NA 4OSEA 1ZK3A 1EDDA 4XM0A 3UBMA 2QN7A 1WIWA 1ETHA 1YMQA 3CE9A 3EBLA 2WD9A 3K8QA 2EEPA 3BYZA 1DI0A 2H57A 2HUNA 2NV2B 4UJ3A 1ESEA 5JALA 1ZN8A 3N59A 3DHNA 3QRWA 4XPIA 3L6EA 2GRUA 1LBEA 2OENG 2PZJA 3O2SB 5JBNA 1EFKA 3BHMA 3RV4A 4FFPA 1JR6A 4B74A 1YIOA 2XDQA 4MW0A 2J9GA 5F9FA 2GJAA 4O5AA 2R1VA 5E2AA 2PGAA 3KXDA 4QXQA 1PR5A 3ZU5A 2HKIA 4MAAA 3HFJA 4W7IA 2Q07A 1BDHA 1Y81A 1OH5A 4RIEA 3MHTA 3PJDA 3UWDA 3R23A 5ADHA 1QP8A 2AZ4A 1UBFA 2Z30A 4ZAFA 5JXWA 1HSZA 3NONA 4KGVA 4ZAXA 2A1UA 2XVXA 4UE3S 3WL7A 2XNJA 4YUYA 2J08A 2WOOA 2ZYUX 3ANNA 3W5CA 2ZRJA 4FGJA 2CNLA 3VR4D 1AKQA 5DNAA 2HMUA 3SVTA 3IBCA 3W1VA 1F2VA 2GXUA 4M8NE 4RMIA 3W8NA 1Z0AA 4L7QA 3D0RA 5D5QA 4UREA 3ETGA 3OT1A 4JUBA 4HXFB 4KKXB 4UPEA 2CFRA 3ZDXB 1XR3A 3E84A 3FI0A 5C8DA 2ZAGA 2MYUA 1MJFA 1H6AA 8ATCA 5U9CA 2VHCA 3O74A 2NOAA 1D4FA 1TU3A 2JZCA 2OBFA 4GX0A 5AM1A 2XRZA 1NW3A 1A77A 3G8AA 4WT7A 3Q41A 3K9HA 3V42A 1XMPA 2V6GA 3ITEA 4JYPA 4F1KA 4TKUA 2IU6A 3HRIA 4FZJA 1V71A 1ZCAA 3D4IA 3QLJA 4UM7A 3HCRA 4UDNA 4N6OA 2YCBA 4LGVA 4FP9A 3SAJA 3B6KA 4P93A 1UBLS 1WXDA 1ULSA 5G4KA 2REQB 3VOSA 4PZ9A 3AM5A 4ZVOA 4M1MA 5KYTA 1UPUA 1UC5B 4OQFA 4PGHA 4NEHB 5FCDA 4JELA 1JI3A 2BDUA 2N1BA 2PVSA 4TT8A 2PMEA 4MR7B 1V25A