1BVHA

Solution structure of a low molecular weight protein tyrosine phosphatase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
157
structure length
157
Chain Sequence
b'AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACID PHOSPHATASE
publication title Solution structure of a low molecular weight protein tyrosine phosphatase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 21
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bvhA00
3KTOA 1JYFA 5TPZD 1P6QA 1W25A 4KZKA 5PNTA 2QSJA 4OBBA 3QEMB 3OMWA 1QP4A 3QEMA 1AB5A 2JB9A 2FMKA 5FBKA 3OLXA 4PYRA 5I4CA 3KLOA 3MQ4A 3BRSA 4HNQA 4Z99A 2GX6A 3GYBA 5GQSA 3HV2A 3SY8A 3N0XA 1JYEA 3O1HB 2B1JA 4WXMA 1E6MA 5DLEA 1GUDA 4RY9A 5JNRA 2HJ9A 3F6CA 1YTUA 4JOQA 3GT7A 3MIZA 5EWMB 1QKKA 5EWMA 1FFWA 1YK0A 4Z0NA 3HO1A 5IULC 4OLBA 1F51E 1ZITA 5JNWA 1DP4A 2WMYA 4LDZA 3RVOA 1SXIA 2R25B 3GA5A 3OO0A 4IMIB 4PE5B 5HQJA 3RVSA 5KQLA 2BGGA 3K4HA 1OXBB 5T7BA 1U2PA 5C5CA 4TMYA 2WJWA 3LFTA 1DJMA 2HQBA 1EWTA 3CU5A 3H5VA 4EVQA 3KSMA 4ETIA 1DBQA 2PL1A 4FB4A 4D6XA 2FQYA 3EJWA 2IPNA 3T6KA 1ABEA 3M9XA 4Z4GA 4RY0A 2PUBA 3CLKA 3LUFA 5TPZA 3CG4A 4D74A 5BR1A 2X7XA 1MVOA 4G0QA 3HK2A 4HYEA 4XARA 3QLTA 3CZ5A 3HJFA 4W5NA 1SD5A 2B4AA 1JH9A 3QEKA 1CHNA 3K9CA 3NHMA 3KHTA 1Z16A 9ABPA 3HCWA 3RH0A 4F12A 4XAQA 2WWVD 1Z2DA 3EGCA 1Z17A 1A04A 2R4QA 2MSKA 4EYKA 1PNRA 4M88A 5IC5A 2XDYA 1WETA 2M98A 1ZESA 1Z2EA 1JFTA 4LE0A 4MLDA 4XLTA 1YK1A 3B2NA 2PUCA 1DRJA 2E4WA 4N0PA 3O21A 1SXGA 4LZLA 2GI4A 2PL9A 3IP9A 5CNIA 4G0PA 3TB6A 4UHKA 2FN8A 3KLNA 1U04A 4QYMA 2FQXA 2LBPA 3IPAA 4JASB 5GOTA 5HSGA 4KVFA 1ZY2A 5IEBA 3H1EA 4EY3A 5BRAA 2ID7A 3CKMA 4XXHA 4L85A 1BAPA 4P98A 4QPJC 4RXMA 3H5OA 3HS3A 1Y1LA 1TM2A 2FTKE 3QLVA 3KG2A 5KC8A 4N76A 3H1GA 1NXVA 1QMPA 1BDIA 3H5TA 4KPYA 1EAYA 4F11A 3KCNA 5CNKA 1H9CA 2WY2D 1VKRA 2FN9A 2MYUA 3KJXA 2MYPA 1JF8A 3URMA 4CBVA 2W42A 1BDJA 4OLAA 3GRCA 8ABPA 1TMYA 3OM0A 3DGFC 4TLMB 3RVKA 4ZPJA 1UDRA 3A3KA 1LBIA 5JS1A 3A0UA 3ILHA 2E4YA 3E3MA 2FEPA 4F06A 3CHYA 3EULA 1KGSA 1ISSA 4H60A 4WXEA 1ZN2A 1D1PA 3NHZA 3NNNA 4D6YA 3CFYA 3H6GA 3MYYA 2R47A 3UK0A 1LK0A 3BREA 3I09A 2CD7A 4ZYLA 1QO0D 1NATA 4N03A 2MSWA 4IF4A 5IUNC 3T38A 4PICA 3VNAA 1Z12A 3CNBA 2FLKA 3D02A 1LJLA 2FVYA 1APBA 1GLGA 2JVKA 4H3KB 2HQRA 2AYXA 1RXIA 4IMJB 3E61A 4MS1B 4MS1A 1XHEA 2YHBA 4RXTA 1M2EA 4WWHA 2GWRA 3LKVA 4UHJA 2QV0A 1USKA 3IDOA 4TN5A 1QQAA 3ROTA 3L6UA 4H3HB 2WRZA 1VPWA 3GBVA 5TQJA 5ABPA 3R0JA 3M6MD 4YLEA 3LUDA 1ZDMA 5JNSA 2GBPA 3LUGA 5F64A 4KQCA 4FE7A 1BVHA 1LBHA 3H6HA 1JX6A 1NXOA 4RKRA 1TVMA 5IX8A 1I3CA 3DLHA 1M5UA 4JAVC 2MYNA 1JHZA 3LUJA 2QVCA 4RV5A 1T34A 1NY5A 3KKEA 5TQ2B 5TQ2A 1YMVA 1FFGA 4OTZA 2H0AA 2L19A 2NZVG 3LMKA 4MLCA 4YS6A 1GCGA 1DRKA 1FSPA 6ABPA 3TMYA 3SG0A 1ZH4A 2PMCA 3L49A 2FEWB 4IGAA 3H75A 2NT4A 1URPA 4JB0A 4F8JA 4S05A 2E4VA 4W5RA 1DCKA 1R8JA 3T8YA 4RK6A 3Q15C 3CG0A 5KQMA 1PHRA 3JVDA 5B3JC 2JCGA 5CHYA 4KK3A 2GKGA 5BRJA 4RK1A 3FDFA 4WZZA 1QO0A 1Z15A 4MRMB 4DN6A 4MRMA 1Z25A 1D4ZA 4ETMA 1EHCA 4LRQA 4WT7A 3EQ2A 3N8IA 3NNDA 5DTEA 3OQOA 1P2FA 3OLYA 1F4VA 4EYGA 3I5AA 4G0OA 2AYZA 5JS2A 1JDNA 2LP4Y 4Q6BA 3QLUA 1NXSA 1EWVA 3LUAA 2PAFA 1NXPA 2JRLA 3CZCA 1FQWA 1Z18A 2FMFA 3NNSA 4RS3A 2F8TA 4MYRA 1ZAYA 3KYIB 1KRWA 1YS6A 2CHFA 4W5TA 1U8TA 1ZVVA 4RK0A 3ILYA 3C97A 5JNVA 3HEBA 5TQ0B 5JNTA 5TQ0A 4N41A 2VYCA 4RXUA 4RK5A 3H5LA 2CHEA 4MQEB 4QICA 5KQGA 4MQEA 2QZJA 1JL3A 1RXEA 5TE9A 2NZUG 3OLWA 3DLBA 1JBEA 3N0RA 2IPLA 5FBHA 1L5YA 4YCSA 2PE5A 4PEVA 4KRFA 2E4XA 4YWHA 3BILA 4NV3A 1XWWA 2QW1A 1ZHHA 2A9PA 3TX6A 5DGCA 3UUGA 3M9WA 5IEJA 3Q7TA 1LJUA 3A10A 1AB6A 3JVIA 4MR7B 1VLZA 3C3KA 3IPCA 2JVIA 4MR7A 2R48A 1PEAA 4EVRA 4YR7A 2RJOA 1XHFA 3EAFA 3GBPA 3JS5A 4MGEA 4E7PA 3HSYA 4PZ0A 2PLNA 1USGA 3EDCA 5DKFA 1JDPA 3F6PA 1NTRA 4HNRA 1KMIY 3UKJA 1P8AA 1K68A 3JPWA 4OATA 3EODA 2FSPA 5KC9A 2QU7A 2OQRA 4LDAA 5CNMA 2WJAA 1M5TA 3N53A 1IIBA 4Z4HA 1MB3A 3OLZA 3NBMA 2HPHA 5TPWB 4DQDA 5TPWA 3SQNA 1BA2A 3JPYA 3D8UA 5KWSA 1DC7A 2Q5CA 1DZ3A 3F7NA 3N0WA 4Z4FA 2A9RA 3OLVA 3RVRA 4YRZA 2RDMA 1U0SY 4MS3B 4O5AA 4LX8A 4MS3A 1MIHA 2ZWMA 1FFSA 3ROFA 3Q9SA 1SXHA 4JB2A 1E2BA 1ZH2A 4W5QA 3LOPA 4S04A 2J48A 2QVGA 1CEYA 1VRVA 2FMHA 3S99A 3O2SB 3HDGA 4GNRA 1KRXA 3BBLA 3Q41A 4Z9BA 2P9HA 3G1WA 2YHAA 1BDHA 2LIVA 3TO5A 4EYOA 3OO1A 2PUEA 4NQRA 4N0QA 4KNYA 4ETNA 4EYQA 4XFKA 4Z4CA 3MM4A 2E4ZA 3DGEC 3Q7RA 2ID9A 1TLFA 2IDMA 5FWXB 5DCLA 5FWXA 1YIOA 3FMVA 1QQBA 1P6UA 5KI6A 2IPMA 2PJUA 4N47A 1C4WA 2HSGA 4ZMSA 3MA0A 2FXIA 3O75A 1GCAA 3G85A 3KS9A 5D2CA 5IUKC 4ZMRA 1GUBA 1A0OA 4EUKA 4EVSA 2L2QA 2N9UA 3HZHA 1NXWA 4RKQA 1D5WA 1TJYA 4MPTA 4E7OA 5HM6A 2QXYA 3QLVC 3CRNA 2OENG 4YO7A 4RY8A 3LUCA 5KQPA 1RNLA 2VUHB 3FFTA 5E3JA 3H5IA 3O2JA 3P9YA 3OMXA 1Z13A 4O1IA 5EWLB 3VNBA 5EWLA 4YP9A 1DC8A 1E6KA 2A9OA 3TD9A 3JTEA 3QX9A 1ZGZA 3KYJB 2V0NA 4B09A 1RZRD 2PUDA 4YV7A 1K66A 3C3MA 3EQZA 5CNJA 4ZJPA 4RWEA 5EWJB 3QK7A 1DCFA 5EWJA 3FFWA 3LTEA 1DG9A 4MQFB 4MQFA 3N75A 4WUTA 1MB0A 3A0RB 1DBPA 1JFVA 3CTPA 3GL9A 4ML3A 2M1ZA 4P1ZA 1DCMA 4W5OA 2H3HA 4NICA 3SAJA 2I6FA 1JWLA 4G97A 1ZGGA 3HXMA 2FMIA 3HM9A 3OQMA 4KQ9A 2PUGA 3CS3A 4GPAA 1C0EA 1PEYA 3HUTA 3RVLA 2NT3A 4IRXA 2QR3A 3F73A 4RSMA 4KFCA 1L5ZA 2JK1A 3BRQA 2P4UA 2NUBA 1OXKB 3LUHA 1PUXA 2MSLA 4EGSA 1QP0A 4F3TA 2VUIB 4KREA 2L17A 4MR9B 3QX8A 3MF4A 4MR9A 3GWGA 1EFAA 4G0ZA 4NCBA 4L4UA 3LKBA 1A2OA 2E4UA 2FW0A 5HKOA 2FEKA 4KK4A 4DADA 3MMNA 3SM9A 1J56A 2IYNA 3IP6A 4NCAA 3C6QA 1YS7A 4RK7A 3I45A 3DBIA 4Q6WA 3QELB 3GV0A 3QELA 2DRIA 1QNLA 1YVUA 4LE1A 5FWYB 4G0MA 4Y9TA 5FWYA 4FE4A 1U2QA 3HUUA 4OG2A 2CWDA 1JLKA 4RDCA 3C3WA 3RQIA 3RVMA 1HEYA 2IKSA 2IPAB 4MR8B 4Q7EA 1D1QA 4MR8A 3FGZA 2JBAB 2IOYA 2L18A 1NXTA 2JBAA 3O2QB 4O1HA 4QYWA 4YGXB 1E6LA 3RVJA 3LUKA 1RZRA 1ABFA 1W9HA 2PKXA 1CYEA 2A9QA 2MYTA 2O20A 4JA2A 4JP1A 3RVNA 4Z4EA 2VK2A 1SRRA 5JNUA 3HDVA 4G0XA 5BQ3A 1DBWA 3IP5A 3N6VA 1MAVA 2PUFA 3RVQA 1NXXA 3RVPA 5C5EA 3OQNA 4KMRA 3I42A 4KV7A 4XASA 3O1IC 5B3JA 3W9SA 4HNSA 2RGYA 3O1JC 4LE2A 6CHYA 4RU1A 5T3YA 1B00A 1M2FA 2JVJA 4Z4IA 1D2AA 4G0YA 4RZSA 3QLUC 2ZAYA 2HQOA 3DZDA 5IBQA 3T95A 3IP7A 3O74A 2FQWA 4MS4B 1RPJA 4MS4A 2FKAA 4Z9AA 5IUJC 1Z26A 1EWKA 1PNTA 2LPMA 4TLLB 1QP7A 1S8NA 4MAAA 3SNKA 3FFXA 2F8SA 3HVRA 2TMYA 7ABPA 2PUAA 3OM1A 1ISRA 1USIA 3Q7SA 2FLWA 2WB4A 3H1FA 1YMUA 5ED4A 1QPZA 3H5WA 3JY6A 4IILA 4RK4A 2RJNA 2KYRA 1JFSA 4G86A 2LUOA
chains in the Genus database with same CATH superfamily
1EFTA 4B74A 1QFMA 1X2BA 3HUDA 1XNHA 3CY6A 4L6AA 4FHZA 2Y1WA 4MP3A 2AYYA 5BN4B 5KHAA 3QEMA 4AS2A 2VT7A 4QBKA 2ZJAA 5EJ2A 5JG7A 1O89A 1HX7A 1W6RA 3P5SA 4FFWA 1IPHA 1JQ3A 2G9NA 3IBGA 2FPPA 4JJKA 1FQKA 4PWYA 3MJ4A 3CRRA 4NQZA 4QREA 2Y1FA 4CQJA 1YNOA 4WZAB 1TM4E 2GXSA 1RABA 3ZDFA 3DEIA 1PR3A 3O4VA 1YZ3A 4LJ7A 3KU4A 2AW5A 1MC4A 1R4NA 4OQDA 4XCVA 5EIBD 2R2GA 1TFUA 1KGDA 1RCFA 2BFBA 3FTCA 4MJLA 4AN0A 4OM8A 3ER8A 3C6YA 8GPBA 2O0JA 5JNRA 2G06A 3IEVA 1FDWA 4NZYA 1YTUA 1GPKA 4N5IX 1F9AA 3T94A 4FS8A 5EQJB 1QKKA 5EWMA 4K5QA 4EKNB 4R84A 1RYNA 3DDZX 3QH4A 3OZDA 4TTSA 2RD2A 1SHUX 1CNEA 3AR5A 1R50A 3FPSA 3MRXA 4NCIA 4KIGA 4R69A 1SC3A 4QYIB 4TQAA 3SS8A 3WHLA 5I9MA 3HCAA 3ZU5A 4O1MA 4YACA 3SEAA 2R25B 2B82A 4KQHA 4LXXA 2PV0A 3GCXA 2QQEA 1JHMA 3I37X 2B9EA 4YDSA 4LBVA 3RDPA 2ZROA 3OHSX 2GZHA 3E8XA 2RH4A 4UCWA 3T7IA 2WG1A 4A73A 5K0EA 3TLMA 4QDJA 4TMYA 1HPLA 3KTAA 2FPRA 2HQBA 3N8GA 3U3JA 1DJMA 3W3AH 2VOEA 1SCKA 3ELUA 5EJGA 5KYYA 3FFBA 4H15A 2VN8A 1QO9A 1R0RE 3GWZA 3I76A 3OFSA 5CMLA 2AC4A 4PFSA 1TA9A 2DPMA 3BIWA 3CZRA 2G8LA 4PPYA 5THXA 3NBFA 4XR9A 3KBBA 3K0FA 4KQXA 4Z4GA 1PEKE 4R8LA 4GPBA 4MGKR 3LT4A 2GAIA 5EGNA 1DC3A 5HRUA 3IODA 4D4GA 3EEOA 4RA9A 2D59A 1Z5WA 4Y6RA 3WNQA 1TO2E 3CVOA 1YCDA 3QLTA 1ZIOA 4MAFA 3AF2A 3H2BA 1FRVA 5DMXA 4AKHA 3KHUA 3EMDA 4JBYA 3NHMA 4NYJQ 1NVMB 1H2WA 4WOKA 3WMXA 3L0DA 4BWVA 4XAQA 3WGKA 3PK0A 5C32A 3BFXA 2G4VA 1OAKA 2DWPA 3KWLA 1JIXA 1L4UA 1SZCA 4W9NA 2ZRFA 4OBEA 2G8NA 1JJAA 1M7HA 2IYOA 4CXMA 4JLVA 4DYHA 1JLRA 2R6DA 3L84A 1FX1A 4L5BA 3QVGA 3T1NA 1Z2EA 1JQKA 4GM1A 4LE0A 5CHEA 3DZIA 4H1UA 1FQOA 2PUCA 3UK7A 1HGXA 5EFOA 4AS1A 1RXCA 2M6KA 4JXXA 4TXLA 3PA6A 3ZD9A 3GXBA 1UFOA 1XLWA 1QCDA 3W5DA 3T9EA 1JJ7A 1C1YA 1BOOA 1E3WB 1G63A 3A1NA 4BKMA 1I94B 4AY2A 1SXJA 2AFHB 2OOSA 4RHYA 4Y1RB 1DTWA 2G5PA 5FFMA 5EHXA 3LGAA 4TXNA 5AVKA 4XVCA 2XUPA 2P9CA 1RD4A 3O0TA 1WLSA 3U3KA 3VAZA 2PBLA 1Y1LA 2FTKE 2OBYA 1FP4B 1U2ZA 2YZMA 1W34A 2PTGA 3GFSA 3ITNA 3NAQA 1LUAA 1KEPA 2OBLA 4R1UA 3OCZA 4CF4A 1UT5A 4EMTA 2WSYB 4Y2XA 2UYHA 1NBME 2ONKA 3L8HA 2LZ0A 4ETWA 4I5IA 1V1MB 2IEIA 2Z2IA 5HCIA 4MZXA 1D1TA 1ZSVA 5AM1A 1VE7A 4XM2A 2BV3A 2ZRJA 3DYVA 3EVGA 3VPAA 3URMA 1EIWA 3B36A 3GRCA 1GADO 4Q7KA 3GH3A 1YVDA 3NHRA 3ECCA 3FX2A 3AIMA 4F3YA 1R4ZA 3PC8C 1IY1A 4QKQA 2QDKA 1KGSA 1EFRA 2KPOA 4GX0A 1C7ZA 3WVNA 4F97A 5CCEA 5LZ7A 2A5GA 2TSYB 3ZHSA 4FKBA 4FGLA 1RRVA 4PHGA 1WWKA 2Q46A 2ZPAA 3CINA 4HLDA 4EJ6A 1ULZA 2QQ5A 1MB4A 2YVAA 1QO0D 3PRJA 4JLDA 2CNWD 4K8RB 4UUPA 1FVHA 3RBXA 1KJIA 3EH2A 3PGJA 4PICA 1VL2A 4ESHA 3L4EA 5JMWA 1I4EB 4JLPA 4RMGA 4BFVA 4BP8A 1QS0B 1T3HA 4G8CA 4N39A 4RPIA 5GONF 3OG9A 3ZJVA 3RU2A 4QEKA 2XOEA 1H2XA 2MU1A 3TNYA 5M04A 1X1RA 2VTDA 4D82A 3TTYA 2EW8A 3D0OA 4OOEA 1VCMA 4IR7A 4QT0A 4RAOA 2B1QA 1FOEB 3ISVA 2C58A 3R74A 1SBYA 1UOEA 3BRCA 4UHJA 1IB0A 4XGIA 1ZFNA 1O8CA 4NF2A 3W7AA 4OHVA 2J9YB 3CO0S 1QLWA 3KEQA 2Z4RA 3JQAB 1R5OA 3EARA 4KSBA 3GRAA 2DHRA 4LZJA 2XY4A 2ZTLA 3LUGA 5DISB 3ZZMA 2O3UA 4HDMA 4QEZA 5IWCA 1Q95A 2ZI5A 2FJ0A 1TVMA 3HKCA 1I3CA 1J5EB 2NW6A 3DLHA 1F8XA 1L7QA 4JAVC 1IM8A 1YDHA 1YUBA 5DM60 4DGQA 1GOTA 2BHTA 1IHXA 1NPYA 5AW3A 3LXRA 3PFWO 2WD7B 3PHCA 4IIFA 3LMKA 1L7EA 4IXTA 2BEWA 1DRKA 1GKLA 4MLCA 3QHQA 6ABPA 1HE1C 4WINA 3V7NA 1US8B 5ICFA 2A0UA 1KJJA 4QXMA 4IS2A 3ORFA 3IXLA 3L49A 1UJ4A 1Y8AA 3FCOA 1BW9B 3M1IA 1C3JA 1B6RA 1PR9A 1YKGA 3O3NB 2BHRA 3QOXA 5AJHA 1S2IA 3AF3A 3DULA 3JVDA 1Q20A 4K9SA 4CLRB 3GGOA 3E7PA 2D7DA 1UFVA 4KQ2A 1EUDB 1XZAA 4V03A 3SFTA 4MV9A 4HNVA 4C89A 4D46A 2IGBA 5E3HA 3NNDA 4YMIA 1M74A 1UADA 2FWNA 2OZKA 4WZBA 3L6BA 4XPIB 1DEXA 5T4BA 4BIMA 4KXMA 3T5DA 1OX6A 3E23A 3KUUA 4DA4A 3IPLA 2FJPA 4EL0A 2I1QA 1W73A 1O6BA 1QLJA 4EB6A 5AD1A 2B69A 1NXPA 1YS1X 3D6UA 3I9MA 2C5LA 3P27A 4I08A 2ZTHA 3H0CA 3IMCA 1PIWA 4U02A 1W1UA 4LOKA 1DEAA 3DNPA 4OO3A 4ZZ2A 1AU9A 3U4GA 3G1UA 5KYWB 1UMCA 5EMNA 2ZBFA 1ZVVA 2YHIA 5I7HA 1LBQA 3OIWA 3P32A 3PS9A 3HE3A 3R44A 4L2IB 4WECA 1KYVA 2QT9A 2OXTA 3BQMB 3WWZA 2I2FA 4DVGA 3OF5A 4Q9JA 2WNHA 2P9QA 5BNWA 5TSDA 4J43A 4HV4A 4FZVA 2GZDA 3BAFA 5AW9A 4I6GA 5MF6A 1NTOA 2FSGA 1YB4A 5TRTA 1XCOA 2ZSJA 3EC7A 3MTQA 4M1YA 2HK9A 3E3OA 2CN1A 3ETLA 2Z6VA 3ICOA 4ZP1A 4B9AA 1P91A 3OQOA 4YWHA 1U6KA 3AVPA 1TJ5A 4H0NA 1Y8CA 1A9YA 2J6CA 3LOUA 4U63A 1X86B 4YCDA 3G59A 2V0CA 1SIOA 4PC2A 3TL3A 5JADA 1U0BB 3LK6A 4EQ6A 2XB4A 3WGLA 2A14A 2F3RA 2JFYA 2YMPA 1Y9EA 2CMFA 1S2NA 4MICA 1VLMA 5EXEA 1J39A 3PC6A 3NLLA 3SHTA 4HQKA 1BG6A 4C3VA 1P2VA 1OWPA 2HU8A 5BV0A 4F91B 1Y6FA 1TC1A 4NMXB 4I1PA 1IJBA 3KT6A 1IWPB 1VDMA 1KMMA 2OE2A 1J8YF 1BMFA 1VG0B 2RKWA 1R0BA 3L8GA 4JL8A 4LDAA 4RCZA 1LC0A 2JF0A 2P2ZA 4IJKA 4KAJA 1V7CA 4G8BA 4XGNA 4DLTA 5ADHA 1NC1A 1ES9A 1N2IA 4MHTA 3GI1A 4X6YA 3IR5A 4LC0A 2VT6A 3HUFA 1W36D 3EMKA 3DOHA 4M9QA 3TGPA 4F60A 1T36A 4BFTA 1RP1A 2D2IA 3STUA 1NR7A 3BXZA 1EK1A 2GF2A 2Y0BA 1Z39A 3KTFA 1IY0A 1T5DX 3E9ZA 3MWDB 4REQA 4X3OA 4CVNA 2SBTA 1ZD4A 3DHYA 3UBMA 4QJ3A 1HMYA 1NSFA 1NLMA 1T9GS 1O03A 1WB4A 1WPGA 1DAMA 2R8XA 3NR2A 1L2TA 2AT1A 1AN9A 3NWOA 3G13A 3T5AA 1U7XA 3ZDCA 5I6DA 3LCVB 2AG8A 2HXSA 2NSDA 3CZPA 1E2BA 2A0KA 3VBEA 1E5QA 2Q3BA 3BK1A 1OC4A 3PUHA 3GJ8A 4WLFA 1YCHA 2GJAA 1YHZA 2YW2A 3KUKA 4JK3A 1W2GA 4BV9A 2VYFA 3I9KA 2H2DA 3RK1A 1AM4D 4QUDA 5FB3A 4ENRA 5I7EA 1SUCA 2B99A 3S2EA 4Z4CA 5FUMA 3TLKA 3RFUA 5EZSA 4EI7A 4B7CA 4ZOEA 5KTOA 1TEZA 1W96A 3ZDZB 1CJBA 2J7PD 3KDSE 1YIOA 5KTSA 5BSEA 1HDEA 1SAYA 1X1DA 2Y68A 2CV2A 2II6A 2Q9UA 2QM0A 3Q85A 1IULA 3PX3A 4BU0A 5L3RA 3MA0A 1GRRA 5BWOA 3LY7A 3WBFA 5IUKC 3QEJA 3IC5A 3MGCA 4EVSA 4AQ7A 2VYNA 1U3TA 1EVJA 2L2QA 3PI7A 2GLTA 3IUSA 4OYRA 4MPRA 1T5HX 4PVDA 2EJVA 3UW3A 3RLFA 3F9IA 3KJGA 2G9VA 4G5HA 3EXIB 1R3UA 3DOJA 3SXPA 4OREX 4IDEA 2ACVA 1JPJA 1LFDB 1S2LA 2XAAA 3SZOA 2JJ8A 3CZQA 2FZ4A 3O2JA 3P9YA 3PYLA 2RSLA 3OMXA 4HQFA 4D9HA 4YJGA 3A4MA 5JYBA 3NYQA 2FOIA 2AL7A 1O54A 2EFYA 3NPMA 5ARCA 5IAJA 5JW6A 5TARA 2PLFA 1PUIA 2IA5A 3A9TA 4RVUA 3KYJB 3KPJA 1RHJA 1ZUD1 4MOWA 4DR4B 1SCIA 3HVUA 2PO5A 2YXNA 5EZYF 2PX0A 4YRPA 4CKEA 3JQ8B 5ALNA 1CT9A 3OTWA 4IQ0A 4HGRA 4M46A 4E51A 4IP0A 1JFVA 1QGUB 3NQ41 4FCWA 3LUBA 4ML3A 4U7WA 1ODCA 1ZVJA 3KUCA 1G38A 4TTPA 1UDWA 3LFUA 4I66A 4A16A 2FMIA 3IOCA 7REQB 4YLGA 1PGJA 2JLBA 4RORA 4YCMA 3OH8A 5CDGA 3CUWA 2J30A 1U2DC 3NHLA 1MEEA 3FNRA 4EG0A 2ACWA 4I5EA 5KSZA 2BZ0A 2I5PO 4GDFA 1JVSA 4D4LA 1OXKB 3R2JA 1T2VA 2WG0A 4RF5A 3ZD8A 1Z2PX 4F3TA 2YYSA 1TIKA 2QKYA 3DTVD 3RJ9A 1W88A 1FYXA 1DEKA 1TOAA 1CP3A 4BNHA 3A6GA 2VSYA 5GM1A 3ZBTA 1I5RA 1Q83A 1A82A 4ZQGA 3PDHA 3ESRA 1SCNE 1O2DA 4RHEA 2D74A 4CM8A 3AX6A 4NECA 2HA7A 4Z2AA 1MAAA 2ERXA 4LC1A 3C15C 2QX4A 4TLEA 1U3DA 2QPAA 5LQRA 4CCSA 1HMPA 4E1AA 2P5SA 3LQKA 4BNVA 3VC7A 1RLTA 4PZPA 5FBRB 1VYVA 1Q7TA 2OO5C 4FE4A 4UQOA 1V3TA 1TYAE 1SHZA 2PDAA 4RDCA 3JAMA 1OYWA 4CFZA 5FAKA 1A4RA 2DUMA 4QASA 3Q6MA 3KVVA 3GNQA 3BORA 3V1LA 1UZNA 4XSHA 4CDRA 1UC9A 4TRNA 3AKEA 4A36A 4ZHQB 3NDIA 1J06A 1DO8A 5IT9A 5COAA 1HO3A 1EVIA 2JI6A 2W8BA 1SEPA 3SJCA 4DBLC 1ULSA 1W0KA 1PD1A 2IRWA 3C6MA 4N3CA 4D8XA 5BW8A 3S1SA 16PKA 1EK2A 1Z5VA 1I6MA 4KTVE 2H3EA 1P9WA 4NFSA 2I03A 2ZAIA 2CL0X 5I47A 1K8YB 2PS1A 4XASA 5ERXA 4C6RA 1KK1A 3BMQB 5IJ0B 1YZKA 4OQEA 3UKDA 4YUXA 4L5YA 1L4EA 1LK7A 5LZ2A 3G5LA 3H3FA 3CR3C 2CDBA 2I2BA 4U9IS 3T0GA 2JVJA 3TTXA 4BKRA 4GBGA 4EHJA 1J20A 5JATA 1ZM2A 4M49A 3CVWA 5F9HA 1GJRA 5I7RA 2OCPA 4A26A 5K20A 2ZAYA 2X23A 3E6AA 4LNUA 4U5QA 4DG8A 4MS4B 4MUBA 4FI3C 2EYUA 3ZJ4A 4YVFA 1PNTA 3OP1A 5FD8A 3K73O 4KN5A 1QP7A 3PQ6A 2ACKA 3HRHA 3R40A 1JA0A 2G80A 1Z06A 1RKVA 3F3SA 3CX3A 4G07A 4JBNA 4J2TA 4TMTA 1G55A 4MRPA 3W1VA 3VR3D 1VE3A 4LYDA 2IU6A 1L1QA 2YWDA 4E12A 3CR7A 2VHJA 3GAZA 3ZHBA 4ZYTA 1Y8QB 1BU8A 4J76A 5JT1A 3JZIA 3KELA 2LUOA 2ZR8A 3FPKA 3NUZA 2ZIXA 5C9ZA 2DBZA 2QDXA 3GF4A 1COWA 4OI4A 5J58A 3FNFA 3BL6A 4Y6GB 3R7LA 3AHCA 3ZHQA 3KHKA 3QPBA 2RHDA 5F4ZA 5LQMA 5BXQC 3B51X 1Q3HA 1BNCA 4QX6A 1PL6A 2YY6A 1TECE 3HKBB 4GM4A 3ZVLA 1VRCA 1ZINA 2WIFA 2GQ0A 1EKXA 2HCTA 3P0RA 4RETA 3IEUA 4ZEXA 3SZLA 1FTGA 1HG0A 1X7DA 3KDAA 3TQHA 3VZBA 2R6AA 4YMUA 1MXHA 3W5AA 3LX6A 1M66A 2PZLA 3I1YA 3E5MA 4QLOA 1E6MA 3VPCA 5TLSA 3T7EA 1QU2A 2YS7A 1MJFA 1CG6A 5E1MA 3TIXB 5D51S 3AKCA 1VFPA 4RM3A 1XK7A 4DRXA 3FAKA 2IYTA 3IDAA 5I9LA 1ONOA 2G1UA 2VPTA 2DQZA 4ZARA 5G02A 1FUYB 1JMYA 1TW2A 3IELA 3K0SA 3T1TA 2RK6A 4RD3A 1HSZA 2G77B 4DIMA 2QJOA 4A5SA 3FUWA 5AFSA 4W7HA 1KEEA 3AY0A 5REQA 3WMEA 1J21A 3RKUA 3IEMA 1DEHA 3KE8A 2QIOA 3M6LA 2XYRA 2I7XA 4GRIA 5LZ8A 1W44A 3UH1A 2NP6A 1PWYE 2GOYA 2PD3A 3D4NA 2ZYAA 2WJWA 2H4FA 1UKCA 2RIRA 3PJRA 1EP9A 4EVQA 2PZMA 4BQOA 1ACMA 1XOIA 1DBQA 1RM4A 2DQKA 2WSMA 5C1OA 1YQGA 4NCHA 2WA2A 3GBSA 1U81A 3OSZA 2DZDA 4BTLA 3GQBB 2NMVA 5DH9A 5EMLA 1Z4PX 2WJ3A 3CLKA 1JQ5A 3PFIA 3BWCA 4DUYB 3AIIA 4G8DA 4X8LA 1FFYA 3DAFA 3QU9A 2OBXA 5DYWA 5H3CA 2J0EA 3TRHA 2ZZMA 1W5FA 1B0AA 2IYWA 1MVOA 3B9BA 1E62A 4G0QA 4ZQCB 5A05A 3RF7A 3D64A 1QE3A 3LT2A 3QW2A 4R8VA 5HIMA 1U8UA 3ANMA 2XB9A 2Q3LA 1Q1EA 3SZ3A 4WFJA 3RYCB 5DPMA 2M6LA 2OHFA 4IHJA 3T61A 3WWEA 1NRJB 3PV0A 2JG3A 2H2FA 4ZAFA 4AN4A 2XE4A 2EJUA 1LZKA 4GR4A 3ZD7A 2ZIGA 4EYKA 3T5PA 1WXXA 1UP4A 4CL3A 1WETA 3RODA 3FFAA 4C07A 3VI4B 2VNAA 3ZV4A 2P7HA 3E5NA 3UHJA 4R01A 1M6VA 2Q50A 2RCNA 3FCXA 2QLFA 3AL3A 4FYPA 1H9AA 1Z37A 2PL9A 3KQPA 4DSZA 4G0PA 5HW0A 1FW8A 3H1TA 4JASB 2X0EA 2ZETA 5BWLA 2A9FA 2HHCA 3T54A 4KVFA 5BUQA 4IRUB 3WYFA 4IKOA 1HT2E 2G7MC 1ZRMA 3WTBA 1VSVA 1YT5A 2G76A 1D4FA 3OE7A 5IANA 3EWNA 4WDQA 3ZWYA 2ILTA 3AGPA 4D99A 4C3UA 4RTMA 1NAIA 4XZ3A 2YHSA 3SNKA 5EJAA 5DNAA 1NV9A 4UM9D 4WSOA 1WMAA 4ZRDA 2D5AA 2QTTA 1EX7A 3KCNA 4KE9A 1H9CA 4X6LA 4J0CA 2GT1A 5KPDA 3LRPA 1RPTA 4P3OA 3PD1A 3S2ZA 4EA9A 1N2ZA 2FZ5A 1F4PA 3WBBA 2HJRA 3NH6A 4IFTA 1JV2B 8ABPA 1PGQA 3I2HA 4E14A 5IDQA 5JXGA 3KLPX 2B5OA 3RVKA 3EZ9A 2R6CA 3THSA 2ZQZA 1N6KA 2PZKA 1J8QA 1UPXA 2HRBA 4YRJA 3UC9A 3MMPA 3U56A 3F6RA 5CVDA 1SUFA 1KC3A 1ZN2A 2HDOA 2W48A 3NDJA 1GXSA 1A27A 4EG4A 3MYYA 4OB8A 3QLJA 2VJCA 4CI9A 5G1OA 5H02A 1HYGA 1NYTA 1UC4B 2CD7A 2IZ6A 4ARSA 3EE6A 2VVTA 5J4HA 3Q2IA 4S2EA 1NX6A 1OA0A 1LJLA 1ZD9A 2CNBA 3KXKA 4Z7OB 5IASA 5KYXA 2GM4A 4BMXA 4J1TC 2YJZA 4BLOA 3MLEA 3FPBA 3FHCB 3VHXB 2HQRA 1OOEA 4BQFA 3IYLW 3MHTA 2Q2NA 4I8DA 4KMOA 3GFQA 1TEHA 4Q1EA 2EX4A 3T3HA 4M37A 3NIGB 4RXTA 4EP1A 2O8DA 3AJAA 2WF8A 4G5GA 1JGTA 4P4NA 4CKBB 2Y76A 2Y27A 4FC6A 3LQFA 4L57A 2V7BA 3LBIA 2I54A 4NZNA 5EXTA 3RROA 3ZGLA 2VT3A 1HH4A 3GPIA 3W2HA 1SC6A 1UXJA 3PDIB 4C3ZA 3LYAA 1G2PA 1BXRB 2DPLA 3DFUA 5JAHA 4DT1B 5F64A 3G7SA 4QGSA 4RC9A 3L7BA 5AI8A 1X0XA 4FKZA 5J4LA 1NXOA 1UFRA 3W77A 4KR6A 3DBHB 1LSUA 2HMWA 3IAM1 2VWGA 3ZY2A 2DFNA 3A9WA 3FNHA 4M0PA 5KTMA 1XXHE 3GAMA 5KOYA 5FDFA 1U5AA 2YNMC 2PK3A 1V6CA 3B78A 3DDNA 5TQ2A 4P35A 1TGVA 2JEZA 3IGFA 5BVHA 4B4KA 4CHTA 2NZVG 2JD0A 4WQMA 2VZ0A 1NVGA 2OAGA 1DELA 3T5GA 3EXG1 1VYTA 2O8FB 1NMSA 2VEOA 2ZIZA 4HB0A 1RIIA 4MQ5A 4JI7B 4OLHA 4HAWA 4IIVA 1QCZA 5CPFA 4RTOA 1N0HA 1FBTA 1Z15A 2VJOA 1ZA2A 4K26A 1OBOA 1FYVA 5CFMA 3KB2A 5IAKA 3THOA 5A4KA 3ONWA 1E4EA 4AP5A 1ZWKA 3WLFA 3OIYA 4F4UA 5J40A 4BNLA 4MKGA 3KQKA 1WLYA 1X70A 1TB4A 2JH8A 1N8TA 1N7IA 3QLUA 4Q6BA 1ICEA 1JKMA 1RAFA 3LO8A 4KJXA 5JFTA 3LUAA 3ELDA 2PAFA 2IW3A 1V26A 2HFJA 4FFBB 4MEBA 4YJ2B 4DLVA 1J00A 2J1LA 1AVTA 1PJBA 2IYEA 3TF5A 2IL1A 4JC0A 4URXR 2BGRA 1YAJA 2I2CA 3DAYA 2CT8A 1V43A 4GSKA 3CZAA 2LDBA 2OVBA 1N7JA 1LV7A 1XZHA 1DU4A 2O2SA 4X20B 3RHZA 3TW0A 3FMGA 1ZUNA 4UJ3A 3VPGA 3WV4A 4DC0A 3E2MA 1IIRA 1CUDA 3H5LA 1UJCA 4QICA 3RRJA 4M22A 2KBEA 3HKDA 3CCFA 5D5HA 2VQ3A 4MCJA 1PKEA 1P19A 4E5SA 2NZXA 3FYUB 3K35A 1HE3A 1YA8A 5IKOA 4JDPA 2PE5A 1C80A 1TNDA 3L0BA 3NP9A 1DKNA 2NSHA 2QXUA 1YGYA 2NU9A 3FPEA 3Q87B 3J81k 1MLDA 1RTTA 3HB1A 5ALSA 2Y9PB 3ZDXB 3OD5A 1MOQA 2NV2B 3KPVA 4XEHA 4BIIA 3PE3A 2JCYA 4PBRA 2CBZA 4L0DA 4Q19A 4WASA 3UBTA 1AB6A 1IN5A 2OUIA 3VVLA 4RKFA 1V8FA 3E2IA 4MUAA 1UXIA 2L0XA 1GZ4A 1A9QA 1AK9A 1YZUA 2FFJA 4OXKA 4IQGA 4YT5A 2ETVA 2DUWA 4C3OB 5LP1A 5DEIA 5E4JA 4IM7A 3EC1A 4MW6A 2CLSA 2EP7A 3D8TA 3HB0A 2GPYA 3OIVA 1Z75A 2PGLA 1ESDA 1IZZA 3EODA 1VI2A 1A8HA 1JEQB 3V2HA 1SKMA 3JU3A 3QUQA 2WJAA 3LF1A 4RH0A 4Q00A 5A4JA 3FZEA 1U5CA 1DAHA 4TYNA 1G66A 1MB3A 1AA9A 2XAUA 2JLUA 4KOAA 2Y0CA 1P2TA 5TPWB 1WF6A 3G2IA 4HMPA 4PNPA 5B1SA 3UWKA 1OT5A 2JFUA 3R3SA 3TM4A 3OOEA 4LF6B 4M60A 4EA6A 1OASA 2C1EA 4LRUA 5U9CA 4ERNA 1HRDA 4YAIA 1MQ8B 1DUVG 2GCIA 2O23A 3PNYA 1M34B 5GVRA 4FONA 4BAZA 4Q3EA 1G5TA 1GYPA 4PLPA 3IT3A 3KYCB 2ZWMA 1FFSA 2J33A 2IGTA 2WZQA 5E3IA 4XR4A 5FQNA 3B1JA 1H0RA 4NBTA 1FSGA 4P4SB 2PSSA 4NC9A 4UHHA 4URFA 2X8LA 1ZH2A 1AUOA 1QGYA 1NU6A 2ZRLA 1G3QA 2QROA 1U0LA 4II7A 1I9GA 1XTUA 2ZB4A 3G7NA 3CRVA 2F17A 4UDOA 2D8MA 2BE9A 2XNDD 3GLIE 3C85A 4K6CA 2YV3A 3NV7A 4BTVA 4ZK6A 4EF4A 5KDLA 3RVBA 3V7UA 3WJAA 4UVIA 4NJOA 1GFWA 2ZRMA 1T3TA 2I4MA 1SBZA 3WLLA 3ORQA 1YZFA 2D7JA 2YWEA 1UBSB 3OWOA 4LHEA 1NU8A 1QHIA 1YR2A 4MNTA 5FWXA 2P4HX 5KI6A 4EB0A 1VJTA 4LY0A 2I66A 4N47A 2ZBEA 4WOCA 1NVTA 1OVGA 4PHTA 2GBIA 3RYIA 3BRWA 3FM9A 3OQIB 4DV5B 2PR7A 4RENA 1H6CA 3AQIA 4X91A 4I3HA 3TLYA 4EUEA 5KEIA 1M1NB 3W3AA 5JY1A 1UBLS 5DGIA 1YOVB 3ESZA 3IAM6 2XTZA 1C8LA 4CNBA 5ECDA 4CV2A 2XXAB 4E7PA 2R44A 1YRYE 2JI9A 3N2EA 3C3JA 4JQYA 5AXAA 4J7CA 4ZZ3A 1W36B 1S4QA 2G25A 2GAFA 1TU0A 2V4ZA 4B71A 3GP8A 4L02A 3WLOA 4HGPA 2GHRA 2HGSA 3FYDA 3KD2A 3CWQA 4DNFA 2R5FA 5A4AA 1TL7C 3MTEA 1C7IA 4N3BA 2QYOA 3DDCA 4Y2UA 4F8YA 1JLSA 4KQJA 4AURA 3T0IA 4DJJA 1TADA 3X1DA 3HCOA 1N2HA 4OJTA 1CB0A 2F9LA 3QX9A 2PRYA 1I2ZA 4PC3A 3VH2A 5ARBA 3CH6A 4HPJB 2I1VB 1PTKA 3I6BA 1YQ9A 5KZMB 4MO9A 1KZ9A 3V8BA 4WV3A 1JHRA 2RHBA 1H6DA 3CNQS 3CUVA 4E5MA 5C7IO 4XLLA 3MT7A 4PYIA 3OKCA 4WJKB 2F43B 4X54A 5I9SA 4ZVOA 1V3UA 1DIAA 1EINA 1GGFA 4QHTA 4NICA 2C82A 2ZJBA 1KYXA 1G20E 1GDDA 1UK6A 1ZGGA 2MWMA 2O1XA 1V47A 3JATB 4JJEA 1CIVA 1NDHA 2CV1A 3BH6A 1XMVA 1E9VA 2YFQA 1PWEA 3SJBA 2C4NA 4A8PA 7GPBA 1ACLA 4YV2A 1E1KA 4OHUA 2H2IA 3H9GA 4B3MB 4TVKA 4CM4A 1EK0A 4MWGA 1HBJA 2BCGY 3N8KA 4NFYA 3MF4A 4MR9A 2OD9A 1ADJA 2RGNC 2I4LA 1WCIB 5KAMA 2VRWA 3BE5A 2C9YA 2VHEA 3C39A 3GMIA 4HB2A 3VH3A 4NVRA 3X44A 5JD4A 4DV2B 1IG0A 4KK4A 4UEWA 1N6NA 1F1BA 2VF5X 5B64A 2Q8NA 4HDRB 2BBTA 3UOAB 3EXG2 2NUAB 3BCUA 3CISA 4GIBA 4ROTA 4ENVA 4NZMA 3G6WA 4JWTA 4PZCA 2UXCB 5DFAA 1XMJA 4DNPA 4BE9A 1Z62A 1YVUA 3W78A 1SJ9A 5L53A 4D9FA 1U2QA 4OG2A 2Z43A 4BO2A 1YASA 3RQIA 3GEBA 3ZW7A 1Q7EA 2Z9BA 4L4YA 1XPOA 3JD4A 4S24A 1AGPA 1C3XA 1V3QE 3VX4A 5IAOA 1EJ2A 1IHPA 2PZJA 1R37A 3HFGA 3OIDA 2BKAA 1ESZA 3T7JA 4RZHA 5F9FA 2CL7X 3I04M 4HQOA 5J1SB 4C04A 4U8GA 2I6XA 1CY7A 4WKNA 1DDGA 2HK7A 1GZUA 3LCJA 3LI2A 4JA2A 4OXNA 2BTOA 3EHEA 3KXIA 5EUQB 3IS3A 1YDWA 1OXSC 2FMXA 2FN3A 4MVJH 2ODAA 3RVQA 1C3OA 3L5OA 4IIUA 1AJEA 1WMSA 2VDQB 4NJEA 2AMVA 3GEDA 2VYVD 3EGEA 4TT3D 3E9CA 5ELXA 2PG3A 4WBSA 1XZIA 4NV1A 5CM9C 4ZAVA 2XKAA 3E9MA 5A1JA 1IH8A 5FHQA 4QBFA 2FMTA 4FNAA 4RGBA 1XB2A 1P9LA 2ID8A 3CLRD 3GU3A 3EUWA 2C9CA 4JGGA 1WUKS 2C2OA 1N1GA 3DTVB 4H3SA 3JSAA 1G0OA 4X1YB 2C07A 5SZHB 1A9PA 5IAAA 3ZXIA 3BHJA 2R5WA 3DXYA 2ORVA 2NGRA 3I9V6 1OAOA 4JBXA 4JYBA 1XDZA 3R8FA 1EWKA 3TDKA 4ZHQF 1U11A 1WV1A 3AUYA 3GZ4A 5K4AA 1MBZA 3L02A 4CMIA 1KARA 2GAJA 3BTSA 3A8TA 3G8AA 4X6UA 4QRHA 1U8FO 4GUAA 4IQ8A 2RCYA 1ML3A 4BMCA 4OHMA 3IAXA 1YMUA 1Z0KA 3FN4A 3FTPA 1EIZA 3TNDA 1NOIA 4D43A 1QPZA 2ZEJA 3BA6A 4B48A 4G01B 3VU9B 3RUIA 1E2FA 1VHTA 1KEZA 5INTA 1MR3F 3G8DA 3P19A 5LJIA 1JYFA 3R5KA 3QUBA 3HDQA 3VKGA 1RJGA 2RH9B 1EX6A 3FNGA 2BP7B 1QP4A 5MN5A 3GZNB 4LOHA 4P84A 4KR7A 1AB5A 2HU7A 1A4UA 1J33A 1FLAA 5KQRA 1XBTA 1DJOA 1YOBA 2CLLB 1CUBA 1VI5A 2XTAA 1S0UA 3GNLA 4GQAA 4MW0A 3K8YA 3SC2A 3AF0A 4AY4A 2QL5A 3P96A 2UKDA 2HMSA 2I9PA 3DKIA 4YECA 2B1JA 4ZZIA 2EJCA 2AR7A 1EQUA 3WQQA 4E94A 4Z53A 3QWHA 2G1AA 3FTQA 2BFEB 2BGKA 4E6EA 3LVQE 3REQA 2HJ9A 4JV5B 4Q1FA 5D5PA 5DGHA 1I13A 1QRRA 1JPVA 1RM0A 2J6IA 3AEQB 5FPPA 4LCJA 4N5DA 1AUXA 2V3WA 3MBOA 3GAFA 5AI0A 3PXUA 4UREA 3ZKWB 5B3KA 2XRMA 3CKKA 2EQBA 2RI0A 1ONBA 3GEGA 4R98A 4H1HA 1YV9A 4LF9B 4HLCA 1VMKA 5C5CA 1AO0A 2AZ4A 3H5VA 3NTVA 3KSMA 4ILKA 4LGVA 1LZLA 2OORC 4NBRA 4Y18A 5H0IA 2VXOA 3UJ7A 1WUTA 2R66A 4R2XA 3TOVA 3A2KA 1BXGA 1RE0A 4R9SA 4UUNA 4Y0AA 2QA5A 1O3YA 4JI6B 1ZEMA 5JJIA 5ALOA 1BEUB 1NY6A 4EELA 4RTPA 4RVSA 3KJEA 2X6RA 4RZ3A 5BYJA 3NHKA 1SVOA 1P7ZA 5BR1A 3CW2A 2HPZA 4R2HA 1MAHA 4NU8X 3ZHXA 2ZI6A 4IO1A 1WZCA 2DT5A 4IIEA 1T9KA 3JAWB 2ZUCA 4RPGA 3T3NA 2AVNA 2YWGA 1TFRA 1YVEI 1UH5A 4OSEA 2JLWA 5JSFA 4JSTA 1IOVA 4KU4A 5ARDA 1YZHA 4L9RA 4P08A 3UOGA 4YMHA 1WW2A 1J8VA 3F9CA 1NI4A 3N2KA 4GOXA 1JNXX 1Z08A 3LPDA 1YBVA 4LF5B 2HOQA 1PNRA 1DFIA 1L8AA 1EESA 1NUSA 2XDYA 1JG1A 4WOPA 1UKAA 1V41E 4I1VA 5BR8B 4M9XA 1ZZGA 3S2GA 3B2NA 4HO1X 3N8DA 5BW5A 3J81A 1SH7A 4K9NA 2GDJA 3WJ7A 2QLBA 3BC1A 2G4LA 1JDUA 2GETA 2R65A 3B3QA 5L3QB 2IXTA 4F3RA 2FN8A 2HLPA 2C7OA 4CTOA 3IPAA 1GNLA 1YUMA 2WJIA 1P4GA 4I9GA 1DL5A 4RCYA 4UULA 4Q9KA 4AYWA 3H1EA 4QVKA 5EJFA 4HWKA 3K9HA 4FFOA 4N7BA 4KVGA 3NVKI 3IQZA 5HKLA 1YKSA 4WCFB 4YMTA 4GT1A 1KOFA 3RCBA 3OE5A 1GZ5A 4LGCA 1N6OA 1STOA 4C88A 5HJ5A 3H1GA 3AEXA 3PFNA 4QUAA 3NANA 4LJSA 4WOJA 3DMYA 4CR8A 4ZC8A 1BDIA 1OBFO 4ZEVA 4GHWA 3LA8A 5AM0A 3L40A 5BQFA 2P4SA 4EG5A 1A9RA 4YONB 1LW6E 2EFCB 2FWMX 1DARA 2X4GA 2FN9A 3GFVA 3G2JA 2ODPA 4OMCA 3CLVA 1CY4A 2FUKA 2AK3A 3G2QA 2RHLA 3PSHA 4QSMA 3SKYA 1O77A 1RYBA 5LVAA 4ONEA 2ONJA 3UT6A 2Y71A 1TZMA 5JVDB 1YRBA 3NPAA 3QXSA 2NUTB 4K9DA 3BTOA 1BMQA 1G5QA 1NXQA 4NK5A 2H9YA 4NG5A 4AMVA 2X9LA 3B6ZA 2I87A 2ZYWX 4RMNA 4MWBA 3WKBA 4G5SA 1CRQA 1ZKMA 2F1HA 2W6QA 3MEQA 3BREA 1X7ZB 1Z4LA 1YQEA 3NBZC 2IZ5A 4LQLA 1VE5A 3ED5A 3DZBA 4Z1OA 4WLNA 2BEJA 5CB4F 3ZWCA 5C0OE 4J91A 4AMZA 1GA1A 1N6LA 5AVRA 2VH2A 2V3CC 3P2KA 1APBA 2X7HA 1KYZA 1Z5OA 3E27A 4H3KB 4AJKA 4J7XA 2GCGA 1E9CA 2MCFA 2EQAA 1EHIA 1GCIA 4IXDA 5IN4A 1WAMA 1LRKA 3FGOA 4UJ5A 4U2BA 4BV8A 3WLTA 3HB5X 3AEKA 1S7GA 1EUQA 3UXEA 3NKFA 4PRLA 2NYVA 1BGXT 4TL9A 4GXRA 4AF8A 3KQSA 5FWNA 1IZ0A 2HQSA 2NNWB 3P71T 4S12A 4GP9A 5EJIA 3WYNA 5K3FA 4FE7A 1H0SA 4UBOA 4RFVA 4M0EA 3PE6A 4TV8A 4UM9B 5M5BA 2PEYA 3O93A 2J9FA 2GEJA 5B3LA 4D0SA 1JHZA 1MG5A 4OX9Y 3SQXA 1T8TA 3ZWQA 1TCVA 1XQ1A 1KJNA 5B6JA 2V0GA 2HJHA 2ZQ5A 4INZA 3TH5A 3BDAA 2A1UB 5EZQA 3T4EA 3WR5A 2H65A 4OLJA 1XKXA 2QUIA 4DV0B 2I9KA 4B3RB 5KVSA 1H1LA 3SG0A 2ZREA 5F2OA 2BMDA 2NT4A 2H1FA 3K94A 1EM8B 2CL6X 3OJFA 3T34A 1O4WA 2ZI4A 5D86A 3R9XA 2P5YA 2ZTSA 1M73E 1ZAKA 3B1VA 3O8BA 3ZU2A 5B3JC 5KQMA 3NATA 2PT6A 2ZU0C 1ZCFA 2GKGA 5G0WA 4RK1A 4S0ZA 4Z2YA 5KYYB 3VR3A 1L0BA 3AXTA 3CXUA 2BYTA 3BEDA 3G2PA 4J0QA 3QFTA 3IL2A 3EOZA 121PA 4HUJA 1R15A 3BXFA 4E3ZA 4BKOA 1DB3A 3A04A 3I5AA 5E6SA 3K0FB 4ATNA 1GNPA 3O1LA 1CJKC 3A2NA 4WAUA 2AG0A 3A3NA 3Q1LA 5JWRA 4NONA 1JDNA 2IDZA 3WMRA 1E5VA 1QUFA 1Z6XA 3OT1A 4PS0A 4DCGA 4C1NA 5IAEA 3K20A 1QJ4A 3DOFA 3N6RA 1NSYA 4MYRA 1T3GA 1EEHA 2P7IA 4GEGA 3TOCA 1N1MA 4ALLA 1PCXA 4W5TA 2BFCB 1X1SA 3GVCA 4YRAA 1CQJB 1H8HA 3AI3A 1GKKA 3OZRA 2Z83A 2XUGA 3F46A 3G68A 3M0EA 5EHQA 1UFQA 4IHKA 1T2CA 1AQLA 3I5XA 5HS6A 3FUCA 1T13A 3D81A 3QKTA 2OZLB 4QM6A 3T4UA 3MRTA 4D8UA 5CFQA 3DLAA 3ACBA 3JQGA 1J23A 3G2OA 3JTMA 3OZBA 4K1XA 3DBRA 5G4LA 2OP0A 4DYDA 1TT7A 2WMNB 2YX1A 3K9NA 5FBHA 2Y77A 3ZHOA 2Z6AA 3Q8MA 1NYLA 3FOEC 3LU1A 2I71A 4GF5A 4AJ1A 4YJ2F 1RMTA 1T0PA 2ZVJA 3FI9A 3JQ9C 4TVOA 1VLLA 1TQ4A 3IUNA 2YXDA 5K8CA 4YRCA 1I14A 4MR7A 4YR7A 4BXOB 1E2KA 1YB1A 5E9QA 1GL9B 1T0IA 1ZD5A 2YWCA 1FS5A 1NVWQ 4EHNA 4I4TB 4MV7A 3TEFA 3WA7A 1ZR4A 2HW8A 3CXRA 5IK2D 3MWEB 2OBFA 1Z28A 5T4EA 4Q7MB 1CLUA 2JRCA 4ZGBA 1YRQA 4WPGA 1EEXB 4OSPA 5JZSA 5HR5A 4QYSA 2FETA 2MMGA 4OEHA 2ZYVX 2R84A 3JWIA 4RGQA 3EVCA 2PUWA 1M9NA 1K06A 3ZIAA 1QG0A 2AQIA 4BGDA 3A4YA 1IRIA 2P27A 3IE2A 1KVUA 2GCNA 3H2HA 4ZO7A 3KDPA 1G8HA 2FN4A 4DKJA 4DMFA 4IL5A 2YWRA 5FA5A 4F0JA 1NR5A 4PLWA 3ONDA 4HQRA 4BEVA 1KXJA 3NCHA 3PIIA 4ITUA 4LSMA 4CDMA 5BV8A 1NZDA 2VHWA 3OX4A 1ZIPA 1HYHA 2VBFA 4W7SA 4Y2TA 2ZUEA 3VZDA 4Q0MA 1FDRA 1Z68A 1VLJA 3LSTA 3F9RA 3QKSB 3Q9SA 1CZNA 3GT4A 1QH1A 1SOWA 1SXHA 4R1PA 3EFBA 2OO7A 4S04A 3RFVA 2IQIA 2QRVA 3PNLA 5CDFE 5ECWA 5A9RA 4YFYA 3O2SB 2A3NA 2FW8A 2P2DA 4O4HB 4HTFA 4WVLA 1OXMA 4BX3A 2P9HA 2CYCA 1NA5A 5ILGA 3O31A 2PD4A 4QRDA 3PQ2A 4ZO9A 2PPLA 2VDWB 2MR5A 3AEUB 1W7AA 3ZLJA 1XQ6A 1WSAA 3DL2A 3H2ZA 4LYFA 3U19A 2XNSA 4HQ6A 1GO2A 1L7AA 1WQ1R 2VDMB 3VPSA 1HFWA 4B3CA 1TLFA 4UW9A 4YMLA 1RPNA 1U6IA 4B3DA 5C5DA 1P4JA 3DE7X 5SZIA 3V6LA 1ODSA 3V1TC 2W6JA 4TKZA 2QSUA 2PSEA 4D8TA 2C5EA 1NE2A 1KI7A 2QAGA 2LWIA 2ZUUA 1OIXA 2WF6A 4LHVA 2IHYA 3MXOA 5JZMA 1GNTA 2J3DA 3AR7A 3OICA 1HV8A 4GMHA 2WG2A 3NWPA 4X61A 2ZE6A 4ALKA 4BZPA 4CLOB 3C6BA 3AUTA 4P5EA 1W2HA 1DRVA 3G02A 1KAMA 2FWIA 2N9UA 4M76B 1L5NA 3S70A 1R4MB 4ZVNA 4MP6A 1FYWA 2FPIB 1BX3A 5HM6A 3H7AA 2PV7A 1ZJ6A 3CRNA 1IAVA 3MCTA 4FQ8A 2CDNA 3RS3A 3RR2A 5WRFA 2ZYTX 4A92A 1CDDA 1WVMA 3ZXUB 3FFTA 1E1RD 1DX9A 1UMDA 2GXQA 4WN9B 4OSOA 4Q4AB 4WESA 3QIVA 5FTKA 3UW1A 2FDRA 4EFKA 3ZPXA 2PXCA 1T4DA 3KQTA 5ETJA 4BYGA 1M8FA 1G2QA 1FJGB 5DGDA 1ND6A 2AG6A 2W6ZA 5FUQA 3ETGA 3BQNB 1OYOA 4GICA 1BHO1 4JLMA 3RBVA 4ZI7B 2EP8A 4ZJPA 3DOEA 5EE1A 1JHVA 2OVFA 1FYEA 2A8YA 1XDGA 5HUJA 3RYTC 4F93B 2V58A 3MCWA 1G8JA 1DBPA 2ZQYA 1OLOA 1PT7A 3AETB 3C1OA 2GM3A 2OCIA 1KDZA 5BWCA 1WTAA 3CTMA 3SAJA 2M9MA 1JWLA 3B9RA 4ZODA 2W2LD 4C03A 4FCVA 1VC2A 4A8JA 4BNNA 1CF4A 4TN1A 2XUKA 2NAPA 3RK4A 1RLOA 2AKAB 2NU6A 2UZ0A 4LECA 3L8ZA 2O1WA 5F4BA 4LTDA 2HSJA 4GZ5A 2G28A 2JK1A 1ID1A 1OXUA 3PXGA 3FRIA 3SMQA 4EK9A 2NUPB 2PWYA 3K4PA 1ZI6A 1ZXXA 3QZUA 2XADA 5AM2A 1YRHA 4WKGA 1MT3A 2Q62A 4O0MA 1WXEA 1WXDA 3LDFA 2WILA 3EY9A 3CKLA 5B1DA 3R4CA 1Z38A 4ZI5A 1YJQA 2JAUA 4FGZA 1YDMA 1E7SA 3RAEC 4IIGA 4C20A 3ROZA 5D3MB 5BR7A 4Q4HA 1JSZA 2EVWX 3AJRA 3QVOA 4Y1FA 4G0MA 4ZYZA 2WVJA 3EGDA 3TRKA 4Y9DA 2VNKA 2VP2A 2O2CA 4Q7EA 2AEFA 3RSLA 2BFDB 1JXMA 3O2QB 1EU1A 1P33A 3UJ8A 2CUZA 5AKXA 2CXRA 2A9QA 4HUTA 1TCBA 1V5IA 3A1UA 2G1JA 4I1IA 2D0OB 2RAUA 3BWBA 3EAGA 2A5DA 2XUQA 3DW3X 4JP1A 4V0KA 1UBEA 1L5SA 1PAUA 4QFMA 2YWHA 4UAJA 4AROA 3HDVA 5JI2E 1T1SA 2C57A 3Q3CA 4IDHA 1EFDN 3L8YA 2FPMA 1G98A 3GFOA 4G65A 3W9BA 2FE4A 1GKUB 1S89A 1SU6A 4K9OA 3DR5A 4MQLA 2ZYDA 4REQB 4W1SA 1A76A 1Z34A 5EQFA 3WGNA 4RABA 1JS1X 1M2FA 3TPZA 4FWTA 1K6JA 5LMCA 4KLAA 4PIPA 2BFPA 1G8SA 3ENWA 5AH0A 4UAVA 3AC0A 4JKIA 2YXBA 5H5JA 5IBQA 3WGHA 2DKNA 3CVVA 4MUXA 2HADA 4B46A 1JR6A 5KTPA 5LU9A 1JQJC 2FQWA 3KXPA 4Q7LA 4C2AA 5A2GA 5BY2A 2QMOA 3RSHA 3DAGA 3UXHA 3I1JA 2CK3D 1R3DA 1GTMA 1NUPA 4WNYA 2IE8A 1Y3FE 4JR0A 1TTTA 1IY9A 4MXDA 2TMYA 4OGFA 5K8IA 3UGTA 3TIIA 1S3IA 4A0SA 3OZWA 4EQZA 1BU5A 3FB4A 5D7NA 3GYGA 4IF6A 5KVCA 1KE2A 1YJBA 1UBTS 2IZZA 1ZGAA 3K72B 4K81B 4O4IA 3NEJA 1E1LA 2B4YA 1PLLA 2HMYB 4Q3DA 2Y3IA 1ZK4A 3BMNA 2ZGVA 3RJTA 2HT1A 4CEJB 4BQQA 1K2VN 1V96A 1X7WA 4DQ0A 1H3EA 3HB7A 4NS4A 4FXOA 3CB2A 1XP5A 4BLTA 3OMWA 4YWJA 3OY7A 3NW9A 2OK7A 1Q77A 4MUHA 1WZ2A 3QMVA 4R9NA 3LPNA 1PT6A 2CFTA 1KY5A 2QW0X 4W1PA 5LD2C 5GJCA 4HQ0A 5U1PA 2P0YA 1BKYA 2VPWA 2IBSA 1QOQB 2OZPA 3DDUA 4KE6A 2GX6A 2QJTA 5FAXA 3W4KA 5LWHA 4OJMX 3TLGA 1GNQA 1THGA 2BM9A 3S6JA 1GLNA 3HJAA 2YJ4A 2JW5A 3KOYA 3TLAA 4QOEA 1ORTA 2N1BA 2ZK7A 4MEJA 4WXMA 4R7TA 5DLEA 4Q3CA 3SICE 1GUDA 4RQUA 4RY9A 5EL0A 3LWNA 4R2JA 4ZD6A 1E7YA 1LLQA 3HADA 3L04A 2C8LA 1UJMA 4G37A 5LU8A 1ZYUA 1UJNA 4FHFA 1MRNA 4BFLA 1N5IA 2JZCA 5EJ7A 2X4DA 3GDFA 4GNKA 4K0RA 2WMYA 1DBVO 1I3LA 1MGPA 1R5JA 3IBTA 3O8OA 4JYMA 1UKYA 3FNBA 4KAXA 3RVOA 1N1EA 1NBOA 2ZXUA 2VDJA 4CKEB 3JVVA 5EPEA 5A5GA 5M3BA 5IAGA 1SK9A 3H1AA 3N86A 1E2LA 3L9XA 1H5UA 1VYUA 1Z2NX 2GDZA 2NACA 3F7OA 4QTXA 5ALYA 1D4OA 4XCQA 5AJTA 1PZXA 1OIWA 1KDYA 2W00A 4N7JA 1BD4A 2F3UA 1J25A 1SVKA 1UXOA 2WNSA 3BERA 5CFLA 1HYEA 2H1RA 2VRNA 3T6KA 1OFHA 4WADA 3UNXA 2A35A 1KI6A 2BGJA 2WJVA 3A1EA 3GAAA 5KINB 4MUGA 1J9GA 2Q5LA 1XROA 4MUJA 4NEHB 4B75A 4EB3A 5HIIA 2D5LA 4F5DA 3UWMA 2W2PA 4WLUA 3DDSA 3HPRA 1PWXA 1M1ZA 1TF7A 3PNSA 2BTQA 3HWSA 1V16A 2EKBA 4OHZA 5A1TA 2ZM6B 3F5SA 1C14A 3D43A 2RHRA 5EQTA 4QPPA 3UO8B 2JGIA 5AJXA 3OTOB 3NFRA 3SIWA 1KFJB 3TSAA 1QF9A 2WP0A 2XOKD 1U7UA 2FA9A 1ORWA 1A04A 1XLTC 1XFDA 1NN5A 4I1YA 1T9HA 3GRRA 3TX2A 1J2UA 1W5EA 3FRJA 1JJFA 1U2GA 2CVPA 2VHQA 2FI1A 3KWJA 3REFA 2CE7A 3ROKA 4D3XA 1E2GA 4JZYA 3PF8A 1J99A 1MP0A 4PPNA 1WDLA 2V59A 3IALA 4U00A 4DR2B 1Z5NA 1JPNA 1C29B 3KKKA 5AKYA 1CR2A 1E9DA 1OHHA 1S9HA 3HGQA 4OHBA 3ZY3A 1QZTA 2HSEA 4WDRA 4Y2SA 3AXSA 1EE1A 4LFBB 3MWFA 3OIFA 1F6WA 3T5TA 3OPNA 2XB6A 3QBVA 1MJGA 1CVRA 1AX9A 3GLTA 4H31A 1Q17A 2CLMB 1KFCB 2O4UX 2UZAA 2HMTA 3D6MA 4HAUA 4KXUA 4XXHA 4R7GA 1X6VA 1E8DA 2LIPA 4O2AA 3SHFA 3V4ZA 5ADUS 3M89A 1T1EA 3JQBC 4OJNA 4RXMA 3U7RA 4LJ9A 5HS4A 1A2BA 3SDSA 1HOXA 1J8DA 3NIWA 3EGIA 1CJCA 5AXBA 2K2QB 3U9TA 2D1SA 4DA7A 4DHEA 2AQHA 3R7WB 3ASYA 1O6ZA 2XV1A 3GLKA 3V4VB 2EF1A 1WCV1 1V11A 5ALFA 4JT2A 1E99A 1O5IA 4PQEA 5E4FA 3D7RA 3PGLA 4HDSB 2E1RA 4EKIA 1ZICA 1QAMA 2JFBA 1L4FA 3OPMA 1M2GA 1RMQA 2DQ4A 4J0GA 2VP6A 5DWVA 4B3SB 4BFXA 1TMYA 4DIEA 2VUSA 3HCNA 2AGVA 2QMHA 2OHXA 3HFSA 1CYDA 3RS7A 3ILHA 4CM5A 4CKWA 2E4YA 5GIOE 5C53B 1TE2A 4F06A 2ZCJA 4O3MA 3KBOA 5J59A 3HVHA 1UM9A 2GD1O 3K0KA 4WXEA 4JL6A 4LCBA 4BNKA 3L3BA 4EGCB 1ZNWA 3OJOA 1ENZA 4HGOA 1XU4A 4RPLA 5EC8A 3KOZA 2Z4SA 3IDZA 1NW3A 3N05A 1F9EA 5AJVB 3Q88A 1EXMA 1G291 4BVAA 1LLCA 3U80A 1ECLA 1CY8A 2LNDA 3LPLA 4CNQA 4OFZA 2PQ2A 1YD7A 2EX0A 2XUFA 1VG1A 4ZI3A 1RTKA 4DV4B 5BXYA 3A7DA 4GBMA 2HJVA 4LI3X 2D54A 2FUNB 3K9GA 1PFWA 1UPUA 4ISBA 3GN1A 4WLOA 5C81A 3AO0B 4Y1GA 1EFCA 1NBMA 1DQZA 5ITZB 1CW2B 3W1EA 5HF9A 4MS1B 3CGGA 3BXEA 4FYHA 5JVDF 2FDCA 3WHPA 3ORSA 1UBOS 3TSCA 3MCVA 2WTMA 1AV6A 1NN1A 2A5YB 2C00A 2FWJA 2GEVA 3JQ6A 2WHQA 1CUEA 2X8JA 4HUQB 3G49A 3KR1A 4AC9A 5HZGA 4LVUA 1CUXA 1U0GA 3D4PA 2P3SA 1J8MF 1XLVA 2BCEA 5FO1A 1Q74A 4MROA 2HUNA 4EJFA 5I7WA 2X40A 4R0NA 3W8NA 1CUWA 2WFZA 1UJ6A 3KC2A 1L5VA 4O6VA 4LRWA 1AGYA 1JEAA 1DO0A 3U5ZB 1XFAA 2XVXA 4BMZA 4Q82A 1HF3A 5CCBA 3K96A 4ZV7A 4XQGA 2OOKA 1GPDG 1WSBA 4OTZA 2RB4A 4Z1MD 1T26A 4XVUA 2Q9AA 3Q9LA 1IXYA 3VSAA 1N5RA 3RD5A 4ACAA 5JISA 3CX7A 3CONA 4PFKA 1KEEB 3FNIA 4PRYA 3JYNA 4QT4A 5CDYA 4MDYA 5J47A 3HXTA 4GFDA 4F4FA 3D2LA 3T1OA 2G04A 4JB0A 2E5FA 3EIHA 4IDFA 4F8JA 1WKCA 1JB9A 5DK6A 1T6NA 2PYDA 3PUVA 3ZV3A 4ND3A 5IVHA 4MKXA 3BBPA 5BSUA 5CHYA 4IIDA 3T5BA 1QK3A 1N6IA 1JLHA 1C7RA 2BEVA 2GHQA 2QZPA 2WTNA 3PPIA 2A84A 4U4AA 3N5KA 1PS9A 4XQEA 3UMFA 3UMVA 4DN6A 4YMWA 1Z25A 4LCEA 1KMHA 5CXSA 5DTEA 1ECCA 3N8IA 5EKDA 5CTAA 5BT8A 4ZEWA 2BF4A 2Q2OA 1JLLB 2R1VA 4NYJR 3WRXC 4I5GA 4M21A 4MI3A 4EZBA 5C80A 3FBGA 4TSFA 4TKVB 3VR1A 5AHXA 5AKGA 5IJAA 1O9GA 1QHHA 1EWVA 1DXOA 2I7VA 1V4BA 2IU4A 3NVDA 2IY8A 4C6SA 5IHPA 2F8TA 5KX5A 1TAUA 5CYGA 1RYFA 2ZJ5A 3B1YA 4IHJB 3ZDEA 1I5OA 1VJ1A 1YR3A 3OC6A 2P8SA 2GHIA 2RHGB 4NWIA 1P39A 1CF2O 1ZNYA 3HCRA 3T1YB 1EVQA 3L7NA 3SYRA 2O05A 1AURA 1PD0A 2TMDA 5LR6A 1ETUA 1XO1A 2AOXA 4DUZB 1MB2A 3RSOA 4A8HA 1JDTA 1M2VA 1T1IA 2G7ZA 3KQWA 3PIDA 3TQQA 4XIYA 2FFBA 4BGEA 3GG9A 3TG2A 1QFSA 1PR5A 2X0NA 4PGHA 2A78A 4WNAA 5EXXA 1VIYA 1FPQA 5BYBA 3DLBA 2WWGA 1XZMA 3CJTA 1T9CA 3OF2A 3LIIA 4MVJA 1ZOOA 4LF4B 2C5SA 5GV8A 1Y7IA 4MW4A 1E2HA 2GS9A 3ZVNA 5BMVA 3UWSA 5LYJB 1WXGA 4LY3A 1F8UA 4CIYA 2QRLA 3EGOA 2KBFA 3MILA 1YI0A 4DA9A 1XNGA 2AF4C 2R751 2XUAA 5J9FA 2WE7A 3VKVA 1ZHOA 3B89A 3K8ZA 1RW4A 2AF3C 4AZSA 2EW2A 1TJNA 1SIUA 2ZCVA 1N0WA 1C1HA 1L5WA 2WWHA 3H6KA 2Q5EA 2ZYRA 4HGNA 4D8WA 1TYEB 3V8PA 3OLCX 4ENPA 4ZTZB 3GUVA 1USGA 1CUFA 4W9RA 1PYOA 3A4LA 5JQGA 1YJ8A 2KM1A 4ILEA 4KQEA 1Y81A 5HE8A 3CW9A 2CJWA 4E2WA 1DQSA 5KNCH 2PNFA 2V8BA 2ZKIA 5EI5A 2PLWA 5M29A 4EKEA 3TECE 2H11A 1M5TA 4MW5A 4C2TA 2WWTA 5GIPE 2WJ6A 1ZVMA 2FB9A 2V4UA 1IQPA 5AIAA 4FLEA 4UOQA 3U7JA 3IESA 1Y5IA 3JXEA 1L3BA 4QTTB 2YWXA 3N0WA 4M8LA 1GNRA 4EHHA 2GCPA 2PVCA 3C0KA 3L06A 2A9RA 1OCEA 1SB9A 5FYDA 3I9NA 4CUZA 5C1BA 1XMOB 3OLVA 3RVRA 2DXIA 2ZJ2A 3QVKA 3OESA 1FTSA 4MS3B 2X4IA 2Z5VA 2JDID 4I4TF 2UZ3A 2B7BA 3Q1KA 4L1KA 1AUPA 3IE1A 2OGWA 4OP1A 3A4VA 1Z6YA 3MD0A 4RQAA 4PG6A 4BB5A 3WLQA 1HWYA 2GUGA 1PT9A 5F2KA 1T5LA 3UB4A 3L7YA 3K70C 3PFBA 3TRFA 4IJUA 1MW9X 4DV1B 3EG9A 5GJWC 4M54A 3VM6A 5CPBA 1DDIA 1HEUA 1MX5A 1UDBA 1VCOA 2I8AA 2JIZD 2X9QA 2YHUA 3B20A 3Q41A 1H0KA 4H6XA 3ZR4B 4NBUA 4XJXA 3V46A 1YE8A 1A71A 1JTFA 3OO1A 2WHPB 1G64A 1S1CA 1Q1NA 3OZFA 1CB7A 5FHRA 1C1DA 2OHHA 1TMKA 2HLDD 5FPHA 2V9ZA 3X1KA 1JU9A 4L0QA 4PZYA 2XUZA 5EP2A 4AMUA 8OHMA 2Y0PA 4XX0A 5DYGA 4URUR 2AN1A 2RHCA 2OHIA 3ZK7A 3FMVA 1L7VC 2HHLA 2XMBA 3L0OA 2COUA 3JALA 2JH9A 3ZCPA 3NT2A 2WQ7A 4HH0A 2EGGA 3IFSA 3U31A 1KDRA 1K4MA 4RF3A 3ZHVA 4BVEA 4BLQA 4YDQA 2EJTA 3PUJA 1M67A 2QD5A 5LOVA 2Y1KA 1ORHA 5BNFA 2F1KA 4CN8A 2C7PA 1LWNA 4BJ1A 4TKLA 1SU7A 3A9VA 2IF0A 5DYYA 1W4RA 4JUIA 3C4VA 1AGRA 1QZZA 4RX1A 3D0KA 3H8WA 4O4HF 3PVSA 1DLIA 3G1TA 2O52A 3G8CA 3GNSA 2ONYA 3DV2A 3UWDA 1KI8A 1N3BA 3HTXA 4B87A 3BZUA 4UOEA 3GVXA 5JS8A 4F6CA 2VHUA 4ZV4A 2YOFA 3TUJC 5IKPA 3NTUA 3ON5A 3OURA 1JDVA 1QRDA 4QGGA 4QOFA 2OG1A 1W49A 2WYUA 2WSBA 5EWLA 3VNSA 2Q3HA 1MA0A 2W6IA 4GM0A 1RRCA 2V1XA 3C7TA 4M7RA 4ASUD 3EXAA 3EB9A 3PA8A 4L95C 2AH5A 1Z4JA 3CF2A 4ER0A 1EGVB 3EA4A 2QVLA 2WUEA 1S2DA 2YNMD 3QENA 4PR3A 1O7JA 3KZ1E 3OP4A 3UWOA 4BFCA 4Q9HA 4MPDA 5EE9A 2FR0A 2RH8A 1AXGA 1G5PA 2QG9A 2JFPA 4M86A 1DOHA 4MQFB 2MINA 1OFTA 3OTQA 2IIBA 4Q4DA 3KETA 1VIMA 4IX9A 2BEUB 4H59A 4M1QA 3PJEA 4TQ9A 3H65A 1EGHA 1L4NA 2B1IA 4LSGA 5TMEA 1I8TA 2CFOA 2CY0A 2P1RA 4JB3A 2ZUTA 3RS2A 3V8NA 2QUKA 2VHXA 2VSXA 4NY1A 4IY1A 3HM9A 4R41A 3TFQA 1GQQA 3TE6A 3OKFA 5JEEA 4JWKA 3SI7A 1VI6A 1H94A 3IAS6 1NMYA 3N8NA 3HCCA 3AHIA 1KRXA 3K0BA 3ESCA 3I28A 2DQYA 1SXJE 2F67A 2JEOA 2BOVA 1CJSA 3TQIA 2Z6QA 2GHTA 3Q3GE 3SKVA 4ZI7F 4JJ7A 2OBMA 2OPBA 4KPUB 3GWGA 1U4OA 1T5OA 1M10A 1PNVA 1HDYA 3LKBA 1TI7A 3B7WA 4MZDA 3HBLA 3K0EA 5E4YA 2NU9B 5MFPA 4BMSA 3KOWA 3EDRA 1HQDA 3AKDA 4I4NA 2C78A 3EVZA 2IYNA 3GGDA 4JIGA 5AO9A 3WG9A 4GZ3A 4A1FA 4BNDB 2WHRA 5JANA 2GK4A 2MSDB 1SCUB 1VKJA 3R23A 5EEGA 3BSYA 3GV0A 3ZC3A 3QELA 1VHJA 4LV6A 2JGEA 3AI1A 3JZMA 4B7UA 1O0BA 4UKDA 1EJBA 5IBCA 2C99A 3I9LA 2I2XB 2ZUDA 3NTXA 1CJVC 1ODJA 4M7OA 5JH7B 5CVJA 5EQDA 4YRTA 1ZJZA 1IB6A 3WIUA 1C30B 1Q91A 2VC2B 5HZMA 4P53A 5CT6A 4JHXA 1P17A 3CPHA 3IKMB 4I50B 3RWBA 3ZGXA 1B1CA 3BHMA 4JT9A 3AKZA 3LBAA 5IM4A 1V45E 4FDLA 3ZE2B 4CL2A 3MSCA 4ZKEA 4DANA 3RRNA 5FQOA 1JQDA 1NXXA 3TRJA 4GOOD 4C5AA 5CYOA 1I32A 3BE8A 4YFVA 3D2CA 2IP1A 3JASB 3WL8A 3WYDA 1OLUB 3AZOA 2QRZA 3U09A 1JIJA 3CX6A 3KV1A 1QYCA 1GGEA 1Z4KA 1AQNA 4EOGA 2B98A 3NCTA 3QVUA 1U02A 4NZZA 3G9XA 2LR0A 4J0DA 4WGGA 5FUYA 2RGUA 4DUPA 5LA6B 4WZAE 2Z30A 3WISA 3GD5A 3K2IA 1EFPA 1ESCA 2IPOA 1S8NA 3BZWA 4IQFA 4R2IA 2QRPA 4TWAA 2H54A 3R7WA 4GLJA 3ANXA 4TUYA 4C7KA 2PUAA 2JJ2A 1NIPA 3FE2A 2XEXA 4R2MA 1E1YA 3Q7SA 5JS7A 1P1FA 2P8JA 3GCWA 3ZCTA 1MFZA 2H8GA 3ZE1B 4BBZA 4J4TA 4UPVA 5JSHA 4Y2VA 2PSDA 3DMGA 1ADGA 2WPDA 1C9EA 2KYRA 2O3RA 2NADA 3NT5A 1L4KA 4XWOA 3EFEA 2JBHA 3UMYA 5KWVA 4ESEA 5CLLA 5HF5A 2UYQA 4GWKA 3LC7O 2IC5A 2YJNA 5JJKA 1K5GA 2XHEA 3GT3A 4C0XA 3OTHA 5PGMA 4YTEA 5H16A 3ZHRA 4AJIA 3AFHA 4AD8A 4X8HA 1YQWA 3EQ8A 4CR6A 3VOBA 4UEQA 2R6JA 5KVQA 1GDHA 3B1WA 3LPMA 4FIDA 5KKAA 1Y3DE 3X2SA 5JZOA 5C8YA 5TT1A 4CMEC 1N3YA 4F4JA 4UCQA 3KZVA 3KSRA 5E0KB 1A7UA 4ANFA 3QVXA 4IDNA 3D6HA 3HJCA 3TLXA 1A98A 1BDMA 2CXNA 4QO7A 4FGKA 3KU1A 3DPSA 5SICE 1IPEA 2XSZD 2PQ6A 2ZVDA 4OGLA 3CLTC 3UZUA 2QTVB 2YFKA 3IHTA 4GKVA 4QODA 3MIZA 1YZVA 3QG1A 2JGRA 2OCGA 2Z2YA 3FYSA 3LCRA 3RM3A 2IYPA 3AERA 3OPYB 3A11A 3L01A 1JU3A 1PTJA 3ADKA 3LWDA 1VPVA 2G08A 2O7NA 1SUDA 2RHMA 2XQVA 4NOJA 2W37A 4OHKA 5KAPA 3B2QA 1U8EA 2J31A 3RVSA 4KUEA 3ZVRA 2CV0A 1PL7A 2GD0A 2R68A 3LA6A 3I4LA 3SZGA 3V3TA 2CHUA 4PYMA 3U7GA 1ZOIA 3EH1A 3I2JA 4P83A 2D2VA 1SKYB 3IQHX 2X3FA 5H83A 1D9ZA 4UE3S 3RSFA 1JVNA 3O92A 5B1YA 4B83A 2F3QA 3KYDA 5DX1A 1TCCA 2IPNA 4EGQA 5DLYA 5KDDA 4JJ8A 1E2DA 3FWYA 1M2KA 1KDOA 3NEPX 4NNJA 3MCZA 5HOEA 4PLFA 4FWBA 4TPKA 1AKRA 2QBYB 3S68A 4ZGGA 2EZ8A 4FUTA 1QVWA 1P72A 4KO2S 2JCSA 3QV2A 5JMPA 1JZSA 4DLPA 3PQFA 2FEOA 3PQ4A 3RNOA 3TW4A 1D7AA 2YWJA 2PEZA 4NULA 1GNVA 1GU0A 1TT5A 3V00A 4W5NA 2P41A 2F00A 3FKSA 3THRA 4CODB 1PDOA 1XU9A 2H9IA 3BE4A 5A7GA 5K4HA 3TRDA 4CEIA 1EG2A 5LKAA 5KSYA 3HVIA 1QQ5A 3BGDA 3EJ6A 1FJXA 1XN1A 4BQNA 1E32A 1E1RA 3QF4A 4Y9UA 5DI3A 1ZW6A 3JRNA 1S02A 2YYZA 2FUCA 1L8QA 2QVYX 2UZIR 3L7DA 1JFTA 2F59A 3QE4A 2FG7C 1CNFA 1YK1A 4I1RA 3WIDA 4HZIA 5C2JB 3PR3A 5HGXA 3JQPA 4D45A 4ZVVA 2AZDA 2ZJFA 1JNYA 4FSHA 1LU9A 3WGYA 4HY3A 2HA0A 2X77A 3L8MA 4OKNA 5DHAA 1G21B 2P2SA 3W8FA 4D3ZA 4DLRA 1RWQA 1ZY2A 4KCGA 4ED9A 2ID7A 3MD9A 3NS7A 1ZJYA 1V7ZA 1XKQA 4I6JA 4BO9A 3EYAA 3EDOA 4ZV9A 4MQ6A 5C7OO 1L9XA 1R8QA 5G1NA 1F7VA 1MZVA 3INNA 3LY8A 3TZBA 1S01A 1MB9A 1R4AA 3U62A 2C5AA 4KWTA 3I12A 3UAWA 2NZWA 4I4CA 3RC3A 1W1IA 5CAEA 2JLAA 1W4AA 3E05A 3P0EA 2G9UA 3FOCA 2WU0A 1AHPA 1Y6ZA 4ZXPA 5LLSA 2A30A 3MCUA 4XX1A 3G0IA 4UE6A 1UIRA 5IJZA 4CBVA 2AN4A 5CW1A 5E9JA 3F78A 2PSHA 4Z7QB 2YMQA 3A3KA 1JSXA 1MEOA 1E1CB 2QIPA 4UZSA 3VH1A 3P0JA 4A10A 4CIXA 4DVJA 4HTAA 1IN6A 1C50A 1I3MA 1QYRA 1TAGA 3AY3A 1FZTA 1RACA 1YA4A 4ZO6A 4JOBA 2IYYA 3CFYA 5IVDA 1JYSA 2P4QA 2VTEA 1AF7A 3MN1A 4M0FA 4X6XA 1RWOA 3VZCA 1I01A 2FQQA 4TMVA 4G5RA 5DK4A 1GG9A 4KG7A 1QQ6A 1J0EA 2NO5A 4E6PA 2J3HA 4N5HX 3RJ5A 2FLKA 2JFOA 1SPXA 2NO6A 2F6RA 3RJMA 3IV6A 4K1LA 4QDUA 2PBFA 3QKIA 1ZJJA 3QU2A 1N36B 4FDTA 5B58C 3IVXA 1L5MA 4EG8A 4FOLA 2Y67A 1Y82A 3BL8A 4RD1A 5SZKB 3EYWA 3IP1A 2IX9A 3DUWA 2CYAA 3RGGA 1Q0LA 2O4CA 1JSRA 2QWXA 4IPTA 4RS4A 5CM8B 1DRUA 1HDZA 1IFXA 1RC0A 1B0PA 1NKTA 2Q28A 4TTVA 3V42A 2WB2A 3GBVA 1VL8A 3VI3B 4HNUA 2FCAA 5HHTA 2XBLA 4NNOA 3AW9A 3OCCA 1E63A 1L7XA 2F1JA 5HG0A 3SC2B 5BSHA 4KQCA 3U81A 3BF8A 4CMAA 2OZVA 4CCWA 3BD8A 4FN4A 2H17A 4M1WA 1B74A 4DMCA 4AWBA 3QVLA 3HXPA 4FNGA 2J9XB 3C7DB 3DG9A 1NY5A 2IV2X 2AXQA 2Q1SA 2GFQA 3EIQA 3DBVO 2GD2A 3LQ4A 2HMVA 4LWZA 4UBLA 4YS6A 2IUTA 2WAYA 3HEAA 1M6NA 4JP3A 5DIZA 3ZZTA 4P3PA 4IVPA 2B5VA 3D7LA 2PMCA 4R5HA 1VJCA 4RVNA 4BGUA 5KMGB 2CK3A 3COYA 1U28A 3HBNA 2E4VA 3V48A 4HAXA 1GT91 1KZGB 1DBSA 4MB6A 2VQDA 4ZOLA 1ZLYA 2ZI9A 2FHSA 2JCGA 2JLQA 3GJ7A 3HFJA 2FPSA 4FMDB 4MX8A 2R85A 4U7GA 3WJ1A 5BR4A 3V55A 4Y0VA 2ZDHA 4YJHA 3PHIA 4GC5A 4CM9D 3DC7A 1BKSB 1O97C 5AQ1A 2QLNA 1MABB 1LD3A 4M1TA 1GDTA 1JDJA 5BPHA 2VDUE 3HHPA 4MEAA 4B0OA 4L08A 4IHQA 1OY1A 2QLLA 2WKSA 5EP1A 5IBPA 4F7DA 2XMPA 1Y4ZA 4CIDA 1XK6A 3E3AA 5LOVF 3JQEA 5ITVA 2QMQA 3ZE0B 1PLKA 4QUIA 1XXHA 4MINA 3PPWA 1WDTA 4PZZA 3WDKA 1FQWA 2IP4A 4Q01A 3DT6A 4C29A 1ZK2A 4XLZA 1TIPA 2IF2A 3KYIB 4D6PA 3SXUB 5JO9A 2E0IA 3AU9A 3JWPA 4I55A 3LOQA 3ZH9B 4CW7A 1MAUA 5AW5A 1C7JA 5C51B 3C6KA 3IIIA 1PQUA 1NI4B 3N2KB 5AWFC 4IFIA 4PFJA 4ARIA 2KB0A 4K9RA 2QX7A 2CKMA 4FMCF 1Q1BA 1BJRE 1R9JA 4TZKA 4TKUB 5TQ0A 3GDWA 5I7SA 1SB8A 1FMLA 2JKYA