1CYEA

Three dimensional structure of chemotactic che y protein in aqueous solution by nuclear magnetic resonance methods
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
RSDKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of chemotactic Che Y protein in aqueous solution by nuclear magnetic resonance methods.
pubmed doi rcsb
molecule keywords CHEY
molecule tags Signal transduction
source organism Escherichia coli
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 1994-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cyeA00
1BA2A 2MSKA 1JDPA 3DGFC 3JTEA 3T95A 5ED4A 3ROTA 2YHBA 4D74A 3S99A 1FFGA 2FEWB 4YP9A 3N8IA 1LBIA 4KQCA 2TMYA 4RKRA 3RVJA 1QP7A 3EQZA 1MAVA 4ML3A 4Z4EA 1JL3A 1DCKA 4Z4GA 4MR7A 4WXMA 2XDYA 2JB9A 3LUGA 1XHFA 2LBPA 5FBKA 4ZYLA 3MM4A 2QW1A 3CZ5A 1EWVA 1MVOA 1Z16A 2LUOA 2A9OA 3E3MA 5C5CA 1URPA 1BAPA 3F73A 4MR7B 3O1JC 3MMNA 2IPMA 1F4VA 1Z12A 3I45A 1L5YA 1JF8A 2FLWA 3JS5A 3O21A 3D8UA 3H6HA 1DRKA 4H3HB 4MR9A 1YS7A 4WWHA 4EYGA 1Z13A 3MYYA 5IX8A 1QPZA 3LUHA 4Z4CA 2PUDA 1DC7A 5FWYB 3NBMA 5GOTA 4DADA 2E4ZA 3IP7A 3LUKA 4IGAA 4N41A 2WJWA 4MS1A 1SRRA 4QYMA 5JNWA 1DG9A 2GX6A 2PLNA 4EVSA 2YHAA 1RZRD 2FQXA 2VUHB 5IUKC 1D4ZA 3EODA 1DJMA 2DRIA 1FFSA 3EDCA 3JPYA 1FSPA 5KQMA 4MS1B 3QX8A 3G1WA 3EGCA 2E4XA 2QV0A 4YLEA 3NHMA 2PAFA 3OLWA 4G0QA 5E3JA 3LUCA 2WMYA 4NV3A 2AYXA 1Z26A 3FFWA 4QYWA 4B09A 1RZRA 1YMVA 1ISRA 2PUCA 1PEYA 2CHEA 4MS4B 3Q41A 6ABPA 3C3KA 1A04A 2QVCA 3Q9SA 4YR7A 3O2JA 3SG0A 4E7PA 3H5VA 4ZPJA 4OATA 4ZMRA 1OXKB 3MF4A 5CNJA 4IMIB 3TB6A 2M1ZA 4F11A 3CNBA 4NICA 3NHZA 2QSJA 3QLVC 4RXUA 9ABPA 5CNIA 4EYKA 4G97A 1GUDA 2L19A 4YGXB 1D2AA 4UHJA 3N6VA 3CG4A 1P6UA 4KZKA 3RVRA 4O5AA 1GCGA 2JVIA 1YS6A 2VK2A 3KYIB 5BR1A 4W5TA 1USKA 4O1IA 5D2CA 5EWLB 1USGA 3SM9A 2N9UA 2CHFA 4TLLB 3H75A 1E6LA 3QLUC 3H5OA 1ZGZA 2FMKA 1EAYA 1JX6A 4YV7A 1BDJA 3RVKA 4MAAA 3KTOA 4Z9AA 3M6MD 3OLYA 3N75A 3QELB 3R0JA 4IILA 4RY0A 4IF4A 1JHZA 4JAVC 4F06A 4MGEA 1J56A 3GV0A 4IRXA 4N0PA 3UUGA 4QPJC 4HNRA 3QLTA 1VLZA 2PUEA 1DC8A 2PMCA 4G0OA 3A0RB 5TPZD 5JNTA 2FSPA 3H1EA 3QEMA 3FGZA 1K68A 1H9CA 4Z0NA 3E61A 4P1ZA 5DKFA 1NXVA 1DZ3A 6CHYA 5HM6A 3C6QA 3QEMB 3HUUA 4N03A 1KGSA 2JRLA 5JS1A 1Z17A 3CS3A 2MSWA 5TPZA 4RK7A 4RU1A 3TO5A 2P4UA 1TMYA 2R4QA 3HV2A 2NZVG 1NXPA 3A10A 4XAQA 1JYFA 5DLEA 4W5QA 5DCLA 1E6MA 2JBAB 2R48A 1JDNA 1NXSA 4OLBA 1WETA 3IDOA 2LIVA 2IPAB 2M98A 3A3KA 3BRSA 3TD9A 2O20A 2LPMA 4MRMA 2PUAA 2RJOA 3G85A 1I3CA 3ILYA 4MLCA 3OO1A 4OBBA 5KC8A 1NATA 1CEYA 1SXHA 3M9WA 4OG2A 3GA5A 2CWDA 3IP9A 4MRMB 5HSGA 3LKBA 3T38A 5TQ0A 3IP6A 3O2QB 1P8AA 2FN9A 5T3YA 2PKXA 1AB6A 1XWWA 2E4VA 3CKMA 3LUFA 3QX9A 3SAJA 4KMRA 4RKQA 1ZVVA 1ISSA 2MYTA 3BILA 3KLNA 3KLOA 4RK6A 5TQ0B 2JK1A 5FWYA 4JASB 1W9HA 4XXHA 3OMWA 3CZCA 3CTPA 5EWJB 4G86A 3RVQA 3UK0A 2GBPA 2ID7A 2IPLA 3EQ2A 2OQRA 4KFCA 1EWTA 1AB5A 1JYEA 3HCWA 3KS9A 4JB0A 1YK1A 1KRWA 3O75A 5IEBA 3BREA 3QEKA 4Y9TA 5JS2A 2P9HA 1DCMA 1TM2A 3N53A 2V0NA 4N47A 4ETMA 2BGGA 1MB3A 3RH0A 3HO1A 2F8TA 3IPCA 4F12A 1GUBA 3FFXA 3OLZA 1RPJA 3CG0A 3OM1A 2FN8A 2NT3A 2JVJA 3LTEA 4PE5B 4RSMA 1LK0A 4W5OA 4PICA 2PE5A 7ABPA 3HVRA 4EYQA 1BVHA 3OMXA 4MS4A 4KQ9A 3CLKA 3H1GA 2WY2D 1EFAA 2JVKA 2HPHA 3JPWA 1QQAA 4RY8A 5ABPA 5HKOA 4DN6A 3HM9A 4UHKA 3HK2A 5KQGA 3QLVA 4TN5A 3LMKA 1YTUA 2ZAYA 3OQMA 3F7NA 3OQNA 1ZITA 3H6GA 3H5WA 1M2FA 2VYCA 4G0ZA 4L4UA 4Q6WA 2KYRA 1E6KA 5IC5A 2FQYA 2PL9A 3RVPA 1C4WA 2NUBA 1D5WA 3GBVA 1OXBB 1C0EA 3JVDA 3LUAA 5KI6A 1NY5A 2HJ9A 2CD7A 5TQ2B 5EWLA 4DQDA 4ZMSA 1MIHA 4G0XA 1DBPA 3QLUA 5IUJC 4RWEA 4KNYA 4IMJB 3HDGA 4PEVA 1Z18A 4KREA 3MIZA 4P98A 3QELA 4E7OA 1PHRA 1PNRA 3HZHA 1BDHA 1RXIA 2B1JA 1M2EA 2VUIB 4G0YA 3T8YA 5FBHA 5B3JC 5IBQA 1FFWA 4W5NA 3I09A 4RZSA 3P9YA 5DGCA 3RVNA 2IPNA 3I42A 3QK7A 2GKGA 4GNRA 3SNKA 1JFVA 3O1HB 3MA0A 5GQSA 4MS3B 4ETIA 3KKEA 2FLKA 1QP4A 4HYEA 3ILHA 5JNVA 3KYJB 4WUTA 3GRCA 4KRFA 1EWKA 4KVFA 4RK1A 3L49A 4LDZA 4WZZA 1DRJA 4LE1A 4L85A 3D02A 3N0XA 4RXMA 4F8JA 1IIBA 4Q6BA 4Z9BA 3HSYA 3FDFA 3OLVA 4FE4A 2E4YA 2MYNA 3RQIA 1YVUA 1UDRA 1SXGA 2F8SA 2IYNA 1T34A 2FW0A 2JBAA 2GI4A 4JOQA 1ZY2A 2J48A 3O2SB 3N0WA 4EYOA 3DLBA 3OLXA 3JVIA 3N0RA 4M88A 1A2OA 4YRZA 3RVMA 5KWSA 4TMYA 3HUTA 3GWGA 2E4WA 1QO0D 4RK0A 5BRAA 4TLMB 4MYRA 3LFTA 4LE0A 3GL9A 1LJLA 2PUGA 1CYEA 1S8NA 2QR3A 5TPWB 4KV7A 3K9CA 5FWXA 1MB0A 2QU7A 3OQOA 1U0SY 1JFSA 1Z2EA 4MQEA 3I5AA 1KMIY 2FQWA 3Q7SA 3FFTA 4EY3A 2R25B 2IOYA 1QP0A 1QO0A 1ZESA 2GWRA 2RGYA 3GYBA 3Q15C 5FWXB 5EWJA 2ZWMA 5KC9A 1GCAA 3HXMA 5I4CA 2FEKA 4PZ0A 3A0UA 3CFYA 4MQEB 2FTKE 1M5TA 1PEAA 2NZUG 4FE7A 1LBHA 1ABFA 4YS6A 3FMVA 4HNQA 3NNNA 4KK3A 2FMFA 4LX8A 4MPTA 1P6QA 2OENG 3H5LA 1FQWA 4LDAA 1SD5A 3CU5A 3NNSA 2QVGA 5KQPA 3VNAA 1JH9A 1ZGGA 2HQBA 3O74A 1E2BA 5PNTA 1ZH2A 3C3WA 4LRQA 2FVYA 4XASA 2FMHA 2HQRA 2MYUA 4ZJPA 5BRJA 1U04A 2FEPA 2WRZA 2R47A 1GLGA 4ETNA 1QKKA 1JBEA 1NXTA 2E4UA 2NT4A 3SQNA 4WXEA 3B2NA 5C5EA 5CNMA 4EGSA 3L6UA 3VNBA 4EUKA 3UKJA 3C97A 1USIA 1NXXA 1DBQA 1PNTA 1VRVA 2RJNA 2MSLA 3HEBA 4JP1A 5TE9A 8ABPA 4KK4A 3W9SA 3KSMA 3URMA 1B00A 3M9XA 4Z99A 5JNRA 2A9QA 3DBIA 5F64A 4O1HA 3DLHA 4Z4IA 3JY6A 1TVMA 4FB4A 1Z25A 3LKVA 4MLDA 3IPAA 4MR9B 2PJUA 5JNSA 2H3HA 1NTRA 1TJYA 4YWHA 3DZDA 1U2PA 4PYRA 3DGEC 3EULA 1A0OA 3LUJA 2FXIA 4QICA 4Z4FA 2WB4A 5TQ2A 1CHNA 3KCNA 3SY8A 2IKSA 4HNSA 1ZHHA 2MYPA 4XLTA 4YCSA 1TLFA 1P2FA 4Z4HA 4WT7A 4NQRA 4N76A 4H60A 1ZDMA 4G0MA 2FKAA 3ROFA 4RY9A 4W5RA 1Z2DA 2B4AA 3K4HA 5DTEA 5TQJA 4OTZA 5B3JA 1L5ZA 5CNKA 3H1FA 3GT7A 1LJUA 2AYZA 4S04A 4OLAA 4MS3A 4RS3A 4D6XA 1RNLA 1NXWA 1DP4A 1ZN2A 5EWMA 5BQ3A 4XFKA 3KJXA 5IUNC 4RDCA 1PUXA 4H3KB 3HDVA 1ZAYA 5KQLA 1VKRA 2A9PA 2RDMA 4RK5A 2HSGA 2QZJA 1R8JA 5IULC 2PUFA 4CBVA 4XARA 3Q7TA 5EWMB 1JFTA 1DBWA 3GBPA 2WWVD 2HQOA 1YK0A 2LP4Y 1U8TA 3H5TA 1XHEA 2PUBA 3F6CA 2ID9A 2JCGA 4MQFA 5T7BA 3OO0A 1Z15A 4RV5A 3LUDA 1EHCA 1M5UA 2L2QA 3Q7RA 1RXEA 4JA2A 1YMUA 4LE2A 4G0PA 1Y1LA 4LZLA 4MQFB 4NCAA 3HJFA 2A9RA 1F51E 2FMIA 4EVRA 3HS3A 5IEJA 3NNDA 3EJWA 3BBLA 2I6FA 2L17A 1YIOA 3O1IC 3KHTA 1W25A 2L18A 3OM0A 5TPWA 4F3TA 4EVQA 4KPYA 3KG2A 3TX6A 1QMPA 1BDIA 4NCBA 1K66A 1VPWA 1ABEA 3RVLA 3H5IA 2W42A 3LOPA 3C3MA 1D1PA 1NXOA 2H0AA 2Q5CA 4RXTA 3BRQA 3T6KA 5HQJA 3RVSA 3EAFA 3CRNA 1JWLA 1DCFA 4N0QA 2X7XA 1U2QA 4JB2A 4Q7EA 4YO7A 1JLKA 4RK4A 1D1QA 4MR8A 3F6PA 1APBA 3CHYA 5CHYA 4D6YA 1HEYA 2QXYA 1SXIA 1QNLA 3IP5A 1QQBA 3MQ4A 1ZH4A 2IDMA 3RVOA 2PL1A 5JNUA 1KRXA 4GPAA 3TMYA 2WJAA 4MR8B 4S05A
chains in the Genus database with same CATH superfamily
2CFOA 3HEMA 2ZJ8A 2CXHA 3BFKA 4HBZA 4X8LA 3E3OA 3ROTA 3UAXA 4QWMA 4HAXA 4AZ0B 4AUEA 5ED4A 4PVCA 3N39C 2EWMA 4G4GA 2IS2A 5EY5B 5GONB 4Z4GA 3U44A 1QF7A 3L8CA 4NCIA 1FUUA 2EDCA 4GP9A 3RODA 3A6GA 3WYGA 3ZDAA 1LLCA 3VH3A 1YBFA 5JT1A 2RHJA 1UDXA 2X76A 3EDQA 3EFOA 3OT5A 2A8YA 3DCIA 4H15A 1G2PA 1UPTA 4ISBA 4LRTB 3L7MA 4M37A 4D46A 4DBLE 4DXAA 3OUUA 4MVJF 4MSUA 1KY3A 3HYTA 4KQHA 3GCZA 1SMKA 1JAZA 2CEAA 3CEHA 1N2OA 2MJLA 3DZCA 3C3PA 3ENWA 3JD0A 3NM4A 4Q4AA 3VUEA 4EF4A 5JFTA 2O8BA 1G64A 1RLTA 3Q6NA 5IFLA 5ALEA 1OXMA 1YS7A 3W7VA 5CD9A 1UQRA 1PJ3A 3IDQA 3TEJA 4R1UA 4Z4CA 2VN8A 3L4JA 1PLKA 4DA0A 2NXEA 2HK6A 1Y98A 4YRSA 4YCMA 2XRZA 1XKXA 1I0IA 4KGXA 2GHRA 4BO8A 1RIFA 1E1LA 2YHAA 3NLLA 3U2QA 1L5FA 2OZPA 2ZQYA 1NF8A 1J22A 4X6UA 1JEYA 1W76A 3PNPA 4PZ9A 4ITUA 5K0ZA 1AO3A 2E4XA 1WUKS 1QRAA 3OQ1A 1H6CA 4G4JA 1Y7TA 3K9NA 5H3HA 4ZARA 3FUWA 1CVIA 1YKFA 1F8UA 2XVZA 4HYYA 2XA2A 3PDIA 1IK4A 4NV3A 4RD2A 2O3QA 1Z6YA 2Q5JA 5D00A 1TJ5A 1GKLA 1AG9A 2FPIA 3NDPA 5FL7A 1NVEA 3C98A 3T52A 5F3WB 4IXDA 1F17A 3G8DA 3NTUA 1I33A 3V4PB 2J5QA 2PXCA 4EHJA 3S8YA 2DTEA 4DR7B 1YRBA 2JFXA 2HK7A 4MDHA 2C1ZA 2VHEA 2WYUA 2BFBA 1K98A 2QMYA 4J2OA 5F3RA 5KHLB 3G2KA 2ID4A 1EG2A 3IMCA 1KY2A 2HK9A 4DLNA 1AQNA 1OB5A 1UBTS 1PT9A 2BKEA 1B3BA 2BM9A 1I0ZA 2H5IA 5DYGA 3V4FA 4EPYA 4ZZ3A 3LQQA 2PA3A 1S01A 2PZBA 4LHEA 6AT1A 4ZYVA 5HZHA 1AQLA 1RVDA 3H8JA 4FOLA 5HFJA 4D9GA 3EGXB 4D8TA 2EBUA 3CG4A 2XADA 1D0IA 5P21A 4BMXA 1G6HA 1IAVA 3A6FA 1QTIA 2H5LA 4HMQA 4LUCA 1KZ6A 1T8RA 2QAIA 1B0PA 1V5EA 4FZ5A 3HLKA 2JARA 3RRBA 1SIWA 1KOJA 3FTDA 3GJXC 3E15A 2P75A 3A1UA 4JBIA 1H2FA 4Y67A 2VJAA 3B3QA 5JJKA 3AB3A 2OCAA 5DMXA 1R8YA 3EZNA 1H5QA 4XW2A 3EXEA 4AJ9A 1U3DA 2CFIA 4J2TA 4BJ1A 4J90A 2INGX 1RRFA 2A57A 2PX6A 1UBRS 1ISHA 3M6MD 5JWHA 3QELB 2X0KA 2C5EA 4H27A 1S4MA 1YVDA 4F06A 4MGEA 3NYWA 2IU4A 1WCIB 1B0AA 3BMCB 2FV8A 1CJSA 4I55A 4S0XA 4E1BA 1ML4A 1J0DA 1EGAA 2I2DA 3PPIA 4A0HA 2PMCA 4LCBA 4TOIA 5KKCA 5KYUB 3FAKA 5CA0B 2J0QA 1W2WB 4LOHA 1EVIA 1ZD2P 5AHRA 4A2CA 1EFRD 1D6JA 1ISFA 1BJRE 1GPDG 3GJRA 2YX1A 4JC5A 4U9UA 2R7NA 3EZ6A 4IIJF 2QRPA 2WM9B 3E4DA 3MWFA 2DBRA 3R5FA 2RCNA 2P9EA 4OH7A 3CJQA 1BXRB 4KIGA 4BFTA 3CS3A 4FHGA 4RQTA 4Y30A 4I7EA 3Q0TA 1K8XB 3EYWA 1JG6A 3NUZA 3F74A 3K1AA 1JWBB 3TYXA 4Z2AA 4KFSA 4HNHA 1C3OA 3DC2A 5EQJB 4C0BA 3VU3A 4EI2A 4O0MA 4YPVA 5IJ9A 5JHGB 3TE7A 1WETA 3IOMA 2XCQA 5CHEA 4KR7A 5LIRA 3LKDA 3H5NA 4KLNA 2LPMA 3WAKA 2NVUB 1H42A 3P5SA 2BVNA 1I4OA 2ZSKA 4YA6A 4NEGA 3MWDB 5B36A 1P5ZB 3N2EA 2A9VA 4YHHB 2G7ZA 3M9WA 3M82A 5E9JA 2EX1A 2RAPA 3IIJA 4ITRC 4RZHA 4ZZ0A 3BFVA 1P17A 3JQ6A 4XJXA 2FJ0A 2Q46A 1OAOC 1OILA 1PN3A 3O2QB 4LX0A 5T3YA 3RQSA 1N0WA 3MINB 1AXGA 3EYAA 2X8WA 4P86A 2XE4A 1A5BB 1TLLA 1QM5A 3RS5A 4KMRA 4RMGA 4R3UC 1W5SA 2WNHA 3G8CA 5TQ0B 3B3FA 1RLIA 4LOAA 5BWOA 3OZWA 5E6RB 5ICEA 2NU7A 1MF7A 3DOCA 3UK0A 4FFOA 4X1IA 3WIEA 2VJKA 3UPUA 2CMDA 1RD4A 3E82A 3ORRA 4YI5A 2AEMA 5C3UA 1C4XA 1ORDA 3OE1A 4GU5A 3O2NA 4GX1A 2Z57A 3DF9A 5CK4A 4CV2A 2PFGA 1E59A 4NNOA 3SYTA 4BMYA 4OJQA 4B85A 4PR0A 1BHQ1 2HAEA 1WPRA 1DCMA 1WXDA 2XMPA 3KSAC 1JEEA 3JASA 4HATA 4BNGA 4A5OA 1KDZA 4A1OA 1CF4A 3G2PA 2ET6A 1OFVA 3ERCA 1WV0A 3VHQA 2A3NA 2WUEA 2JVJA 3I37X 3LTEA 4WZAB 4YB8A 3TZEA 3S8EA 5C52B 3F3YA 2EZ8A 1KOGA 4LGYA 5CB4B 5HILA 3GJ7A 2XTJA 3GLGE 2PXXA 3D7SA 4ZEWA 3OZ7A 2I55A 3CNLA 4D8WA 4RY8A 2AZXA 5JBQA 1NR1A 5ALLA 4A5SA 3LQRA 4Y6SA 4YY3B 1OFUX 3DWFA 1XPJA 2ZWPA 4MKXA 2CLKB 2OD7A 2G80A 1ZNZA 2VEDA 4ILEA 4DVGA 5AKLA 2VQEB 2BM0A 3A1SA 5KU1A 1SOVA 4D8YA 1YJ5A 1KERA 1QAMA 1QR2A 3KT8A 2WV9A 4G0ZA 4NF2A 4TWIA 4KPUB 4BX2A 3OU7A 4B81A 1XMJA 2Y1KA 3QVGB 2PEZA 3UJHA 5LLDA 1FFAA 3L41A 2VYNA 3VAYA 3DBRB 3CNOA 4A9AA 2AWNA 5EE0A 4DHWA 4DQUA 1AK9A 5HJEA 3P4XA 2ZWIA 1XG5A 2WSBA 2J6HA 3I4LA 5EWLA 4CIYA 1FMJA 1FFCA 2G9RA 2IFTA 3ACCA 4M55A 4RESA 4G0XA 4ZT5A 5FLKA 5BW8A 1E9RA 3GJ8A 5CH3A 1IATA 3CTMA 4X20B 3P19A 3SZMA 2REXB 2Q6TA 2P41A 3K0HA 5EXEA 3Q12A 3M4ZA 4KO4S 4LJSA 5BVGA 1QWOA 1CDDA 3NEPX 5M04A 2Y1XA 1H8HA 3HADA 4P98A 3WKDA 4IOKA 4E7OA 5A5FA 5KYYA 3VC2A 1BDHA 1NYLA 4I8XA 3V1NA 2XZOA 2AEFA 3C8MA 4D5EA 3HVJA 2QTNA 2GYUA 1H65A 4ZAZA 3OPYA 1NOIA 2IWRA 2W7TA 2BEVB 2GKGA 2IH2A 1IUOA 2NV0A 2PRKA 3QPDA 3O1HB 5LZ5A 4HXYA 5JR3A 3ZXSA 5BN1A 1E5LA 2EC5A 1M6HA 3AHEA 1A8IA 3LVQE 4CNBA 1VHTA 2Z1MA 3ILHA 5CLLA 3DCNA 3N0TA 1CRWG 1NVXQ 4K1XA 4HY3A 1G4UR 3RSSA 1M1NB 5KJ1A 3SDBA 3PB3A 5DIFA 1I4EB 4MRSA 3WSWA 4KHZA 4A7PA 5CDUA 2VNIA 4DJEC 4D4JA 5C4MA 4CPDA 2PL5A 5DLDA 1PSWA 1ZA1A 3ITDA 2ZSEA 1JSLA 4Q7JB 5FORA 3PEYA 3QKUA 2JIZA 2PWYA 2PJZA 1T34A 2IXDA 3IRVA 4LXXA 4D44A 4EYOA 5CXQA 3WGTA 3C3BA 5DXAA 3G6WA 1FIUA 3IODA 4YP0A 4WLEA 3PRHA 4ARZA 5JVDF 1JJFA 3DEIA 4MIOA 2Y9MB 3JATA 3G68A 1NQTA 3JYQA 5IJXA 1R9NA 4XQ9A 1Z07A 4LE0A 5ESWA 3ZQKA 4CRWB 2ZIZA 4UTOA 1JIKA 3E1KA 4W6ZA 4YFVA 4AYWA 4CMIA 2QMQA 5C7LO 2QL9A 3NI2A 4X00A 5KBYA 1LI7A 2HF2A 1JUDA 3ROEA 1DX4A 3WRYA 2IY7A 2FRDA 1MQ9A 1UUFA 1Z2EA 2OAP1 3QVLA 2UZ1A 5CP8A 5CFZA 1YACA 4Q93A 3VDXA 4AMYA 2GS9A 3CJTA 1FA9A 2PX5A 4F92B 2WUGA 1VXRA 3TPZA 1DC3A 3KIPA 4MV5A 2V9CA 1E64A 4UTVA 2ST1A 3CFYA 4X7PA 5I7OA 3UJDA 4Z4QA 1B3RA 3PEEA 2CHGA 2IEAA 1WAMA 3B9RA 3JZMA 4ND4A 1HL7A 2RI6A 4XWYA 3AR9A 3QQPA 2NSYA 2WHRA 3DO6A 3DXXA 3ABOB 4GWGA 5FBVB 4G36A 3SHOA 5PNTA 4HTFA 1ZH2A 4U00A 4P4UA 2SNIE 1V16A 3TVYA 1NE7A 2O7QA 1SPBS 3THYA 2GK7A 3IHWA 4RFLA 1IG0A 4OHVA 2Q5HA 4WADA 2E5LB 4F9GA 2WHPA 2D4HA 3WLQA 3ACDA 1RABA 3JWPA 3H0KA 3HDHA 4PQFA 5D86A 4HS4A 3ZY5A 2CCKA 1OJLA 2EIXA 1I9GA 5CX4A 1NONA 1XEXB 2WWGA 1DB3A 5EJIA 1U9ZA 3JWEA 4PQEA 3HLYA 3RAGA 4DNQA 4EF5A 2W9XA 1SD2A 3TAXA 1LDMA 1U2DA 4DPKA 4M9SA 1YUBA 5AVZA 5DYNA 4CLEA 4DQKA 2HHLA 3K5WA 4AY4A 1BU5A 2HLHA 3O8LA 1UAAA 3OPMA 4AX4A 1U28A 2D4AA 1NOKA 4UZEA 4YP7A 1JU9A 4XJVA 3EPKA 3IKMB 1L7VC 1XAHA 2CXNA 2PJUA 3S5JA 3S2YA 2ZBQA 3K31A 3MTIA 3OJCA 1XZKA 4HSEA 4IYRA 4MW7A 1XU9A 3LGAA 4MUKA 1MZPA 1HDGO 2ICAA 4PIMA 3KAQA 4UDXX 3RSCA 1Q12A 3CN7A 4UULA 5AQ1A 3TG2A 2GVZC 3DOIA 3O95A 3EF0A 1ZICA 1Z4MA 2PR2A 5ELLA 4EPVA 5H02A 1DOHA 2NADA 4W9NA 1KDYA 4DA9A 3R23A 4S24A 3PC2A 4XVCA 1ODFA 3HU3A 5AFSA 1G6Q1 2MYPA 2ES4A 4RTKA 2XTMA 2WHXA 3G2NA 2CL5A 4GMKA 2O9JA 1KEVA 1H5NA 2RC6A 5F35A 4H60A 1QIHA 5CYOA 1DO0A 1PX2A 1SB9A 1RYZA 2BGTA 2OR3A 1EGHA 3OM8A 5SY9A 5FBRB 4OM8A 3ZQUA 4TMFA 4TN1A 3K6KA 2EJTA 3UOGA 1QK3A 1BGVA 1ENYA 5A4DA 3J7AC 1LJUA 4PHGA 3DNFA 2IHUA 4ZCSA 4IXTA 1G5PA 5C53B 1QHHB 1IN8A 3VOSA 1SCDA 4XTCS 1RNLA 3ZWDA 3Q10A 3T5PA 4ZIRA 4N01A 2HPVA 3IAM6 2BFOA 3TKAA 1KO5A 1Z6XA 5DX8A 3BRWD 3HKEB 4FSDA 4JT4A 1P44A 3H9CA 5K6RA 4DE5A 1K7SN 2H4ZA 3FKQA 1OGJA 3KHUA 2A5FA 2XMCA 4WI1A 3R4VA 3THWB 3QEOA 1TPZA 5COBA 1NN1A 4HJXA 2AG0A 2NTYC 3FMOB 1D6MA 3SYRA 3QXGA 2C2MA 2C04A 4JXJA 5FOUA 4US2R 3L4BC 3O9ZA 4XKJA 3GW8A 5D5HA 1NQ5A 3D3WB 4EKDA 4D4GA 2NVWA 4EB3A 4CKZA 5JNLA 3OQVA 2O8EA 4JA2A 1I7SB 2QQFA 2WJ6A 1K4YA 4NCAA 2R6FA 2ZBUA 2PH5A 3CW2A 3MWEB 4IJWA 3FPSA 4TMZA 1YNSA 4G5RA 5ALOA 3IQDB 1MRSA 5E95A 1GM5A 3IAS1 2WSLA 3KXIA 3PGMA 2C59A 3R44A 4JR2A 4X6LA 5JSKA 5BSUA 1UC8A 2XMZA 3DWGA 3NWJA 4JWKA 4ALIA 1R12A 4GPTA 4RPGA 2OP0A 5AVQA 2P7HA 4JLKA 4FONA 4KIUA 1QMPA 4H7DA 3N2KB 3GT4A 2YJNA 3IKLA 1X9GA 4KGVA 4RJLA 5FJIA 1XZEA 4JI4B 3SE7A 1EP3B 3KOYA 3Q6IA 4L2IB 3TM4A 2PO5A 4P80A 2UYHA 5HQJA 3NYQA 2NX2A 2C98A 4HFRA 1RIIA 3EMBA 3L7CA 4E5NA 4BNJA 1M7BA 3QIVA 4XX0A 5HQ3B 2IZ5A 1I36A 1NG1A 2ZWAA 3VC3A 4C7MA 4EIWA 3GOQA 3AXSA 5A0TA 1J21A 4TTTS 1YDWA 4QT0A 3F67A 5CVJA 1Q7GA 2JH8A 2ZI3A 1ZR2A 1RRMA 2OHFA 2VYVD 2WFLA 3MGGA 4JSYA 5HF6A 2E6KA 4M1WA 2R6CA 1UP4A 1KAQA 3HJHA 3T95A 4PC1A 2JD1A 2Q1YA 1FW8A 2YHBA 4FKMA 1YF3A 2A92A 3SZGA 1JQDA 2G1JA 4OIFA 1WW3A 4RULA 3OTIA 4RE6A 3L92A 4FNGA 4IIDA 3RJ5A 1E92A 3ZUPA 1QAQA 4ZT3A 1U4SA 1NOJA 3W5HA 5AM4A 3C8UA 1WZNA 5C8YA 2WA2A 1TK3A 2DPHA 5JC1A 3I1JA 1AE1A 1BAPA 4NFSA 3CYFA 3QV2A 2HU7A 1V9SA 3HJNA 4Y9SA 3WDSA 4A82A 4EG6A 4PHHA 3S2ZA 1ORVA 4GLOA 4NY1A 3PUJA 4IWYA 3WK5A 3MC1A 1DIAA 2PLRA 3KKZA 4KACA 4MR9A 4Q1CA 3FYHA 1QPZA 2RGRA 1NKTA 3DEYX 2C0PA 3C6XA 1K86A 4H59A 3E9QA 2OBLA 4ZP1A 3RLFA 4DADA 2C29D 4DEVA 2VDVE 2WFMA 2EYQA 4ENUA 1E4YA 1NM5C 1DO8A 3OEHA 2HHCA 4MNTA 4TN5A 1RPAA 3AX6A 4TTQA 1DNPA 3E9RA 1X1RA 2PBLA 4UDOA 3V9AA 1ZCZA 2F67A 1UBOS 1W6RA 5BMVB 4BCDA 4R8LA 5JJBA 2YKGA 1JLLB 3DQZA 3ILSA 3OQPA 3PC3A 1XKLA 1FFSA 3ZKWB 1Z6QA 1LJ8A 1K8RA 1QIDA 1ESDA 3NP7A 1M76A 3JQGB 2PX8A 4FYYA 4N7BA 4NFYA 4TM8A 4E30A 1QONA 3ER9A 3B70A 3E1GA 3LOUA 3I39X 2P6NA 5CEEA 1DEAA 2R8BA 1J99A 3IAS6 3CPJB 4MMZB 4OHCA 1RPNA 3Q8KA 4M7OA 4I4TF 1QE3A 1KOLA 4Q4HB 4QULA 2OC9A 3ZJYA 4OQFA 3OHSX 4BKQA 4V1CB 2IHYA 1QTQA 4IH4A 3LGXA 2Y4OA 4RFSA 1R4MA 2GLTA 2AW3A 2EP7A 3O83A 2PS0A 4V0NA 3O2JA 2QMEA 4YRMA 4V0QA 1SBZA 2XIQA 4KO1S 4BFSA 2HT6A 3PUYA 2GN1A 1G3RA 2J0SA 1N78A 4BEJA 1BVRA 4YT4A 4BWYA 2AN4A 4ZU6X 2RI1A 3ICWA 1GO2A 1GUDA 2QS9A 3NIBA 5F33A 2NXJA 3M3HA 2BFEA 4C89A 2HWKA 2P40A 3A9VA 3CWQA 2H7YA 3F3SA 1M74A 4AJLA 1I3OA 3EPJA 2F43B 3CSSA 3RF6A 4N3CA 2AR7A 5JAOA 2N0SA 3VR4D 2VG8A 4CMEA 3W7BA 5ADVA 2I4RA 3O7MA 1XXLA 2ODNA 3IUSA 2GVNA 3OKCA 1OC2A 1SAYA 1FVFA 1TQHA 3T0FA 4LJRA 2FH5B 1NWHA 1O8CA 1QGED 4EUSA 5FOVA 3GJ5A 3ZEIA 4YAIA 4IF4A 1JHZA 3PWSA 2VTKA 1LVGA 3ISTA 4H0FA 1M0WA 1ILWA 4AJIA 1ZR4A 3RU7A 1GTMA 2DF8A 1X2EA 3AI2A 3HYCA 4Q3AA 2HC9A 1HQYE 2QAJA 3JQFC 1N1MA 4C30A 3MWKA 3H1EA 4KTTE 4RVNA 5LOVF 1YRYE 3P1JA 3K5IA 1O9GA 3T3GA 3M5PA 3EQ7A 1BCRB 2ERXA 2OCKA 3TRIA 2PQMA 1Z6GA 1W4CA 1SUWA 1R0YA 1W0JD 1D2GA 3A1CA 4N4AA 5DNUA 1TM5E 4I50A 1M33A 1CQPA 5FXMA 1Y8QA 2J1LA 3QVJA 3VQTA 2BR4A 4JITA 3VVCA 3Q9LA 4J3FA 2RHMA 2P62A 3L6DA 4PONA 4DC1A 2C95A 5GGXA 1P2SA 1WSWA 4YRAA 5ITSA 4AKIA 1DOAA 2NO4A 1TMYA 1XXHB 2R4QA 4H2DA 4XWAA 3R7WB 3BA1A 4UHCA 2CKMA 1KQFA 1T5IA 3P2YA 3FNFA 3D8RA 5AYVA 3VTAA 3OETA 2BWJA 3AB8A 1NSFA 5EESA 2ZCUA 1EESA 4LHSA 2ZU0C 4V2IA 1UJ4A 3VHLB 3CB4A 4DDKA 3K0SA 4G2TA 1H4QA 1X0VA 2YWEA 4HGYA 2OCYC 2VT2A 1H8EA 1I4WA 1SB8A 2DHEA 3O4HA 5FWDA 4EITA 5DASA 1XPOA 2A0WA 4HNAB 1DI0A 1N5KA 1TAGA 4J76A 2JZCA 5M2QA 1JA1A 1JVNA 2JIDA 3OA0A 1C3JA 2E4VA 2JJYA 4FIZA 2GNPA 3DR3A 3S5UA 1E6UA 4OJKA 3IEUA 2JA1A 4Y1FA 9ATCA 1BG6A 1N0UA 1R0RE 3W5JA 1JA9A 4I08A 3I5YA 4QUAA 5IZ4A 3I1IA 1PAUA 2ZB7A 3IESA 3IUQA 3UHFA 1RRPA 2A14A 1B8OA 3P9IA 4QTTB 5DV9A 1U90A 4FWBA 5SZJA 4GWLA 3I9V1 1O08A 4MVXA 2QM7A 3T12A 4HDMA 3A37A 3G49A 1FNSA 2PGLA 4N47A 1DC6A 2OQIA 3SFZA 2ZIGA 4EAQA 3HO1A 2W43A 3DMTC 4I1VA 2QJOA 4HX9A 5M3BA 3GJ0A 3SYNA 2A1UA 5EPEA 1D2MA 3CZPA 5IMSA 1E79A 2GAOA 3G23A 1I5OA 5I5EA 5DTRA 3ESYA 1QJ4A 4NOKA 1XFAA 3F6BX 3MFYA 3UC9A 5CVVA 3TLGA 4MJLA 4N18A 4ZD6A 3RT1A 1E2IA 1EUCB 2I65A 3ZS9A 5D87A 3CSUA 4IJQA 5CYFA 4TZ6A 1MZVA 3B6MA 4BU0A 3FLEA 4G1CA 1JI0A 1T9ZA 1UJ5A 2G9VA 5ABPA 5HKOA 5L6MB 3HJBA 1R5NA 4LQ4A 2BEUA 3QMMA 1K5HA 3CXUA 2ZUVA 5EVJA 2ZUBA 4AG3A 4URHA 1ZITA 3OQNA 2G09A 2VPWA 4BASA 1SEPA 3B6JA 5EYPA 3V33A 3ZPXA 4CFYA 4XGRA 3MXTA 1B73A 4UVGA 1YU6A 1Z8DA 3GXOA 1KI1A 1YDMA 4XLZA 1SOUA 1X77A 2ONKA 4GQBA 1Z35A 1C0EA 2JGIA 3JVDA 4JD5A 5EE9A 5I9MA 3JAMA 2ZIXA 5LU9A 3RIEA 5J4YA 1L1EA 1T6XA 4RMIA 5P8WA 2XA1A 1N4DA 1P9WA 3TLZA 1C81A 3PENA 1DBPA 2CNDA 1IHXA 3GN1A 3NTVA 4FNMA 3H9BA 5HP4A 1VBMA 1EWRA 5REQA 4I3FA 5KJFA 3GT0A 2C61A 5MF6A 3K8OE 4NV1A 4KREA 1E9DA 3B6EA 5JSYA 5F7ZA 3OPQA 5AKEA 4PZCA 2VJMB 3HZHA 1PFQA 3EIOA 3AKEA 4KNWA 3V1YA 2ACVA 2XUDA 1QZ3A 1ESZA 2K2QB 3QOFA 4RX1A 3DAPA 1XQ9A 3EOZA 2KX7A 1L4LA 3R3YA 3SNKA 5AW1A 4YP5A 1Y9EA 3E7XA 1HFJA 4LDNA 4LYGA 4COOA 1SHTX 2YHIB 1TUBB 5LJLA 5D6NA 2GB4A 4QRDA 3ZDZB 4J0FA 4E2WA 3NRBA 1U6KA 1MENA 1X3SA 2D7DA 1E2UA 1W35A 4JHXA 1SU4A 1DAPA 3Q8XB 4JNKA 4Y2TA 5L3QB 2HMVA 3QFFA 2XB8A 5DHQA 3OJFA 1K06A 4NNPA 1NVMB 4J75A 1M8GA 3FJ1A 1LQUA 3BJRA 3O8DA 4QL3A 1MX5A 1PJAA 2Q99A 1F2UB 2WVAA 4X92A 3CPSA 4ZQGA 2PPVA 1VG9B 2WK1A 3W5VA 3EUAA 1Y37A 3QV1A 2B8JA 3KEGA 3PQ5A 5JLAA 2G72A 1OWLA 3QM1A 3OLCX 4EAAA 3PE3A 1PNOA 1C1XA 3BCUA 3DZJA 1NJ6A 3EAGA 3VVLA 4BMOB 3ANYB 4NV0A 1R2QA 4PYMA 3A1WA 1B42A 3TLYA 2YBDA 3LE8A 4F1WA 1Q92A 1WXIA 4HH0A 1HYEA 4MWBA 2IYPA 2LE0A 1NLMA 1GSHA 1ZSVA 1G8YA 3VKWA 1LD3A 1PE0A 2HFKA 3KOOA 4G89A 4MRRA 1VKHA 2P27A 4B3XA 4DCNA 1ONBA 3UMJA 3N05A 4O2LA 4XJTA 1PUIA 3QBTA 4D8VA 4FGWA 3SVTA 3AWIA 5CFPA 3W78A 3JQAB 3LT2A 3HO6A 4HP8A 3OQOA 4J49A 3ZJUA 1GQQA 4W6QA 4MQEA 1VCNA 1XN4A 2IZ7A 4KQ2A 1KMIY 4MW6A 4D41A 3ZIAD 1O8BA 2EFDB 3BEDA 3B3JA 2IOYA 3HBLA 5BV8A 1UKVY 4OMUA 2X3FA 5K3FB 4ZC8A 3KQMA 3SQOA 3HXMA 3ZC3A 3LNTA 4IUDS 3RRNA 1OGYA 4ZJZA 3AEUB 2PJDA 2IXBA 3FMVA 4LHVA 4OP3A 2FMFA 4X90A 1QHXA 1XAIA 3LC1O 3ICQB 1UMBB 3IBFA 2Q6KA 4MITA 4CTNA 2E4AA 4NH4A 3R0ZA 1S1CA 4XGKA 5JATA 4GVLA 4JNCA 4KUHA 4MKRA 1CUCA 3BK2A 4ZT6A 5B30A 5ALZA 2HQRA 4EX6A 1ULBA 3FE2A 1E32A 4F4DA 2QE7D 1V8ZA 2R47A 1GLGA 3H2BA 1BE8A 3MBIA 5B7QA 2CNWD 4RVOA 2UUAB 2VWQA 2FRXA 2ZB2A 5HYVA 4FC6A 4R0VA 4D2IA 3ZHBA 1XJWA 3T4EA 1LPSA 3U9SA 2I9KA 4KW7A 2BFFA 1M2VA 2C2YA 3MRXA 4O8CA 4KSYA 2WAOA 4JP1A 2BMJA 5CH8A 4IDQA 3SEZA 5J58A 3R20A 3JQ7B 3FHOA 3ZBTA 4LJ7A 2BBOA 3LT0A 1PWEA 1NUTA 1T10A 3HSKA 3PF8A 2NUAB 4ZV7A 3DBHA 4DA4A 2P9TA 2V65A 4FFBB 3LP6A 3KOZA 4X3OA 1J8YF 2D0DA 4IX9A 5F1KA 5B1DA 5A6SB 5HNKA 2JPDA 3DMRA 2Y6VA 3BHIA 3RJTA 1SUDA 4X84A 2GHQA 3VU0A 1QOZA 4LF4B 3DR5A 1QE0A 2JJ2A 2O5RA 5CRIA 3TRJA 2JGDA 2NVOA 5AXDA 3ZH2A 3RSHA 2MSEB 2G77B 3LDGA 1EGMB 3PQ2A 4FDTA 3LDHA 3D6NB 3LECA 4DUGA 3GZNB 4FLFA 3Q72A 2I6GA 4LDPA 4UAJA 2R7AA 2NO1A 2RAFA 4TQAA 5ER9A 4IS3A 5JV5A 1FDVA 2NGRA 1G1AA 2A5GA 2FUCA 2X3UA 3FNHA 3KXLA 3SF8A 3DLIA 2BMEA 3OBIA 1EI9A 5KHAA 4K87A 1EXMA 2UDPA 1Q19A 2J31A 1NJGA 1NBWB 3GJ3A 3A11A 3LX5A 4B7CA 4M86A 5BW4A 1B0UA 3S3TA 3FBTA 4ZI2A 1G6OA 1RJ9B 2VUUA 1DG3A 2X6RA 2ZJBA 4OMFG 1KI4A 2PS9A 2ODWA 4OREX 2FHPA 2YFQA 5B1IA 3NDBB 1C30A 3TK1A 3DV9A 1XMSA 4BV8A 3OZFA 4D6XA 4K5QA 3K9BA 4GMXA 1BN7A 2QM8A 3CGGA 3RBXA 4YRBA 2IYFA 1HNXB 4PR3A 3OM9A 1V5IA 1NP3A 4MWCA 1OFHA 1Q0LA 4XR9A 1FFEA 4HVCA 2QXUA 3RC2A 4ZQEA 1RQLA 3GEMA 2A9PA 5JS6A 2GFIA 2O2DA 2QZJA 2VJPA 4HGQA 4KP7A 4Z8YA 3HXTA 3Q3IA 2VQFB 1MKYA 1V95A 4M7RA 4LA4A 1BN6A 1U7UA 2HIHA 4WCFA 2HQOA 4EH1A 5HM8A 4JI0B 1QYDA 4DQVA 5KNDA 1M8PA 3F6CA 1GGHA 4ENTA 5T7BA 1ZN8A 1ODCA 1ZCAA 2HSWA 2R6HA 2Q7DA 1RCUA 1M5UA 4LFBB 1RWVA 1PNVA 4G8CA 4KWTA 4IOJA 5FADA 3SIRA 3WRWA 2JJQA 3WO1A 4FD2A 1JG1A 2G8LA 3SJ7A 1KWGA 3MOIA 3DE1X 2ATVA 3G1TA 4HB4A 2AFIE 1EFVA 2PKQP 5EFOA 3MT0A 4JI6B 3IOEA 2QM0A 2CDRA 3MJVA 3TZQA 4YALA 5E3IA 1K5GA 3INRA 3KHTA 2L18A 5C8XA 4EQZA 3ED1A 3KQHA 3OF5A 3P0JA 4ZTBA 1INLA 4AWBA 3QXXA 4GOMD 4BLWA 1RWKA 2BIFA 3DYVA 4OQDA 1G21B 4DXHA 4GMFA 4RTQA 3TLEA 1ZIPA 3LOPA 5SY6A 1YS9A 3RASA 1YONA 3G59A 1JLHA 3PSAA 3TB4A 1XMXA 1W19A 3K6SA 3E8XA 1D8TA 2X42A 2QTGA 1L5SA 4AECA 1JHXA 3DVRX 4TLAA 2AZMA 2H1WA 2X7XA 3I8XA 5CBPA 3J81A 4Q7EA 3GLIA 4I99A 2C58A 3GLFE 2FZKA 3GA7A 1GFZA 3KEFA 4W82A 4QELA 3PQDA 1IQRA 1E62A 5DHTA 5I7WA 1U7DA 4FOPA 1DDIA 1GFIA 1G0OA 1W52X 1QIEA 1GKKA 1KAHA 3WBFA 2DH5A 5T8KC 3VVMA 4F8YA 1T29A 3OWXA 5THXA 4J94A 3DGFC 3M6UA 4W99A 5CT9A 1NV8A 2OGSA 1KR2A 2EFYA 4IKPA 3S99A 4XR4A 1TF5A 1VHJA 2G5PA 2HLNA 3OFVA 1NRXA 4B35A 4DCSA 5F7XA 2ZTHA 2D1QA 5BNWA 1YJAA 1GG5A 1FRZA 2OGZA 3MD9A 4FHFA 4IIXA 4KRYA 5EXDA 1BXZA 3LUGA 4GR9A 1X8KA 3NPAA 5I48A 2ZJ3A 3NAMA 2RKOA 3UGQA 4XFDA 4YBZA 3TSAA 1MVOA 3DT6A 3QE2A 2MINA 5BR7A 5IVKA 1H0HA 2HOQA 4QBFA 5KNBD 1LUAA 4CF4A 3ZK8A 4CQMD 1C9JA 2JLQA 2P90A 3IV6A 5AIBA 5KTNA 4D4HA 2G3YA 4IGIA 1FJGB 4BE4A 4JVNA 3KJQA 2ZYGA 5EMHA 2UZ3A 4F84A 2BRUA 3EFOB 5BWBA 3QBDA 3COYA 4MRAA 2XNHA 4H3HB 2ZI5A 3EWAA 2ZYSA 3BMNB 3AI7A 3T1NA 1GYPA 2CV1A 2EXXA 3L82B 4RD1A 1IBSA 4BWVA 3EIQA 5EXTA 2O8BB 3KKOA 2V6BA 5FOXA 1RYHA 2C9YA 1N2SA 2DZDA 1MJNA 4EGQA 1GADO 4IFIA 1XTTA 4V3BA 2AHRA 2QF7A 1P1BA 1CJVC 2C2GA 1KR5A 2OA0A 1IMJA 2ZR9A 4BGVA 1NJ1A 2DRIA 3FWZA 4IMPA 3I9FA 3RARA 1G5HA 1NDHA 1NF2A 1VLQA 5LP6A 3EGCA 3QZUA 4YLEA 3NHMA 3A6DA 2V58A 1AKMA 3U48A 2V6IA 1SHUX 3LUCA 2BMWA 2O05A 1XF9A 3M5DA 2AYXA 2J59A 2JJMA 3RRZA 4EOGA 2NM0A 4QYWA 5DSZA 1A4UA 3ZGOA 1FVXA 5ES3A 2O5CA 1AZSC 1KP2A 4NBWA 1RKQA 2VP0A 3IKTA 3F4LA 5JWOA 1QFYA 2A30A 1MC1A 1A9ZA 4MMYB 2EWWA 5CA1F 3AHJA 2C9OA 1KF0A 1KVTA 1J39A 4XWOA 3KVVA 3OESA 3T5TA 3P4YA 5JAHA 4KH0A 1E6CA 1DFIA 1JQ3A 4BP9A 1P1IA 1U9JA 2EERA 1H9AA 4E5SA 4K05A 2ZRBA 4TVKA 1CULC 5IVIA 3DKKA 3S40A 3DAYA 4M98A 3GN2A 5JOQA 1GT6A 5JYDA 3SKYA 3QG1A 3MSXA 4W7HA 4E21A 3MQ2A 1TPYA 4LMBA 4MUGA 1QGUB 2XOEA 4UU7A 1VE1A 3AIOA 4DLTA 1VSUA 5BR1A 5J9FA 2ZJ0A 3I83A 2X41A 1HDYA 3A70A 3OQIB 4Q47A 5E8RA 5KSOA 4P5PA 4D0RA 3WHIA 1BVYF 1IJKA 3B6IA 3RADC 1R6AA 4B4WA 5LLSA 1SC9A 3C1TA 1M2KA 4G1VA 4LXYA 1N7HA 1SVSA 1QYXA 2GHTA 4Y2YA 4P7BA 1E69A 4IJUA 5JY1A 1WB6A 2QJRA 4I19A 4PQRA 5HCNA 3OBBA 3UO8B 2ODTX 3QA9A 1P7VA 5DDIP 2XRYA 1P0CA 1CJCA 3CJRA 2YIVX 2WE8A 3IPXA 1PYOA 3QEMA 5EKTA 3RFVA 3WB1A 5LYJF 2FX5A 1RQNA 4BC0A 1C4KA 5CD1A 1M1XB 4AROA 2R1UA 3DZ8A 2FCRA 2H1IA 3O8QB 4MJXA 2Q1UA 4PYQA 1M34E 2V4ZA 3CNNA 4ZOCA 4UUOA 1BEUB 4P8RA 1MA3A 4X8HA 3V97A 2ZBFA 4CT4B 3F5FA 4MZDA 2QG9A 3DE6X 1PJRA 4NPCA 2QG4A 4QE3A 3FUTA 3VKVA 2RARA 1F2VA 2NZVG 1EFRA 3WL8A 5FYQA 3HR8A 1JYFA 1WL8A 5HHTA 5IJWA 4PRLA 3HCFA 5HA5A 3BERA 1R9GA 3WO0A 5K5EA 1C8KA 1GL3A 3N8KA 1Y9DA 2KW5A 4CFSA 4D8UA 5EKSA 4YRDA 3K1AB 4YUWA 3TD9A 2ZT8A 1C3OB 4UBJA 3QNMA 4ZOBA 4B6JA 1M2NA 1F3OA 2B4TO 3FD8A 2E55A 1EX1A 3GIWA 5FV7A 2CV2A 2V1XA 4IHJF 4WW0A 4PO1A 4G4SP 1WXXA 3G2IA 5DEIA 3R5XA 3EZFA 4QPNA 4Q66C 4W1RA 3T38A 2D13A 4JUBA 4ZU3A 1ZIDA 2L0XA 3BIFA 4RPIA 3TZKA 1N7JA 4GVXA 3SJUA 2EFGA 3UAOA 3ZE8A 2C5BA 1WDWB 4YDSA 4N5LA 1ZOIA 2VDQB 3KLNA 3VO9A 4OVKA 4EA8A 3GLTA 3K09C 5JWRA 1CUGA 4XXHA 1ESNA 5FTMA 1VB5A 4QUHA 4TTVA 1X38A 5AXCA 1ORHA 3I32A 4UD2A 4FOOA 3G0DA 1EZZA 1HKUA 4Z7QB 2QI9C 3GFFA 1WXQA 3FVVA 2M6KA 2ECOA 4AMVA 4B75A 1WKCA 3BX1A 2GBIA 5IEBA 1Q1AA 3ACBA 3I6YA 3TM5A 4V0MA 4MJ3A 1FMCA 1DC4A 5A3SA 2WWRA 3HJUA 4HDRA 3FA2A 4LWQA 2CSUA 1RC1A 4JEMA 4M9CA 3TIVA 2GDJA 2F8TA 1YFJA 1SK9A 2F3SA 1DXOA 1ZN9A 2HEIA 3L7AA 1KI3A 5SV2A 3K30A 1ICEA 4IXNA 3OWHA 2GK4A 3JASB 4DJTA 5KOIA 3NB0A 2DAPA 2DHQA 4YP1A 2NQTA 1S02A 4Y2UA 4AF6A 1PG2A 4PU0A 1N8NA 1WQ3A 2ZRJA 5ALYA 2JFYA 3DPUA 3VH4A 1BXKA 3LL4A 3P2MA 4NAVA 4Z9FA 5IFKA 4RHTA 1HXHA 5KVSA 4BWFB 1NNI1 3LQYA 4V0SA 7GPBA 1CZKA 4HYQA 2Y99A 3OQJA 1MVNA 3H86A 4NE7A 3QLVA 2J30A 1O6GA 3TSYA 3QVWA 1PW5A 1QG6A 5CB8A 4CETA 4INJA 2G1AA 2DH6A 2XBUA 5K8JB 4FCTA 4I1YA 4WSOA 4K8OA 3QFTA 1JH8A 3I2YX 2NU8A 4FHEA 2PUTA 3V3KA 5A5VA 3COPA 5FHRA 1NY5A 1EEXB 1WMDA 4CKXA 4BNWA 1MORA 5MFPA 4H9GA 2PT6A 1DG1G 3BD7A 1DLJA 1O03A 4PFQA 3WYCA 1AUVA 3DT9A 1ZK1A 2Q4BA 4D4LA 4OF4A 3OPVA 4PEVA 5J2TF 2I71A 1QLJA 3MK31 3W2TA 2Z2JA 5JSFA 2A0UA 2R68A 1AOXA 4CLOA 1ZRMA 4H4EA 2YZKA 3CUUA 3FGPA 4PSVA 4MUEA 3V8NA 2VUIB 4G0YA 1JXOA 2GD0A 4O2RA 4PNEA 1FDWA 4B33A 4XDGA 3RC9A 5BVGB 3TZ6A 5KYYB 2JS7A 1PJTA 1UR5A 2QX9A 1LTHR 4IM7A 1MJHA 3QEAZ 1JSZA 1N9GB 5FUBA 2CKDA 4AMBA 4REMA 3TW6A 2CUTA 1GR1A 3RG2A 3OPYB 1GSOA 2M2IA 2IGTA 5EJAA 3AM1A 3R0XA 4L5CA 4WBSA 1DAOA 3PDUA 3L49A 1VJRA 1TO6A 5TMDA 1T15A 2VP6A 1YJXA 3LLVA 4QVIA 1IN1A 2OCIA 3MCVA 2CVPA 4WINA 5SYAA 5C8DA 2Q3BA 2HIAA 4TKVA 4Y98A 2DM6A 3LU1A 4FJ0A 4H1VA 3O3CA 4HMOA 2HX1A 3VM6A 5L7TA 4HX5A 4EG5A 1XA4A 4I1UA 4AKEA 2NZXA 4DV7B 2WTNA 1EQAA 2JBAA 5E4YA 2REQB 3CX7A 4FVTA 1FJ2A 3GAMA 1T2CA 2A4MA 1SIOA 4JI8B 2HYDA 2C7OA 1K97A 1E3TA 4PM4A 1L5HB 1CJKC 1E2FA 4WESB 1A5AB 4LQDA 4S2UA 1Z75A 2OQVA 1W1UA 2Q5FA 4LVNA 4J6EA 4RABA 2GN9A 3SHQA 1Z06A 3NBKA 1QO0D 3KUUA 3DPSA 2GEBA 2JKVA 4JS0A 1T4BA 3I04M 4YR9A 3LFTA 1VMKA 1WKBA 2OV6A 3CKLA 3QKWA 3SHFA 4ND2A 2YYSA 4ARZB 4BO1A 2IH4A 4G5SA 3I8OA 3JATB 2GBLA 1XMIA 1CDZA 3E23A 3HVHA 2C54A 4LXHA 4EQ6A 4YRKA 1OYWA 1QFMA 1EVQA 5D3MA 3VX3A 1L4HA 3D64A 2Z6QA 4N48A 2ZT5A 2QNIA 1T1EA 2IYZA 3EVTA 3QNUA 4I4TB 3E7PA 3OJLA 3VPXA 3GUHA 3NCHA 4CE6A 3SZUA 4DEXA 2EGHA 3LSYA 1G20A 1U8AA 5EMNA 4G6ZA 2GSDA 4JOSA 2E7ZA 1RZUA 2FTKE 3GUCA 1XNHA 4DWWA 4RIHA 3EIEA 3MS4A 4N65A 5J4LA 5DI9A 4D3ZA 3JXEA 3NVMB 2ZJZA 3SZ3A 2QRVB 1EWQA 1XLWA 2HJWA 3AY6A 3VU9B 2JFPA 5HOEA 4LVOA 3HFGA 3KJZA 1DCTA 1HPLA 2XQKA 3RREA 1HYGA 2QQ0A 4AJ1A 2VSXA 3AP3A 4LNAA 4ERNA 3AEKB 4WY8A 1JECA 3JAKA 4MA4A 3RIMA 2FMHA 1ZVQA 1U04A 3OEED 2E5WA 1FP6A 1PLLA 1XROA 2A0YA 5JXIA 2A84A 3MTDA 4JY7A 1C41A 5WRFA 2VO1A 2YZMA 5DH9A 4H77A 4L5YA 5CYPA 2YOGA 1NBMD 4TROA 4AZSA 1MQSA 5BWLA 2IRWA 4HTFB 1M6NA 4Q1EA 2BDEA 2TS1A 1YE8A 3OKFA 4HSGA 4HXGA 3NBUA 3FSRA 3THYB 4EUKA 3VSEA 4RELA 4LOKA 4N49A 4RTSA 2DYKA 2V54A 1DBQA 3HEBA 3TTVA 5K0EA 1H1LA 4Y6OA 3L93A 1Y1SA 1H4TA 2RMKA 2WHPB 2GN4A 1G7SA 2WF6A 5A2GA 4WNAB 4L27A 2W37A 1XLVA 4RLQA 5K2MA 3T7CA 4L8VA 1TIPA 5MGNA 5T64A 3LA6A 2R6JA 4A16A 4QFCA 5K01A 1Z2OX 4MQMA 4PZAA 2ZXEA 3BWYA 4G65A 1QU3A 4G84A 3U9LA 5E2BA 3F6YA 3NANA 4FCWA 5G53C 4F3CA 1KJJA 4UHFA 5DM2A 5BWMA 4CL0A 4NBTA 1IVYA 2DG2A 1TJ3A 3HB5X 3W77A 3LUJA 2KS6A 4E6EA 4DOMA 2BJWA 2I33A 4PSCA 2ZRHA 1V4VA 3UKJA 1MA0A 2C94A 1E63A 1Z0KA 2BGJA 3S1AB 5LD2B 3QFSA 5H8WA 4P84A 3EWSA 4XSGA 1T9KA 1JG3A 4Z86A 4RVCA 1Z4KA 5IANA 3GFGA 4KXUA 3V4VB 4O33A 4BLQA 4B71A 1DAKA 3ILXA 1FXWA 1L9XA 2W70A 3VH1A 5A5EA 2WQ7A 3I4CA 5L9AA 2XWBF 3KTFA 2XUIA 3UJCA 5IZCA 4M89A 2VATA 1Z7WA 3BK1A 3TOSA 1KPIA 1X7ZA 2G8NA 4EUNA 2HA0A 2H2WA 3HM2A 2DR2A 5MFZA 8OHMA 1MN6A 3UF0A 4NNJA 4GG1A 2KQUA 4D98A 2QI9F 3U7IA 5DGIA 1SVWA 2EEPA 2X5JO 5EJEA 1TJ4A 3OA2A 1SBCA 2FWPA 4L5AA 2J5XA 4QQNA 1UBMS 4R7TA 2G82A 5EWMA 5IUNC 1JJ7A 2ZJYA 5E1BA 1Q3TA 1EG7A 1VLVA 4HDSA 2AQIA 5D8DA 1CS4C 1WPQA 3GJ6A 4RZIA 1P1JA 1ZAYA 2RDMA 2DQYA 5IULC 3T0GA 1Q0SA 1KMHB 4R5HA 4NU6A 1KFKB 3UXYA 4R1OA 5AVXA 4RYDA 4PWYA 2VUSA 4ASUD 1SUFA 5EZSA 1ZA2A 1PEDA 5G4KA 5IXYA 1HNZB 1A9OA 2FSHA 4RV5A 3KUKA 1SPXA 3D3EA 3BRWA 1YL6A 4CIBA 4OYRA 2E87A 1U7ZA 2JCYA 2OOKA 3G5MA 4R7GA 4RJKA 3UGJA 1Z5WA 3B7GA 3C39A 3NRCA 1NPDA 4LOJA 2X23A 4X3CA 1Y1TA 1LI4A 3HU1A 3FWNA 3BDVA 5DK4A 5FBLB 3E5MA 5B58C 4K6OA 4EY5A 2O7VA 3DAFA 3IR5A 1I7DA 1F51E 3E70C 3L9WA 3PQ3A 4CKYA 1VPLA 5AOBA 1I3KA 4BNDA 4EVRA 3NBFA 1WTCA 1Y3IA 4HH4A 4P82A 1G3UA 2UYCA 3GNLA 3K9QO 5T57A 5J43A 1GQ2A 3CVOA 3G8AA 2VHQA 2OZVA 3EFHA 3HPQA 4HYTA 4ZVMA 4BAZA 3UA3A 13PKA 1P7WA 2O2EA 2WZQA 5LUAA 1BH2A 3PFGA 4D5GA 2Z2KA 1M2OA 5F7OA 4LMAA 1OAOA 4U7FA 5BYAA 3DT8A 1EDBA 1VA4A 3EG9B 2AI2A 3PXBA 1ZQ9A 3L8MA 3EAFA 1UQUA 1C8VB 1L5MA 2IY8A 4KYVA 2QBYB 2QLTA 1B8NA 3PCXA 3EH2A 2EL7A 4JL5A 3W9UA 3IXLA 2R5FA 3UH0A 1MEOA 4HRYA 1APBA 1GV0A 1L7BA 1ZC4A 2PV7A 2QOEA 4YMWA 5D6OA 3ZWPA 5BUSA 5MGBA 4JKYA 2ZSIA 4G1MB 3LH5A 1X87A 3SR0A 4XX0B 2O19A 4UVEA 1Q44A 2FVXA 3QKSA 5LMUB 3MJDA 1M10A 1PSZA 3JTEA 3BVPA 1TYCA 1SWWA 4NAUA 5H16A 2H48A 2W2TA 2JBWA 3V9PA 3WWEA 3ZH9B 2WLSA 4B3SB 8GPBA 5C46F 1WXFA 4ML3A 2J3EA 3ZQ6A 4FWTA 1ULSA 3FUXA 2XDYA 3MCUA 4CM6A 3C85A 1FVHA 2W93A 4L95C 2AXQA 3NBQA 2OP1A 1H6DA 2VYVA 3ZQ4A 2C42A 2UYGA 4HUQA 1PZFA 1BH6A 5EHXA 1X7XA 4MQ5A 3F73A 3W4JA 4XVUA 3OCCA 2AH5A 1Q0PA 3TOZA 1QH9A 4I1PA 1IY2A 1E0DA 1IUNA 1XNQB 3R4CA 4RKYA 3AUAA 1K27A 5HUHA 2PMFA 1UP6A 1ISJA 3L7YA 3PNQA 2WT4A 3YASA 5FWAA 4EYGA 1KY4A 2X9GA 1RTKA 4HN2A 4O6VA 4EZEA 3X1KA 5C9ZA 5HIAA 3U7GA 2N42A 5JD5A 3MGCA 3IUEA 1R15A 1X8LA 2E4ZA 4CODB 1NURA 4GO1A 4PZEA 1E1MA 1SOWA 2WC1A 3UTCA 2F59A 3VH2A 2FK7A 3N2GB 4B1FA 5CT4A 2OGUA 1SC3A 4K03A 4NZZA 2JGNA 3CUTA 1FFYA 2JCBA 2C2KA 2RC5A 3AL3A 2ZSBA 4LDQA 5THKA 3BS4A 1BS9A 3LRXA 3RYIA 3P9CA 5BQPA 1MW9X 5F5LA 3AJ8A 1PZHA 3PHBE 1CKEA 1L6RA 2VK8A 3FX2A 4NTZA 1U7PA 3BGDA 3FFWA 1VBFA 2FR0A 3DE7X 5E0OA 4CCYA 4DCPA 3OOHA 4QXMA 5F5XA 5IBRA 3IUNA 2HA4A 4EW6A 4YRIA 4YECA 3TBFA 1IN6A 3BM5A 4Y7DA 3NS7A 4WIAA 4C3ZA 1IJFA 1U8EA 4JJAA 4MYTA 4D57A 3CV3A 3H8SA 1CZHA 5FI5A 3GDOA 3JSAA 2QRHA 1SU7A 1DAGA 2F4NA 2P9QA 1MEJA 1RLUA 2CVHA 2OHGA 1ZVMA 2VDWA 3NU1A 2DY1A 4GOJA 4JXKA 3QXJA 3ZZNA 1XEWY 1OXKB 1LLQA 1GXSA 1JKJA 1R4MB 2D0IA 1IJEA 1XCGB 2EJBA 2YJ5A 1J2EA 2NU6B 3DLAA 4PRZA 4TYMA 4YMHA 5KX5F 4PPGA 1MOZA 3PE4A 4FBGA 5EKDA 3IUYA 3MCTA 4OHPA 2WHYA 4GBMA 4PCVA 5DBEX 2PUVA 3HO8A 4FLMA 4NPAA 4M1TA 1RLJA 2XJ4A 1U9YA 1XTQA 2HXGA 3DHYA 4ED9A 4G26A 2WTAA 3KE8A 3MS7A 4NH0A 3IYLW 1U02A 3RWBA 4B4UA 2YVQA 2KLBA 5I8ZA 1T1GA 2AVNA 2FZ5A 1M66A 4LPSA 4TS4A 2BFEB 1HT1E 4OOEA 4Y2JA 4FSHA 3T5MA 3WS7A 4TLLB 3FWHA 2G4CA 3QLUC 4NBKA 2P6UA 2CD9A 1IPHA 2I3GA 3A04A 4MP3A 2FMKA 3BXFA 4FJ1A 2OLEA 1U31A 2IEZA 1IHOA 1R0LA 1X39A 2OG1A 2W2VA 2Y0BA 3TSCA 3I6MA 4M54A 5BN5A 3AJAA 2B98A 4IRXA 2ZR0A 1EVKA 3OZBA 4PXAA 3VR4A 2J3LA 3CT4A 3VI3B 5JNTA 2GN6A 4ND5A 4Q3DA 3OCZA 8LDHA 1BVUA 3CZRA 4PGMA 4M1QA 2KE5A 1Y9AA 4HQKA 4AO8A 3RO7A 4JIGA 3P2EA 5CDFE 4BAGA 4TT3D 3AFMA 3ZCPA 3PUXA 1ZJWA 4FHZA 1SKAA 2JGKA 3INGA 4ZI7A 2QUAA 1XRPA 4MGIR 5LJIA 3LHSA 5JAUA 1D03A 1Z17A 1U5BB 4YRJA 3KQTA 4PXSA 2OCBA 4WZBA 4HRVA 2P4UA 1HE1C 2QGNA 4Q01A 4Y6RA 3VPSA 1Y8QB 2I3ZA 2V59A 4FGSA 3A10A 1XN1A 4GDMA 3IXQA 5DCLA 1PJLA 2RGBA 1W0JA 5JSHA 3NC0C 1TTPB 1GARA 1PV4A 4OLBA 1GA4A 1G1MA 3O84A 4YDQA 4W4TA 3HFRA 1CPYA 2OXCA 3VV3A 4MRMA 4GQAA 1SVMA 2B1GA 2GASA 1RR6A 4DYDA 2PUAA 4GWKA 4MGZR 4RZQA 4QYSA 2QVZX 4CKEB 4F56A 4ZA2A 5I4IA 1VE5A 4BGIA 1RMTA 3L8YA 4UEKA 2A7QA 3P0HA 3D7KA 4D6YA 4C7XA 2XMBA 1BRMA 1BQ4A 2PWBA 4JEUA 5FLEX 4YRGA 2X77A 4AKGA 2B30A 3CKMA 5BV1A 2RGXA 2ZYHA 4Z4IA 2ANBA 3H2YA 4JELA 1UXIA 1ZZEA 5TY0A 4TV8F 4PFJA 4C88A 2DECA 4R9NA 5LWHA 4WKBA 5LXTA 2D1FA 5FPKA 2GERA 2PLAA 4JASB 5FI1B 1Q16A 4BNHA 2WU1A 4DNOA 3OT4A 4I9FA 2YQ5A 1EE9A 3S81A 3L18A 1A97A 3TFOA 4N9WA 4HAYA 2JAWA 2IZZA 2JAUA 4J03A 6PFKA 1N32B 4YV2A 1S89A 3KCQA 3NYRA 3RW9A 2IZ0A 5KCMA 4ZWNA 1DT3A 3N8DA 2E18A 3WK7A 4Z7NB 2C7PA 5JH7F 2GXUA 1J7KA 2GVDC 3WK6A 4C4YA 2WP8J 3AQ4A 3E03A 2GSWA 4CM7A 1GUBA 1Z0DA 1FP7A 3U3MA 4TXLA 2B1QA 2XCOA 3D6FA 4HB0A 4JP5A 3CLRC 4PE5B 4BJHB 3CO5A 2QVYX 3K96A 4BQPA 4KBGA 1NBHA 3R09A 2R6ZA 3ETLA 3AUSA 3GRPA 1LSJA 1KYZA 2G06A 4TL6A 1HDIA 1KZ9A 2SKCA 3QE0A 3QVKA 1ZIXA 2R7MA 1NP7A 4Q02A 5AK6A 3PTLA 2ABWA 1ABBA 2AMJA 2VHXA 5B2FA 1H4VB 3TLGB 3UG7A 2BP7B 4RTLA 2QUZA 1A5SB 3SS7X 1U2TA 5BSWA 3CNQS 3RU9A 3E7WA 1OLUB 5DGTA 2A0XA 3QH4A 3ZE6A 2OLKA 2QTLA 4DLSA 2KYRA 1E6KA 2M6SA 1MX9A 2CYAA 1WD7A 4UAGA 3TR0A 1DQSA 2BEUB 4JLAA 4KVAA 1QRSA 5J5AA 3TGWA 5TRTA 4AW9A 4F4IA 2AN9A 3SX0A 2Z2YA 2LTAA 3E2IA 2YWCA 4PCUA 5LQUA 4WV3A 1A98A 2UVQA 1OH7A 3L7DA 3WI7A 4TRNA 3WRVA 5IUJC 3EVEA 3EXHA 2G1KA 5C3MA 3LGSA 3PVCA 5E1OA 2HRDA 1MNQA 1YBHA 2P5TB 3STHA 1W2GA 4CCAA 3NOQA 1EXVA 3H2HA 3GGJA 2ZAMA 4IGEA 5JPCA 2QLBA 3SC3A 2AF4C 5DNYB 4JIMA 4DB2A 1MTOA 4H35A 3NHJA 5EXXA 4P0QB 4H7HA 2FRVA 4RD0A 2KBFA 5DGCA 4B3BA 2GYVA 2FWJA 4TKMA 4LVUA 4XDHA 4BNVA 2VC2B 3WNCA 3MA0A 1KFEB 1VFPA 2QY9A 4QGAA 1UC5B 2XAUA 4ACAA 3AUYA 5FEUA 2FK8A 2GCOA 3C74A 1M5RA 3AVQA 4UATA 5A4IS 2VWGA 1A4IA 3M0EA 1VKZA 3OIWA 4ICIA 4L76A 3BGWA 5J40A 3CISA 3ZCUA 1GPLA 3IMKA 4RXMA 3AU9A 4KTVE 2FUKA 5ALDA 5HFAA 4ALJA 2VK4A 2WR8A 4QOIA 1TUIA 1T0HB 5EUMA 3VKFA 4F2GA 1YVPA 4U9IS 3H9JA 3H2ZA 3DPIA 3HFSA 4H08A 1N9KA 2YS7A 5KQRA 4UMDA 3KO8A 2YNMC 3DDOA 4V39A 3NWPA 4XUCA 5EJMA 5AK3A 4YHBA 1A8SA 3II6X 4CIDA 1T9GS 2LVBA 3AH8A 3IMFA 2GZDA 3TX2A 4TVSA 5LP6F 4H3SA 4YCLA 2POCA 2BGUA 3B3GA 4A2QA 3RS0A 1YKGA 2W11A 1COWD 4XB2A 1C1XB 4KL8S 1PFVA 2PVCA 4NL4H 5BN4A 5A4MS 1R0XA 2W6JD 3QUQA 3OFSA 1PS9A 4KO3S 3DOUA 1X7WA 1EXNA 1AA6A 3PFBA 2LD4A 3KOMA 3Q7SA 3BH7A 3UCEA 2P1DA 4DCOA 2Q7OE 2IS6A 2XY4A 3OURA 3TNFA 5EWJA 1UK8A 3KJGA 1JSXA 4IXWA 1GCAA 5E7JA 1P29A 4LYEA 3U6KA 1OR8A 4S2EA 1GPWB 3EOAI 4MQEB 4K2HA 4FE7A 1PEAA 3AJRA 4UU0A 4TWJA 3FGNA 2SCUA 5CA1B 2VNSA 4D02A 2IEYA 4OFBA 3SJCA 2RKBA 5IHPA 5LR6A 4J0GA 3RRYA 1T4CA 5G41A 3WQQA 2AJBA 5ISMA 3AHCA 1PSDA 1WA5A 3ZIAA 3AF3A 5C8ZA 4ZOAA 1TVKA 2I62A 3EDMA 4QUIA 5BOSA 1QDEA 4B6PA 1EB9A 5EXSA 3UMVA 2OB1A 4YRQA 2IYEA 3Q5DA 2QQGA 2QDXA 4BNXA 2H57A 5AMXA 3UWDA 3R0QA 1JBEA 3ORHA 5TSDA 2GJSA 4NS1A 5F2OA 3RROA 4B2PA 2X5NA 1E2PA 3L6UA 4HEJA 3VNBA 4K9PA 1XU7A 1ZEJA 1N92A 1USIA 1BWRA 4ILKA 1W48A 4O4HA 3L4SO 3IQXA 1GNVA 4P22A 5DNAA 1EFUA 1YRLA 5E6SB 1LDEA 1LTKA 3IBSA 1Y8CA 2ZJFA 3RS3A 5JC8A 5KREA 2QE7A 5CCBA 1FLDA 4G5FA 4Y2VA 1J49A 3ZLJA 1G5IA 1K8YB 2BM1A 2C2ZA 2CNWA 3EVCA 3PXUA 3LKVA 3QW4B 3CX8A 1X1EA 4RLFA 4WJKB 3KYCB 1OTYA 1W49A 2E1RA 3WFJA 4YWHA 3AGQA 2WIKA 1KU6A 4PNZA 2GTHA 5LB4A 3DBHB 1FFHA 5K6TA 3K6RA 4Z51A 3BH0A 3EULA 4KQ6A 3SD7A 2FXIA 3OIFA 5LYJB 5BR8B 3A1TA 3SP1A 3K0EA 4LKOA 2I29A 3A05A 4UE2A 1CHNA 1K4KA 4B9EA 4YTEA 1QH1A 3WRXA 2Z30A 4RHCA 3UFXA 1TT5A 1LPNA 1SCAA 3KEMA 4K3UA 4HZIA 4QC2A 3ZHCA 5KWEA 4B3RB 4MWDA 2HLPA 1N5RA 5MN5A 5IM5A 2NP7A 1P2FA 3QTLA 2JAQA 4LJAA 1KE2A 1OCEA 2CXUA 3ORQA 3KQKA 1L5WA 4QTYA 5K05A 4OV6B 5K8VA 4X6XA 2R8RA 1OXVA 4J0EA 1ZDMA 2BDUA 4J1NA 5TJ9A 4EL0A 4W5RA 2B2XA 3T5AA 2HJGA 4YQEA 2R65A 5TQJA 3SF8B 3IBGA 1Y42X 2FW7A 2PSFA 3H1FA 1B93A 3N76A 3WMEA 1ZSYA 3ZU4A 4D79A 3VKGA 2VEOA 2EW2A 2XB9A 2CHUA 4IDAA 4OLAA 1V25A 3GMSA 4FINA 4ZVNA 3ZDBA 1J0XO 1PQPA 2GFQA 4LJ4A 3ECCA 4GC9A 3IE1A 1OW3B 1XO1A 3GCDA 4YCJA 3O3MB 1Z68A 5LXTF 3KJXA 4OM7A 3L77A 3QFHA 2VSFA 1PUXA 1U8CB 2VAXA 2V7GA 1C30B 1NVFA 4KODA 1SC6A 3VHXA 1L3CA 2ATCA 2IHKA 3MT9A 2Q2NA 3GLHA 3R3WA 3DLPX 1RS0A 3M83A 4K6GA 5C18A 3IA2A 2XKJE 3FSJX 2CJWA 2YC2C 2KMLA 3RIGA 4JBXA 4BBAA 1CETA 2WD7B 1TYDE 1PR2A 1ARZA 1RQRA 2FPUA 2BEWA 4YH1A 3V8QA 4PC3A 5EERA 2EJCA 4LHZA 3T35A 2AJCA 5HQTA 5IDVA 2CLLB 3VYWA 4DGQA 4E88A 4EATA 4EFDA 4ZCMA 5A1JA 3BYZA 1OXSC 2IVZA 3D4IA 1V3QE 4YJHA 5BWCA 3Q8LA 1J2RA 1GTG1 1T3SA 2D5BA 2XVXA 2LRHA 2QNBA 3HPRA 2ZROA 2X0JA 2Q0HA 3E7DA 4I3GA 2XQGA 4MV1A 2H5EA 4XX1A 4LF7B 3TSWA 3TI7A 1KS2A 3L1HA 3F7OA 4YJFB 5TGTA 1E1NA 2GJ9A 4NMMA 1EFVB 3AETB 3AIKA 3E0QA 5AM5A 1K66A 3ZGNA 4NCBA 3H5IA 2W42A 3A3PA 3R7NA 4BB9A 3FCAA 4HLCA 3HXLA 3BKWA 4K9OA 3A4YA 5JASA 1P4GA 5CU7A 4Q7MB 1II8A 3RSZA 1NW4A 3NTRA 2YVUA 1U3UA 1G98A 3FUCA 3GC6A 3H87A 4P08A 4YUAA 1JWLA 3WA6A 3W2EA 1V8FA 1XJQA 3NM6B 4LEIA 1ZVKA 4RHEA 1TD9A 5A05A 2YYYA 1ZMXA 1JDTA 2GA9A 4N5NA 2Z83A 4A91A 5EOVA 3D8HA 3GLIB 2VXCA 4GPAA 5KYXA 3L1JA 3CLRD 2OECA 3O6VA 1FOEB 4JJ6A 4TYQA 3V48A 4R1NA 3W6ZA 4C2UA 4JJ4A 4KV9A 3JQ8B 3FZQA 5LUBA 1DKNA 4XPZA 1LBIA 3GLSA 2BOVA 4LFCB 3PJRA 1R00A 3WL4A 3P0EA 2IKQA 4HGRA 1U7OA 2VPQA 1JXMA 4Y1RB 4A8PA 3DMTA 4HK4A 4R9UC 4ZYLA 4ZVLA 4YMVA 2WE7A 5B6IA 4IQFA 4O4JA 2QW1A 4YJGA 3WGVA 4JBYA 1SGWA 4D4IA 5BW5A 3ISJA 3WLSA 1A95A 3ETHA 4OI0A 1SG0A 2OBYA 2VUTA 1F0PA 2IPMA 2PSDA 2FLWA 3JS5A 4GW3A 4K9MA 5GV7A 1KAEA 2K6GA 1NRJB 4RGBA 2QD5A 4G0WA 3AL0C 4MHOA 1Z13A 1C1DB 4H3VA 5DOVA 2KM1A 1T5TA 4WH0A 3TLJA 1KZ7B 1X74A 1OLSA 2C2OA 4E5PA 3H2KA 4ZJUA 5KNBA 1P3DA 1NMYA 1U98A 4GPZA 4WJZA 5E9WA 2AT1A 4CQMA 2IIPA 2WJWA 4B4KA 3B12A 5L95A 1HTBA 1GGFA 4PLVA 4TSFD 4WXHA 1I2DA 1E5TA 4Y9DA 4DA6A 3ZHQA 1QG4A 3GRYA 3Q7PA 1W0CA 2FQXA 4IAOA 2VA9A 4NENA 2YFHA 1K3UB 2Q8QA 4LTNA 5BVHA 3FRHA 1G59A 3HYNA 1GR0A 4U2DA 3AUTA 4BAUA 3W3AD 2J0EA 3G1WA 3T1TA 1X9HA 2ILVA 5B1YA 4U7HA 2XWSA 4ROSA 4FDMA 4RM2A 4PF1A 2JIRA 3A6EA 2QDKA 1K7YA 3CUYA 5ICFA 4DYVA 1R6XA 5DE3A 3K1YA 2Y0EA 5C34B 3V7WA 3NDIA 5B2ZA 3MJEA 3T3IA 2GNAA 4QPCA 4AM8A 4EMSA 2LCQA 1VJ5A 1L7AA 3HA3A 4RW0A 3EBPA 3JR3A 3NKFA 4N7MA 2VHUA 3SKXA 4UPEA 1OMOA 2J9GA 4V0OA 2XMGA 2XAAA 4UTZA 3AONB 1PVVA 1JKFA 2RGEA 3K8QA 1IXZA 1RI4A 3ORSA 1YZLA 2GJAA 4OA5A 2FG5A 3MF4A 3VHRA 1L8OA 4IMIB 3REGA 4XWKA 4IBOA 4NBRA 4X93A 1CUIA 4GIBA 1ZD8A 3DHEA 4D7AA 2QROA 2UU9B 4GZ6A 2QLNA 2I7XA 4BKRA 5DYTA 3M6AA 1H2WA 3A7EA 4OB6A 4ZO4A 4GRDA 1NMZA 3EE6A 3ZE7A 3DO8A 4R83A 2B4RO 4UASA 2VAMA 3IKVA 1ZD1A 4FFWA 1DHTA 1PK8A 1SO8A 1TGYA 2AX4A 2HRZA 3PT5A 4IUBS 1NX9A 4S1WA 4AICA 1GNSA 3DTVD 4M8SA 4ZVSA 3RBAA 4KR3A 1W34A 2QZ4A 2FPKA 2DCUA 1GZ5A 1UIRA 4NZNA 4J0HA 1QOPB 2GTIA 2DWUA 2Y92A 2ZANA 3H75A 3UV3A 3CE9A 3SSMA 3LL7A 2XQIA 1UFVA 3LKZA 3HRIA 3R5SA 2FUG1 4GYKA 4HPWA 4D4MA 5ITWA 1YZ3A 3TNYA 1BKDR 2EX4A 5DRYA 1IM2A 5FHQA 1VI2A 2W4QA 4ARAA 2FWAA 4E4TA 3Q4GA 1Z5OA 3BE4A 1US8A 5G3ZA 1KSFX 2HU5A 2QZZA 2RHDA 4CI9A 4DY4A 5K8UA 2VJBA 3UHJA 1SIBE 2CDNA 2QUIA 3MTGA 5DP1A 4NKRA 5LZ4A 1PU2A 3SEAA 1JAYA 3CPHA 2YFYA 5KSPA 2C4TA 3FGZA 1AUPA 4L08A 3CR3C 2ZBEA 1YB4A 1YE3A 1P62B 3P9RA 5GY7A 5K3BA 4O4IA 3VO2A 1U2RA 2ATXA 2POQX 3GLQA 3PXCX 3W9YA 2XKBA 3Q11A 1DZ3A 3D4NA 2ZZKA 4DR6B 3QEMB 1WX1A 1SXJD 1ETHA 1JEQA 1VRWA 3HUUA 4WTOA 1L5KA 3RLIA 4QDOA 3T9EA 1E5QA 4RPCA 5FO0A 3R3XA 5K4HA 3WY9A 4UNNA 1XQYA 4QATA 4B4VA 2I0FA 1AD2A 2EFCB 2FOLA 2BBWA 2IT1A 2XUPA 1T8WA 3KR9A 4XAQA 5JARA 4A8JA 5IJZA 3KLPX 2CL6X 2G0TA 3IQWA 1SM4A 1PIWA 1ETUA 3KPWA 1BROA 1D2CA 1P1KA 2ZQZA 3FBWA 3IDOA 2D2EA 4IIUA 3CCFA 4M3NA 2D7JA 2IPAB 3LXXA 4O4LF 1Z37A 3MB8A 5B6PA 4PG5A 4R51A 3JWGA 1E5DA 2ZZMA 1VL0A 5E38A 4ZAXA 1YS4A 4CQLB 1MFPA 1IZZA 1X1QA 1CFZA 1ZWKA 4HZUA 3D5EA 4CTKA 2EV9A 2PGOA 2WF9A 1JHOA 2HDHA 3GNSA 3IMEA 5EC8A 2CZGA 4CKBA 1E1YA 5HMLA 4PZPA 3VR5D 2X1MA 1KKLA 4UW9A 1UK6A 3DG9A 3VC1A 1YBMA 5BY2A 1DGQA 3MTEA 5LSAA 3P0IA 3Q7EA 3HY4A 5JRJA 3R2JA 1H3FA 1DEOA 1RYMA 1ZBQA 4EEXA 3AG5A 3D7MA 1IBCA 1JV2B 1NLYA 1CQJA 1DQRA 1R6DA 2CBGA 3O4VA 4L8LA 4JLBA 4DBVO 2JEOA 3OIUA 3HGQA 4LGVA 2NVBA 2IPLA 5KOJA 2FFAA 3A9CA 4M7PA 5DT9A 4KFCA 1VIVA 1IN7A 3PV0A 3DW1X 7MHTA 4WN9A 2IF0A 2FWBA 4UQOA 1W4LA 1RXWA 2RGDA 3FPFA 1JU3A 3QSYA 3SEFA 4ZOLA 2HJRA 3QMVA 3A2KA 1UFQA 5AM1A 5T4HA 5JZSA 2XUKA 3L7NA 2I2AA 2ZJ2A 1N2BA 1WKVA 1GQFA 1RAEA 2O2SA 4PG4A 4LYAA 4JI1B 4JYPA 1PVDA 2FUG6 3RH0A 3TCKA 2GK6A 4CN8A 5JZMA 1I1HA 4FD3A 1MUUA 3K0CA 5AH0A 3JQCA 3A28A 4IV0A 2VDJA 4HDRB 4H16A 1TC1A 5AW5A 1DIOB 1EK5A 4REOA 1UZUA 2G36A 2ONJA 4FMBB 5IP5A 2WYOA 5GAJA 4MGHA 1HZJA 3IC5A 4AIRA 3DHWC 1PFGA 3UMFA 3LW7A 4CM8B 3A2NA 1C2YA 1AKUA 3AUFA 4D9FA 2VPPA 4Z1MD 3Q9UA 1J2TA 4HEHA 2YWHA 2B1IA 4GECA 4JT8A 4OQPA 1ND5A 4M0DA 3AKCA 1P2DA 2QN3A 3LMKA 3LDAA 4BEVA 4MW9A 1XU4A 3EF3A 1L7XA 2Z4RA 3F7NA 3PUZA 4JR1A 1HMYA 3VYRB 2L69A 3EXIA 4BLTA 2UUBB 1T0JB 4UBMA 5JEEA 3DO5A 3EGWA 3KKQA 3P27A 1N2XA 4E0BA 4CV3A 5EP3A 4GPBA 2QRJA 4MIKA 4WFIA 1HH4A 3I2IA 3LUAA 3ZGLA 4KSBA 4BJ5A 4P93A 3IT1A 1W36C 4PPFA 3OUTA 5TQ2B 4P7KA 1N6HA 3RWOA 4MV4A 4MQUA 2EZ9A 2ZS7A 1LI5A 1Z0ZA 3EARA 4X71A 3WP0A 5KHOC 3EFBA 1M7HA 3EPRA 2NU8B 5C37A 3QU4A 5K03A 1WY7A 1MB9A 1OIVA 1VL6A 4YAJA 2HA3A 5EZYF 5G0VA 4CF5A 5U9CA 2SICE 1UKZA 3JYOA 1R5JA 4HL6A 2C4UA 1LLDA 1Z4IA 4L51A 2YWXA 2IY9A 5ALKA 3LYHA 1T3LA 1TGVA 1PR4A 4Z53A 2Y1GA 1XZBA 5FBHA 5B3JC 1CLEA 1DARA 1NN0A 1YHYA 4DZTA 4RZSA 3HP7A 1M0TA 3HR4A 4CLOB 4DV4B 1JXQA 2FFRA 2RIRA 4Q1BA 4RAQA 3VJMA 2CVOA 1LQTA 4ZVTA 2JIPA 3DUFA 4JLJA 4GI3A 1LY1A 2QSYA 2AVDA 1QP4A 4KQFA 5JNVA 1QGYA 4U4AA 1C7RA 3KYJB 3U0BA 3D6MA 3ABRB 4ZANA 4PCAA 1U8XX 4F91B 2FNAA 4H17A 1DRJA 1KYIA 4P81A 1IQUA 5ALMA 1ORTA 3GIDA 2Q8NA 2FDCA 2DP4E 4BFXA 1E3WB 5CVUA 3OOYA 4U1RA 5EZQA 3DZHA 4AZ3B 1B6TA 3UK6A 3LBHA 2PZAA 2Z9BA 2GZMA 4CDRA 1I0LA 2FW0A 1LPMA 2DFLA 2NSJA