1EIWA

Solution structure of hypothetical protein mth538 from methanobacterium thermoautotrophicum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
111
structure length
111
Chain Sequence
VTAEIRLYITEGEVEDYRVFLERLEQSGLEWRPATPEDADAVIVLAGLWGTRRDEILGAVDLARKSSKPIITVRPYGLENVPPELEAVSSEVVGWNPHCIRDALEDALDVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based functional classification of hypothetical protein MTH538 from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
molecule keywords HYPOTHETICAL PROTEIN MTH538
molecule tags Structural genomics
source organism Methanothermobacter thermautotrophicus
total genus 21
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2000-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein MTH538 1eiwA00
1EIWA
chains in the Genus database with same CATH superfamily
2BKUA 3WWDA 3GPCA 4QUIA 3WOHA 3FVVA 5LOVA 2JGKA 3BJMA 2GN4A 2XBLA 4O4JA 4ZO8A 4BCDA 4I55B 2EWWA 3EH2A 4XJSA 4XAQA 4EARA 2VTKA 4P5EA 1MW9X 3KKLA 1LBIA 3HM2A 4KRYA 4TKVB 3LOPA 2JAQA 1S89A 3PF9A 1LRJA 2GHQA 1XDBA 1D1TA 4CLRA 1WF6A 1YZUA 1N34B 5TQ2B 5E1MA 3KUUA 2R8PA 4LY9A 2Q4EA 1BHSA 1GN9A 2ZYIA 5FI0B 2AK3A 4JUBA 3DZJA 2Q28A 4NARA 3FTEA 1YKGA 4HNHA 4A8HA 2ISCA 3LQ1A 1XEXB 4D82A 1PBTA 4COOA 4UFOA 1L4LA 3RFTA 1L5RA 1X0XA 3U62A 2GM4A 2VSYA 3LCUA 1CUDA 2HHCA 2ZYWX 1QV6A 3RFFA 1CTQA 4UM7A 2QRHA 1RJ9A 4TWJA 3IIIA 5DYIA 1CRZA 4Q4JA 1ZH0A 5BQOA 1P1IA 3VZCA 2IBTA 3GAAA 4Y7DA 5ICSA 5JJLA 3HK2A 1JAIA 5C32A 1R6VA 3HEBA 1CBUA 3VNRA 2ZCVA 4GMHA 1L5LA 3QPVA 3AVUA 4IFIA 4HMOA 2VEDA 4KUEA 1BS1A 1DBIA 1KFCB 3I6QA 2ZSJA 3AOEA 1YOBA 2EFJA 2PV0A 1KDZA 1NXPA 1J33A 1XAHA 5LQMA 3I83A 1TCCA 2XTJA 1YJXA 2P90A 2ZYRA 3DTNA 4ASUD 3PDCA 2EWVA 1WXXA 2I1WA 1TUBA 2XNCA 4M1MA 5H1YA 2GZAA 2QTWB 1XRMA 4QGFA 5LL6P 5EOVA 5H9VA 4L7QA 1O94C 1WMAA 2CNOA 2IX9A 2QXYA 3CLVA 1TLFA 3IX7A 3DBLB 1R2QA 4GOMD 4HAUA 1H2FA 4LC1A 3MUFA 3FNBA 4GZ5A 1JRLA 3KKKA 1LLUA 5GM1A 3WWZA 4MLZA 3EA4A 2YN2A 2HFKA 4YO8A 7ADHA 4GKKB 1X1RA 4K9RA 2XZLA 5FFFA 4EA6A 2C2WA 4FHFA 1ECPA 4MR7A 4UEOA 1QQAA 1LJUA 1TEHA 4I5EA 5E4JA 3DKIA 1F3LA 2B34A 2AG0A 2C5AA 3O1JC 1D1SA 3L5KA 5GGXA 2B4YA 1RKBA 2C98A 3KEFA 2QX8A 5TVGA 4F2GA 2D2IA 5U9CA 2K2QB 3CF6R 2WJHA 3SHQA 3H5LA 4WW0A 4X91A 3VDNB 3C1TA 4ZI7B 1OILA 3H2HA 2A67A 3EH1A 1I2MA 4CKBA 1EEHA 1HH4A 1BWQA 1EVQA 4N0DA 2ID4A 3RGWS 2Q0SA 4QPPA 5AW9A 4EUFA 2W6IA 4XUDA 2YJ4A 2AI2A 3MWEB 4HZUA 4OGKA 2GK7A 4GSLA 4QICA 3N05A 3R5JA 4MA4A 3ILHA 4XXHA 5EEHA 4L4ZA 1WDTA 4DSUA 2BBTA 2LVBA 1ZNYA 3LGXA 3ZWYA 2GJSA 4DN6A 1Q1ZA 4AJ4A 1PU2A 4KI7A 1MO6A 4BO9A 4JN6B 4A0GA 3ZHRA 1O03A 2VQEB 3NKFA 4M4SA 3H16A 4DR2B 4ESVA 1VKRA 4Q3OA 3P9QA 1Q95A 3ICOA 4NFLA 2HUNA 3AFMA 4F6RA 5TIIA 4ZREA 3PQ6A 5C7LO 1Q77A 4NONA 3ACCA 2HBYA 1EGMB 1RYNA 4J0KA 3JVEA 4NTZA 1EGVB 3RWMB 3JS5A 1UJ4A 5HUJA 3NT5A 1PG2A 3DEYX 2VDOB 2QIOA 3GCGA 3N2GA 4KQKA 3S3TA 2JCBA 3T4XA 4A8PA 3UJ9A 1ZJ5A 3H17A 4G1UC 4HR7A 4ALJA 2AKYA 1BU5A 2H2HA 2OM2A 2R1TB 2ZTUA 4J0DA 1KJJA 6NULA 3TG8A 4KK4A 2F8SA 1UXKA 3BB3A 4GPAA 3OX1A 3RVBA 1V39A 2NOAA 4GDMA 1GQQA 1XJ5A 5ILQA 5DCWA 1MZPA 3U9TA 1PK9A 4YHBA 4WMLA 1RXWA 3E3AA 3X1DA 4U2BA 2PO5A 3OF3A 1NMYA 2E4UA 3AUJB 4HH1A 1B8NA 4JJ8A 1EXVA 4LXHA 1JR3E 2X9VA 2YASA 1E4EA 3EIEA 3E3OA 1ADFA 2ZIXA 3FKSD 3OQBA 2OKCA 3PGJA 4RW0A 1VSQA 5ALTA 3R74A 5LQUA 1OAAA 1QAOA 5F3WB 2PGLA 1BMFA 1KA9H 2JAPA 3PHJA 2Y1FA 3ETHA 3V2GA 3LL4A 4A0RA 3N2LA 4Q6BA 3UN1A 3C16C 2B8TA 4RKFA 1DIAA 1LV7A 2YHIB 4H6VA 4C3ZA 1THTA 4F96A 5TMPA 4PTZA 1OUMA 1IXZA 3MVEA 2OOKA 3OM9A 2Q2QA 1K9VF 4LYAA 3QYJA 5AJZA 3UQYS 4C5CA 3KKEA 3FVQA 1MV5A 1ADBA 4LRTB 3LJKA 4LYHA 5J58A 4Z3OA 1C0KA 1FFXA 1K7XB 5GOTA 1DE0A 1E2IA 4GI1A 1EX9A 4X92A 3DEHA 1KIFA 2QQEA 2C8LA 1Z0DA 3GZTB 3L6EA 3O74A 2RGWA 5LM3A 4OLFA 1R88A 1XUOA 2QQ0A 4HHEA 3NTRA 5A7GA 2ZJZA 3RUHA 3LP6A 4B80A 5AVTA 4FCCA 2IP4A 3KLMX 3DV0B 1HFEL 1W1UA 4GZ3A 1KOGA 1JSZA 4KI0A 4N48A 3AJDA 2V6MA 3QPAA 3TFQA 5KKCA 2ZB8A 3AH8A 2HOQA 2LE0A 5I7HA 3K9WA 2PWYA 3R7WA 2CDCA 1GTZA 3B6JA 4PX5A 1JZSA 3HWX1 2BDUA 3LCRA 3A6FA 4H31A 2AOUA 3DOJA 5JMWA 1RLTA 1NP3A 3V1YA 1JDSA 2IP1A 5AJVB 3MRTA 2V5UA 3WLSA 1DAEA 2RBGA 1XYYA 3ELUA 3OZWA 2GZSA 3AIIA 3PD7A 1WZCA 5SYMA 2WSMA 1E20A 1ZJ4A 4AJNA 4OLBA 5FWYA 3CFYA 4YFYA 1PGQA 1F0KA 3TOCA 4OD0A 2CJWA 1ENZA 3ZPXA 4B87A 1R6DA 5C37A 5AHKA 3R0VA 2EJVA 1N25A 4LF4B 3ZQ6A 4M1OA 1EFLA 1V9SA 2QTFA 3DVAA 1KZ9A 1M2GA 1Q1AA 3EEFA 4L27A 4MKFA 3Q5DA 1T9HA 3QFSA 4LDJA 1D9ZA 4LMBA 3UQZA 4IWNA 4PS1A 1KQGA 5CPFA 4UNNA 2J0SA 1SXJC 4IHJA 3JZIA 1C9EA 5EWMA 3ROQA 4X95A 5A0FA 1IB6A 1HGXA 4KK3A 3I1JA 3QPCA 2DBZA 3DMHA 4HH4A 1HQYE 3ADBA 1H9CA 2YY6A 1F2TB 1CUZA 1I4OA 3VQTA 1BVHA 4DSZA 1Z37A 1CE8B 3K9LA 4WZ6A 1II0A 4Y2SA 1I10A 5DO9A 1L5HB 2X0EA 5JAPA 5JAUA 3PR1A 1BHO1 1NN5A 1KRXA 2Q27A 1NA5A 2I2AA 2J4FA 2JGJA 1RQ2A 5T67A 4FEEA 2JFFA 1P91A 4RE6A 5AW4A 2X1HA 2KX7A 4NDNE 3S8EA 4WVFA 5IK2A 1NRJB 1X7XA 2VYVD 2YQ4A 5EZQA 5DNDA 1WVMA 1SVMA 5DTIA 4KXYA 5EHNA 2H1CA 1ID1A 2ID8A 3L7KA 5H0IA 3WLRA 4G8BA 5B2FA 3DCIA 3HDVA 1C7EA 2BJWA 1SVKA 3A1SA 3H4MA 1OYWA 3HHEA 3IPXA 3JAKB 4JUCA 4LGMA 1V8ZA 4QGHA 1EDOA 5ALKA 2XWSA 1SUSA 1OZHA 3V97A 5I9LA 4OHYA 4L0CA 3I8XA 1I36A 3ZXXA 2XUZA 3I42A 3R7NA 1I2AA 4NCAA 2IEIA 4ZEOA 1KMNA 2VPYA 2OFFA 1XZFA 3ZE0B 2QQ5A 1JXAA 3T52A 3WBJA 5A5FA 3W8EA 2RGNC 3F4BA 3H7AA 3IJEB 4KWIA 4DIMA 4B7ZA 2VH2A 2DKFA 4D5GA 1UPCA 4XWGA 3IAXA 2V7GA 2YC2C 4BNYA 3EUWA 3TD9A 2QXTA 4OX9B 2V4MA 3WO1A 5AI0A 2DFLA 2M6KA 2C0PA 4QX6A 3VR4H 4YPOA 1SKYB 2OL4A 1FVHA 1A3CA 2C2HA 5IWCA 3INTA 4IKOA 1UXGA 1CERA 3L4SO 2G5TA 1XEAA 2O20A 3N7AA 3OD5A 1VJGA 5KIAA 2HT6A 3E2IA 4JR0A 2P5SA 1JQBA 3NWJA 4P31A 5CLIA 2C3UA 4II2A 3O21A 2WYVA 3WLEA 1G8KA 1ZM9A 3F49S 4H15A 4HSEA 3E22A 3SS9X 1E9EA 4F9FA 5LP6B 1RHMA 5HZKA 3C8UA 1HFWA 3QUAA 1ZUWA 1RIIA 4KDFA 4CMGA 4BGVA 4CYMA 1RVDA 4CRWB 2HUPA 5ERGB 5ALHA 2C4VA 1SHZA 3CB4A 3QVLA 4AJEA 4B2YA 3H6HA 1IM8A 2BFEB 3EG5A 3SHWA 3WICA 5F21A 4ZVPA 4H27A 4JP1A 1SBQA 2C78A 2R65A 1T1GA 2PFSA 2RBEA 4LZPA 2WAMA 3QMVA 2Q9AA 3LA8A 4HTFB 3OT4A 3PPWA 2JLSA 2O2CA 3PQDA 1J42A 2AG5A 2P0EA 1Z5WA 1G20B 1ZU4A 3C3DA 4MVJM 4YCAA 1J8QA 3RREA 2PUEA 1ZD8A 3MSXA 3VR4A 2HK6A 5BPHA 4JGBA 2GCIA 2J46A 2P9EA 2VJAA 3EOAI 1NLFA 1KYIA 1RI1A 2WT9A 4IEFB 3I6MA 1LC3A 3C4VA 2F9LA 4EKYA 2W4IA 3ZD6A 1QJCA 3FDFA 3LQ4A 3Q6MA 3OFVA 1DEKA 2IUTA 3U16A 3DJYA 5I4KA 5I7RA 3MB8A 5HCNA 3R4VA 2EFGA 2HC9A 4C0XA 1LRLA 1OHHD 1Q7BA 1RLOA 3A3NA 5IAEA 1J99A 1J49A 3EYWA 1N2JA 3ILXA 1XP8A 1V7CA 5CH8A 3E7FA 3FWHA 1QMGA 2H54A 1O97D 1MORA 3L0OA 1SC9A 5HW0A 5JDIA 4Y2TA 2COKA 2M6SA 5L3ZA 1ZHOA 2ZI7A 4XB6B 1VHQA 3LBIA 3MJTA 4KAXA 1RD4A 1V0JA 1QF7A 3DP9A 3I73A 3ONNA 1VCNA 4RCZA 2JFVA 3THYB 3TF5A 4I50F 1GPKA 1GG2A 2W9XA 4DPKA 3ORHA 1S2IA 2X0IA 4A0HA 4H35A 4RTKA 4R9VA 1GFZA 1RKUA 1SNYA 1XRRA 2Q49A 3HUTA 4MRVA 4E12A 2FW1A 5FUXA 4MRMA 2QWXA 3MGAA 1ZMRA 3URMA 4IZ6A 3OT1A 4MWGA 1XN4A 2XUGA 1XTIA 4OV6B 1JFVA 1LV8A 4YXFA 1BXRA 1PUJA 3MUOA 3HVJA 4XSGA 4PQGA 3AEQA 2D2FA 4MR8B 2YCLA 3RT7A 1ZIDA 1LPAB 2R7NA 4XCXA 4M88A 1E64A 1UANA 2V9PA 4FEYA 3T3EA 4Y3UA 2G5GX 1NE2A 2FWPA 4KRFA 2WNHA 3GO4A 1HM5A 1G5TA 1JPNA 3G8DA 2JJQA 3UGJA 2MJLA 1TZJA 4ZGWA 2HMUA 1MEJA 3KR2A 4AZVA 2QN9A 3PDIB 1YZVA 2EZUA 4PCAA 4RLFA 4CMCA 5KREA 4RO0A 1JE0A 4JJEA 5TT0A 2ZJ2A 4B7UA 3M5CA 4U0JA 5CDUA 1E2GA 5AKLA 2WE7A 2WSSA 1QS0A 2Q2WA 4DCPA 1JV2B 4D9HA 5EJFA 5IVKA 4X20B 2FPGA 4XQ9A 3U17A 3RVMA 3TECE 3UKOA 3Q7EA 4QPCA 1N9KA 5KPJA 4LZZA 3ZU4A 2OGZA 2BW0A 1N9GB 4DCTA 3AKCA 4AIRA 1GDHA 5D3ZA 4MV6A 3F3KA 2M2IA 1YQTA 1TVMA 3FF1A 1MNAA 4NCNA 3ZGVA 3U3JA 4RMHA 3S28A 1Z38A 3I76A 4KR7A 3FI9A 3L5OA 3EK2A 4QRHA 5LOVF 2IS1A 4O4JF 4D74A 2OSBA 3QPBA 3EQZA 2O2GA 1KO5A 4ZJPA 5C46F 3U4QB 2MT9A 5DOZA 4IJKA 4ZT4A 1UQUA 1OVGA 2QG4A 2ZRBA 2MDTA 3OMXA 4NRDA 1U8CB 3TS1A 3KZCA 4WZAA 1I7NA 3UAYA 1VCMA 1SD2A 2QMQA 4BP8A 4B3RB 4QG7A 4QXQA 4RADA 4GI7A 2Y71A 3AIMA 4BX0A 4FYYA 4CQJA 4G4JA 1K6MA 1PKEA 3QMPA 1FLDA 2CUTA 3PGVA 5FUYA 1VMDA 4DXDA 2QR2A 3OCXA 4CEIA 1Z35A 5JZ9A 3NPAA 2FPIB 3O7WA 1TQDA 4MUNA 3X0DA 4C3OB 3FOZA 2AFHA 4P7BA 3B1WA 4KQHA 1ETHA 1YZNA 4KNWA 3NETA 1DG1G 1E1QD 1T4MA 1HDXA 7MDHA 2C4NA 3ADKA 5GMOA 3JYNA 3MWYW 1N3BA 3ITKA 3ISTA 4YRDA 3Q7QA 1K6EA 3F47A 3ZHXA 4C7BA 1VP3A 2PUGA 4M38A 4URHA 5BW6B 5G2OA 4I1PA 2PBLA 3TSYA 4DMLA 1I6KA 2ORYA 1TU4A 3OBIA 4QUBA 2G1AA 1Y6FA 4L3OA 1P3DA 4CGYA 3P9XA 3A9VA 4G67A 4PZAA 1Z2CA 5K99A 3V8VA 3T1HB 1CS0A 1C3OB 1OKKD 2QZPA 4IHAA 3L4EA 5FUVA 1N2CB 2PRJA 1NVXQ 3N28A 4M37A 5FI3A 1I32A 2OAP1 3EAFA 3K92A 5AK6A 5BV8A 5KOHB 5CURA 4TMWA 1KOJA 1U0SY 2LNDA 3FG9A 4QAJA 4CKWA 1OPXA 3IURA 2XAAA 4K46A 4C4ZA 1OTXA 1TVKA 4DXAA 3K6SB 1R4NB 6YASA 1AGNA 1D3AA 5KO2A 2LCFA 4Q7QA 1C9JA 4FW8A 3SN6A 1E4YA 3CN9A 3KWMA 3NM5A 1P44A 2IXBA 2FZEA 1JVBA 5BO5A 2NUAB 4TL9A 4CM4B 2YV4A 1RABA 1OWOA 1TE2A 3QITA 3UHFA 2EQAA 1SCKA 2RHLA 4J94A 5JCJA 4YJHA 4V0MA 4BNGA 2C9CA 2FRDC 1IY8A 2KW5A 2Q8QA 4FKBA 3ENZA 3UICA 3BT7A 3IELA 5AI4A 2QL6A 1ADCA 2QL9A 3ND6A 4BNDB 1WBBA 2A9KA 2EX1A 2GN9A 3M70A 4II7A 3VZDA 3KJQA 4WXEA 1KKMA 5BRNA 1YBVA 4KVGA 4LWOA 3HFGA 4PYOA 4PYKA 4F1JA 5CB4A 1Y6GA 4H7EA 3D6VA 1Y5RA 5KNCA 4X8HA 2J3EA 4AY5A 1MW8X 3GEHA 4DUYB 1A8PA 1GPJA 2BHRA 2Q4OA 1WXHA 1XL0A 4TZTA 3HYRA 4JKYA 4Z54A 1J2TA 4CLHA 3PQ5A 1I7LA 3IUBA 3LTNC 5ECGC 1NR5A 5CNKA 1J7KA 3BRCA 1DGQA 3KTAA 3L6CA 4FLMA 1YKSA 1Z4KA 4L0DA 3IOEA 2G1PA 4F12A 2JCSA 3ZLJA 2OWEA 3WYAA 1YE3A 3DZFA 4RKYA 2R1VA 2JH3A 3H5VA 4PW0A 3RW9A 5KTPA 2JZCA 4FSDA 5MGBA 3KZOA 2VP4A 3NBYC 1Q1BA 2FFRA 2NV2B 3I39X 4UREA 4OSEA 3NUGA 4ZV9A 4EY6A 4UTPA 4KQ2A 3IKTA 5INTA 4J2HA 4TLDA 2VWGA 4ZQIA 3OZCA 3GPLA 3O8OA 1NR7A 3CE6A 1TM2A 4GQAA 1KFBB 4FGLA 2R87A 1PZEA 3M6UA 2A57A 2P9JA 3CVVA 5C7YA 1HE5A 3N2IA 1KFKB 5ALYA 1E2DA 2YVAA 3CTPA 2PNJA 1ISJA 2V9CA 3WMWA 5K8CA 1LQUA 1FJHA 1NT4A 4EA8A 3PC6A 1SB8A 3HE3A 3DMNA 5J5AA 4GP7A 3RU9A 1JEQA 1FYWA 1UJ5A 3E9DA 3GFTA 1V5GA 3ESQA 3GJSA 3GR6A 4H7FA 2OGUA 4Q6WA 5TARA 3Q3GE 1IEVA 4AC9A 4R2KA 3DTVD 4FYKA 3OCVA 5BSKA 1KJWA 1MO4A 3CVJA 3K1AB 1Z4OA 4MCJA 4DZZA 5GTDA 2E4ZA 4HEA1 4C2BA 4E0BA 1OF1A 2PSEA 4IYRA 4DAOA 2RGRA 2ZIFA 2BE9A 3PB3A 1OYVA 4L5AA 3C14C 3WTCA 5IYZF 2EYUA 2ZSIA 3S5UA 3R2JA 4RD6A 1B8OA 5EZYA 5IAOA 1T9GR 4EO7A 3HB5X 2LCQA 3T5MA 2XQFA 4E1AA 3ROXA 4F0JA 3S7ZA 5CIYA 4H9GA 2Y9PB 3KAQA 1XCGB 5FPPA 3V1UA 1SOWA 4JQOA 2VCEA 5I4IA 4PQEA 4MVWA 4G4IA 1ZGHA 3M1AA 5HRUA 1VKZA 5EFZA 2PH7A 3GH3A 2JHFA 2EDCA 1N0UA 2GI4A 4ZIRA 4P54A 4YRMA 4KLCA 3AKZA 4MQBA 4WOCA 1YOVA 1XLTC 2C0CA 5JUWA 3LUHA 3BFVA 3MTBA 4YO7A 4IH1A 4JAVC 3VHRA 2L2QA 3BK7A 5TV2A 1FUIA 3THSA 2MU1A 2ZFUA 3BYZA 3E4DA 1UJCA 2QRQA 4V38A 1QIFA 1Z8DA 3DXZA 3OQVA 1UBMS 5LXTB 2GGSA 2YY7A 5DWQA 2GR9A 1Q7EA 421PA 3CG0A 5H70A 3BJRA 1DAHA 4ZYUA 1FTGA 1CUWA 1PFGA 2BC9A 2YJ5A 2VSNA 3GJ0A 3KHTA 2YNMC 4X8MA 16PKA 3X1MA 1P2TA 4E4YA 4GD3Q 4NE2A 1AC5A 3CSUA 4R2WA 4ZEXA 2VRCD 4QBGB 4RVHA 4JNKA 3EJ6A 5BT8A 5C8VA 1JG2A 4YV0A 4K0KB 3X2SA 4KMRA 4F84A 1QH8A 1PD0A 4NJMB 1VSTA 1KERA 2AUTA 2R60A 3UCEA 4QQ8A 4GLJA 4IHJF 4A6DA 2NV6A 2AOTA 3QUQA 4JLUA 2F1RA 4W8GA 4WLEA 3ZWXA 1GSAA 3VTKA 3FMGA 1VPTA 2V4ZA 4KSBA 4KR9A 1NRWA 1QANA 1HQKA 1TCVA 2P3SA 1JFFB 4HNAB 5ALDA 5TE9A 1KC3A 5EPOA 4BMCA 1U9IC 3LK6A 3MEQA 4IINA 1VG8A 1J0DA 1ND5A 5CG2A 4AMGA 4Y2HA 3CNOA 3HXLA 5T6MA 2XVAA 3UPUA 1D2MA 3FB1A 4Q9LA 4EI8A 2O8EB 2XHEA 1X94A 3PL1A 4CIYA 2F2TA 4DA8A 2P3QA 1G6OA 1QTRA 1QGZA 2AEEA 2JHPA 1QG4A 2YWBA 3GT4A 3OPNA 4BGIA 2FWMX 5F23A 5K0CA 2XCTB 2F4NA 3ABQB 3OP1A 4JLJA 3ZQ4A 2WYOA 2W2LA 3OMLA 1WB4A 3GCDA 1QC5B 4WKCA 4C5BA 2H2IA 1IN4A 1IK6A 2M1XA 2QHXA 2BHSA 2NUBA 3M4YA 5JXHA 4UHKA 4W5HA 3HY4A 1Z45A 1JQJC 3V1TC 3WBBA 2HHAA 1ODCA 4FFPA 4L3VA 1GPYA 1NG1A 1XD8A 3ORSA 4QBIA 1CQWA 4V1CI 3ORYA 1Z0IA 2IYAA 1OOEA 2H2AA 3W77A 3IDFA 5IKPA 1EHYA 5GIOE 1UBJS 3T8YA 3DZHA 3AP3A 1ZUHA 4QTUB 4WXYB 2NVOA 3PUYA 1G59A 2D59A 4PLFA 1GPNA 2OSVA 2DPXA 4M8SA 1LBSA 4RVSA 4IDGA 4QBTA 3V4FA 3HUFA 1L3IA 2GSWA 2IF0A 3FDJA 4KQWA 3GRUA 1KYWA 2X8JA 4NDZA 4P32A 3EF1A 2RHGB 2BPOA 2C5EA 1RYHA 2D1QA 2OD2A 4FYHA 4I2VA 4KITB 3DLHA 1W0CA 2HCFA 5JSYA 4WKGA 4BTEA 4XYLA 3EG9A 3SJ7A 5C3UA 1WF3A 3QTTA 4MAMA 3I01A 4XD7D 4JUFA 3F6PA 3GNLA 1ZFNA 2CF6A 4JJFA 2VIIA 2FAXA 1RHQA 4KEAA 2GHTA 4KREA 4OHCA 1L5OA 3LX8A 1HMPA 1SVIA 4B83A 1V43A 3BB1A 2P62A 4G5OA 1OH5A 1N6NA 5KYTA 3G23A 4B2IA 5DJ5A 1MD9A 1U8FO 1YS6A 3IV7A 2NVBA 5AUQA 3SLRA 3IAHA 1QRUA 2PFGA 4BLOA 3G49A 3KR9A 3OHMA 2DPHA 2FZ4A 1YQEA 5CFRA 2JJ1A 2HKIA 1VI2A 3CMMA 4GM1A 1VL5A 3W34A 1M6WA 3JX9A 1PSZA 3BC1A 4DLVA 4KH0A 5D00A 2J48A 3L8FA 3W05A 2DQSA 5LYYA 1NMSA 6Q21A 4Z2YA 2GEVA 5CM9C 1T3GA 4NG4A 1JSRA 2P7IA 2XR1A 4L8WB 4FC7A 5EMHA 5B36A 5JZVA 4ND8A 2N1MA 3L49A 4KXWA 4PRZA 2QTMA 2X5OA 5JNSA 4G81A 5K0LA 1FNMA 1W47A 4BFCA 3WSVA 2HA6A 2FPSA 2WAYA 1Y7PA 3D4BA 4TUYB 4WFIA 4Y2XA 4YJ3A 4DIBA 4F5WA 7REQA 1Z0UA 3DTYA 3G7NA 4GKVA 3K70C 2WZBA 3JCZA 1E58A 3CTMA 1E0KA 3OECA 5JD4A 2Z57A 3FAZA 3GLIB 3DL0A 4HJXA 5ESWA 3T5AA 4I55A 3RQSA 1TJ4A 1WQ1R 4YRFA 1HG1A 2YZ2A 3B20A 4Q82A 5TJHA 1HY3A 2VXOA 2IWHA 5K0NA 5BQFA 4C7XA 4HJRA 4Q0MA 4IUBS 4UVEA 1D07A 1C1YA 4J1QA 4TKVA 4B3FX 1FRNA 1UPTA 2NZVG 3B2EA 4A9AA 5AQ1A 1HDRA 3EVGA 3DKVA 2QENA 3U4DA 4BMSA 3CH7A 3FFBA 4DLYA 2BGNA 5JFOA 4B3DA 3EF0A 1KMCA 1KJ8A 5C8DA 2ZKIA 3AI2A 3FPAA 4I4TB 1XEXA 4JQCA 4PSVA 5ABPA 3G9XA 1YQWA 1CKEA 4S04A 3FNRA 4UPEA 2ZJOA 1AUXA 2NU6B 2C31A 4C0JA 3STWA 4CFSA 4DMMA 1U8UA 3TQCA 1RHRA 1KL7A 1PHPA 1ISPA 2RI0A 2W43A 3ZYZA 2OGSA 5L3QB 4Q01A 3COZA 2FUCA 3QHQA 2Z5LA 2V7TA 1KYXA 1S2LA 2BR5A 4IIUA 4WIAA 2W6ID 4UM5A 4WH0A 4BUCA 1H65A 1Z6XA 2C9ZA 2CHFA 3RSHA 3SHVA 3VFDA 3VTAA 3CNHA 4FYVA 3Q3CA 2OLEA 2G04A 4A0SA 5LNK1 3ADDA 4W63A 1AD2A 5TPWB 4BP3A 2F9MA 2H8GA 3FZYA 3G89A 5M29A 3ZNNA 5FBVB 1XPOA 2FEOA 2W6JD 1F51E 1EP9A 3I23A 1H2XA 1UMBB 3C98A 3WBKA 3DEIA 3H2IA 4JROA 3DBLA 8GPBA 1SHUX 1B74A 1X9IA 1A9OA 3AM1A 1QZXA 2IIPA 3AHHA 4FWBA 3EXG1 4LOJA 3JY6A 2HSGA 1G8FA 4ER5A 3BH0A 1KTIA 1EJ0A 3CLTC 2VT7A 3EARA 1K3TA 4RHTA 1BHJA 4ZWNA 2AN3A 4HRVA 3DR5A 3VYWA 1J1IA 1BX3A 2FLVA 4FONA 5DNUA 2DBYA 2XVZA 1PLLA 3OZXA 5BY2A 3V4ZA 2E85A 3A1FA 1NPDA 4M6WB 1FDWA 4X6LA 5AK0A 4KIFA 3IVRA 2A33A 1P3Y1 1NZFA 5AJTA 3H11B 1X7HA 3FTQA 4ZI7A 2XUFA 4D9KA 4IF6A 4V0SA 2F67A 4ZRNA 5D5HA 1F20A 1QVZA 4PBRA 3G02A 3H19A 5E0OA 1CHDA 1HUQA 3MWEA 5ALRA 2YN0A 1PT5A 2PUAA 1PVDA 5CDTA 5K8IA 4EATA 2XUAA 4DQXA 3GLHE 1Y9DA 3VKWA 1SCUB 1YVEI 3QBDA 1ZK3A 2WD7B 4IIGA 1UINA 3F1LA 3LGAA 4TKMA 5KQRA 3HU1A 1OI2A 4PQYA 4IDPA 2SNIE 4HLNA 5A71A 1UKCA 2FWIA 3RC2A 5J4HA 1S3GA 1G7TA 1MXHA 1NBHA 4RGBA 4UARA 2C2ZA 2RB5A 3CUEF 4OUDA 1NYLA 4DDKA 5KTSA 3THXA 2CDBA 1VHDA 2ZSFA 3BCSA 4CHGA 3CRNA 1G2QA 5IAAA 4LC0A 4HRAA 4QQNA 4O08A 3T5DA 3BZWA 5CFPA 1KEVA 4AG5A 1S8NA 2VHUA 3DPIA 5HE8A 4K03A 3HP4A 1N3YA 3NC0C 4TSRA 5JW6A 2R1TA 1Z4LA 4EG6A 3SMVA 3UJNA 2FR0A 5DGTA 1GYQA 5EE9A 3TTVA 1JHDA 3ZKAA 1UFVA 4GMDA 3I9V1 4FMDB 1HLFA 4MMYB 3UYKA 4GNKA 1JJFA 3GUHA 4PYJA 3MM4A 3NCHA 3ELYA 4X8OA 2INGX 3UXMA 4DV2B 3ED1A 1N1MA 3FSGA 3KJXA 3TNYA 1IRIA 3W5SA 1EK0A 3L40A 2CLCX 3N2KB 2ISSD 2L17A 1KAHA 2BMWA 4J9UE 4CMEC 5AIBA 4M98A 3TIFA 2Q6LA 1UT6A 1TTPB 4FFDA 1UK7A 4HBZA 3PPVA 4HYQA 4L0QA 3QXCA 4PGGA 5EHGA 5HKBA 2DFNA 4EUNA 1JR3D 2XCIA 1XDWA 4R7GA 4H4EA 4UDXX 4MCHA 1ZA1A 4M1WA 4YC7A 3FMOB 3ZGLA 3RVRA 3H9BA 3JYPA 4QDKA 1MX9A 3NJRA 3PP8A 4MIOA 4BU0A 4M7RA 2W6ZA 1Q0HA 2IY9A 3CYFA 1Y1KE 2D4AA 3NBKA 4IVRA 5AKEA 4YPFA 3ZY2A 4C6RA 5AW3A 2H4WA 2CMKA 4J91A 4I6GA 3SR0A 3VHXB 4OB7A 3BXXA 4BKQA 4GMGA 3G2IA 4EUHA 1ODKA 3NHJA 3R6TA 3WB1A 3EFOA 4PC6A 4UAGA 3CT6A 4U8HA 5EE5B 1QIDA 3GOHA 5JJKA 2WUVA 3GJYA 2OC4A 5JS7A 3PJGA 3PFFA 1DTWA 2ZJ6A 2X0DA 1MR3F 2G9UA 3DV0A 3SFZA 3H5NA 5EZSA 3WNCA 3SF8B 3UGTA 5CB4F 1VSUA 4E94A 1GWNA 5AW2A 2FB9A 1CJCA 4P22A 3RTCA 5C9ZA 2GPBA 2BVNA 3P9RA 2ORIA 4ZAZA 2AJTA 5ITZB 4EX7A 1LBHA 4Y2VA 1VXOA 3CF2A 3DT9A 1IN6A 1EFRD 4J0QA 1EFAA 2J9ZB 4X90A 4DE5A 2XB8A 1HYHA 1PJ4A 1YL6A 4YK7A 1M8JA 1DC4A 1AQLA 1U7ZA 2PTHA 4AKSA 4BBAA 4Q1VA 4BFLA 1NY6A 2FUEA 1PQPA 3MJSA 3PEFA 3ZK8A 4B6EA 4GM0A 4FTWA 3L6BA 4WGGA 4HAOA 4BVJA 4E2WA 3GWGA 4Y1FA 1X1AA 4KGVA 1U0TA 2ZI4A 1Q0ZA 4HYYA 4RJIA 2FOIA 5IK2D 1DINA 1C2YA 3MERA 4IR7A 4B73A 3GGCA 4RZQA 1H5UA 2WI8A 3D3WB 2EP7A 3R9XB 1IHYA 4FGWA 1SXJB 2XMPA 3ZLBA 1QIGA 4EI2A 3GLTA 3OZUA 4Q39A 5A9TA 2GK6A 2AT1A 1CYEA 4IXTA 2GF9A 3CN7A 2FGKA 1CZRA 3Q9LA 3DCYA 2GNPA 4WCFC 1MKYA 2PMCA 1BMDA 3NHYA 3DFIA 3NYRA 2V0GA 1OT5A 3M6XA 1M1ZA 1VPDA 5PGMA 1DZ3A 4CF5A 5CT6A 2VHEA 2QM3A 4EEXA 3CLSD 2FWBA 2PZEA 3LQYA 2C1ZA 4ZODA 4GVXA 4OCZA 3GJ6A 4OXRA 3AW9A 2XMRA 1V5FA 4YUZA 2VDKB 3LPMA 1KO7A 1F2TA 1MH1A 5JJBA 4WK6A 1KXJA 1PT6A 2QB5A 3BK2A 4UHBA 3TIXB 5CA1B 5IFLA 2WOJA 2BEWB 4L5CA 1XA4A 1YVRA 1L5HA 3OJEA 4LJAA 2Z4TA 4MPTA 3TO5A 3UK7A 3UWDA 1W0JA 4KWTA 1LK7A 4FDUA 4HVAA 4PM4A 3MPUA 3IEVA 1L6RA 3IILA 4DB4A 3A1EA 1DRJA 2Q3MA 3ZBQA 5LZ2A 3FX2A 3HGMA 3NV9A 4C6TB 5C5EA 4TZ0A 4LMRA 1SHKA 3IAAA 1GQSA 2C8VA 2H31A 1NP7A 2JANA 4YRLA 3SEZA 2I9KA 1OXSC 4GE3A 1O0BA 1ESMA 3DLBA 2Q9CA 2RKOA 1H6DA 1KVTA 1K08A 4LGYA 4WY8A 3OIUA 4B9EA 3DH0A 2OZEA 1INLA 4C5AA 5B7QA 3LCVB 3GEBA 4QC2A 3TIIA 2QTGA 1Z2OX 4A6XA 3JAKA 3FPGA 5DHQA 1IM2A 3RRNA 1IXYA 1Z2PX 4R3WA 3ZE8A 5KQLA 3WQRA 1KMQA 3D8TA 3P9IA 4FMCF 1SCBA 4Z9YA 3VR4D 1G5FA 5JNUA 1JMVA 1EQAA 4F21A 1SURA 2J3IA 2BTQB 2G83A 3FNQA 1XQ1A 4J0HA 4K9MA 4M1EA 4G1BA 2DERA 1F5NA 4G5XA 4RTLA 2C03A 3HL4A 2RJ3A 1PJBA 2GCPA 5EE1A 4D96A 5HP4A 4RH0A 2LDXA 1R3DA 4Q1AA 3TTTA 4C4SA 2J7PD 5IT9A 2W7TA 1SK8A 4PG7A 5AKXA 4HNVA 4W9NA 3TD6A 4OGFA 3Q85A 4MULA 1DDIA 3JQ7B 2ZW9A 1NBMA 3UUEA 3A2NA 4UMVA 4Z0HO 3IPAA 2I4MA 1UK8A 1AO3A 1GLNA 1ODFA 3JQ9C 4M0FA 1SB9A 3ODPA 3JRXA 4RA6B 5EY5B 1CNMA 3PFGA 3D31A 3U13A 4W9RA 5FYDA 1W8IA 4RD2A 4F2DA 2G4CA 4KVFA 1GCOA 2BFEA 2WM8A 2ZPAA 3ORFA 3VNBA 1XTZA 2P11A 3MWFA 3ONEA 3DWEX 2O54A 4ZYLA 1IMJA 1A50B 4PBTA 1QFSA 2R751 4RAQA 4YHHB 1EDEA 3VA7A 2NQTA 4JMPA 4RL6A 4CKZA 3HCOA 1EP2B 2EIHA 2NO7A 1PNTA 3DFFA 3L6OO 3P2YA 4HTFA 2LW7A 4W8HA 5F73A 1L5KA 1VIMA 1GV0A 3K8ZA 1GR1A 4DY6A 2YYYA 1G20A 4K81B 2E4WA 3CZAA 1LFDB 1NVAA 3BXPA 4MWOA 4TLMB 4WKOA 5B2ZA 3SXJA 3R23A 2HJSA 2XYPA 2EBHX 3UGQA 3SQOA 1JLSA 4OXXA 1FNDA 3ZS9A 4JSRA 1D6JA 1WUHS 1ZSVA 4B3CA 3CBQA 3L4BC 3HABA 3AU8A 3DDUA 5HOQA 1GZ4A 4Y2PA 2YJNA 4O1MA 4ANFA 2DKOA 4D0GA 3LDAA 3MWKA 4XGQA 3T0IA 4EJ2A 1RCTE 3VVLA 4KSCA 2ACWA 3PXUA 4UNPA 5FP0A 3WGYA 1H4VB 1T5DX 2HRQA 3EIOA 2CXPA 2PM8A 3ENKA 2H9AA 1XVAA 4ZAGA 3JAMA 5JD3A 1RWQA 4AZ0B 1TMGE 1FB5A 3HCRA 4WNCA 3WWEA 1V3UA 1W87A 4PZYA 5IANA 4GI3A 2W8ZA 1G63A 2ATVA 1DWUA 4JGGA 621PA 2GDJA 4ZD6A 5K8TA 2Y76A 1FRVA 2UUBB 4MWZA 3OP4A 2I4OA 5BNZA 2WIAA 4JXJA 4WZZA 4C4XA 4DA9A 1GFWA 1ZINA 3R0XA 3B1KA 4KOAA 4P4LA 5DN9A 3ZU6A 5LFAA 2Z6QA 1A8UA 3J7TA 4DV0B 4MW2A 1AM4D 4ENQA 3F90A 3GQBB 3CHYA 4FFOA 4FYPA 4ODIA 1R74A 2D5AA 1KOLA 2JHAA 3SQLA 3UIEA 4DIOA 2V8BA 4YMGA 5LLDA 2IDKA 4UPDA 1QCZA 4EFMA 4Y9DA 1A9XB 4NBLA 2CWDA 4O0LA 1SU8A 2J08A 4O33A 3BXZA 4MR8A 5EUMA 1QLWA 4MW0A 5LKRA 1OXKB 1V7QA 1AO0A 3OZAA 5A5EA 1F7VA 3KT6A 3MINB 2RC5A 3NR2A 1NN0A 2XX3A 4YUYA 1B23P 1R0SA 1XHEA 3IQDB 4H59A 2ZWAA 1T5LA 1AKQA 2HJRA 2XNDA 3KT0A 4US1R 4X6XA 4RD0A 4CMHA 4KQ6A 4ZP1A 1RQPA 3D2AA 1F9AA 1E6CA 5BWOA 1FRQA 2ILTA 2Z2ZA 3K09C 1I1HA 1AVTA 3AKYA 4IPTA 5FBKA 2X4IA 4A8JC 3ES9A 5DP2A 3PDIA 5KYXB 4FMBB 1KQFA 1I3NA 1Z6ZA 2ACEA 2P8JA 5GV7A 1GPWB 1KP2A 1ZHHA 1ZGBA 4FUQA 5FA8A 4DIUA 1F0PA 3DAYA 5TR9A 1WW3A 4UE3S 2QJRA 1T6ZA 3P5SA 2YVUA 4KV7A 1E63A 3AZQA 3DL2A 4X20A 5E4FA 4OI0A 3M2PA 5TS3A 3HXPA 3ZY5A 3P9KA 3DDOA 1K0FA 2PD6A 3U39A 2C58A 2IZ7A 2W83A 3PIIA 2JLVA 2VNKA 3O0TA 3JQGB 4RH3A 5HZHA 1N2ZA 1WJGA 4BMYA 4ENUA 5BSUA 4YJ3F 2VXCA 4ZRDA 3WYGA 4YPVA 4K9PA 1NKVA 3L7YA 2GPYA 1N6OA 2EYQA 1E96A 2HLHA 3EVCA 3R3UA 1OW3B 3IQIX 1S96A 3CKKA 2G9QA 3G0OA 2C9MA 2P1DA 1LD3A 1A1SA 1HXHA 4P4TA 2COUA 2JFUA 4ETIA 4AU1A 1TEVA 3W6ZA 4I55F 4FFVA 3U4QA 2QPOA 4MV9A 5ICFA 1VZ3A 4FI3C 1PR3A 5ALMA 5T8KC 5FULA 4IGEA 3UPDA 2ZJ0A 1TQ2A 3K0CC 1FFAA 2GYVA 2CVFA 1VLVA 3OZFA 2RGYA 3QE0A 3LDFA 1W52X 4YT4A 2PH1A 1EE1A 4DKXA 1ZO8A 4IFBA 3DGEC 1OTYA 4M0LA 3AEKA 3M0EA 3WL4A 1M73E 1HOTA 3ZWCA 3COYA 2WIKA 3MLAA 4OOEA 2FPIA 2NGRA 2OPHA 3RFCA 1APBA 3OTGA 1ZICA 1AKTA 2G0TA 3NOVA 2D1SA 1ZX1A 2VO1A 3VC3A 2GVNA 4LCEA 4R8LA 2IVFA 3P1JA 3UANA 3ZTTA 2P9TA 3DFMA 5JCJD 1U7HA 2CHGA 3BM5A 5DIFA 3VC2A 4JS0A 1KARA 3QTBA 5FBQB 1W35A 2JEYA 4DDUA 1U1FA 2VKQA 2Q2NA 2GT1A 4U9IS 4YNBA 2LIVA 3VUEA 1UKEA 4A36A 4RK4A 2RHCA 3MOSA 5B4UA 3NIDB 2WTAA 3C1OA 3D7RA 4IZOA 3HEMA 1OX5A 1DQNA 3DWFA 3ZXUB 1LLDA 1QH0A 1M34B 2P0YA 1H22A 1GFSA 1J6UA 4MTLA 5AM4A 2O8BA 1UBSB 5EWJB 2O1WA 3QU4A 5CPBA 3WMRA 3LO5A 3RBVA 1IOZA 1C3OA 5CYPA 2NUTB 3TB6A 5I7FA 1M83A 3N8KA 4EYSA 5HM8A 5KOHA 4AF7A 2AC2A 5HTOA 2Q1XA 4CF6A 1KP9A 4BY9E 1SUPA 2CWWA 1BTOA 2NYAA 3CXUA 3OIWA 3ASUA 3PC7A 1XV5A 1NSYA 4ABYA 1WL8A 1TLLA 2WDPA 2GMWA 1JNYA 3ILVA 1R4NA 4YFVA 2I6FA 3T3MB 1HDYA 3HBFA 2FPRA 1J8MF 2J5BA 2JIPA 4P34A 2XKAA 1AKMA 5JQGA 1SVUA 1TLTA 2V65A 2WWHA 1G3RA 2LZ0A 4ZTZB 3WGGA 4CM4A 4WK4B 1ESEA 3JQ8B 7MHTA 1SUCA 5AJHA 4AMYA 4RPCA 3PZRA 4D4MA 1CLUA 1AV6A 4KFUA 1HE2A 1L8AA 1YV9A 2OO5A 2XDAA 1T4CB 3DMTA 3HRHA 4MINA 1QCDA 2N46A 3U26A 4ZI7F 1H1TA 4AN0A 3BSSA 4JB8A 1P0MA 4BNDA 5J1SB 2OLJA 2W6PA 4LC9A 3SFVA 2DHRA 3ADCA 3PCTA 2O19A 2JLBA 1QORA 1GGJA 3AY7A 3M7IA 3F46A 2I4IA 2PGNA 3NEAA 1NI4A 4PYMA 3KVYA 4DEVA 1S8OA 3OJLA 1CV2A 5EA2A 4ND2A 5IASA 3W7AA 1WU8A 2HLDA 3A6EA 3Q1KA 4R0VA 5IAKA 1GT91 1QCYA 5IF9A 2IHBA 2ZTLA 3OTWA 4BO0A 1I4DD 2Q3DA 5E95A 3UOGA 1HDGO 2L0XA 3BMQB 4I36A 2HK8A 1NVVR 2QV0A 2IYSA 1RPNA 3DULA 1XMIA 1CUGA 2E89A 2I2XB 2OYSA 2Z9CA 3FGOA 4FIZA 4V24A 1TD1A 3ZS8A 4BWGA 2RGGA 3V4PB 1OAOA 3M49A 2AOWA 4IG9A 4GYYA 2H0RA 4H7DA 4RESA 4ZI3A 1DBRA 2MSKA 2H9IA 4CM7A 4J16A 2MYPA 2DFDA 4LY3A 2ZYUX 2VJQA 1M1YB 4D9MA 4OHFA 4KBGA 3UK0A 3AVYA 1UPBA 5A5DA 2PUFA 2ZS9A 4Q37A 4IUCS 4XQ0A 4CIXA 3CLKA 3V8BA 1XCMA 5HM6A 3DVLA 2HI0A 1ICIA 1RM3A 2P9HA 4TYPA 4Z7NB 2BYTA 2ZLBA 1GDTA 1NYRA 1CY8A 2X5KO 1P61B 4K9OA 1GCUA 3HDJA 1NWHA 4X54A 1T8PA 5IN5A 4TXHA 3TB4A 2JIZA 5HX7A 1RAEA 2BM0A 3BTVA 2PGOA 5AI8A 2W8BB 3S81A 2D4HA 2PSFA 1NQXA 1QX4A 5I4CA 2I55A 1MIHA 5K8JB 5IZ4A 3WSWA 2PGDA 2P79A 2P91A 2E5FA 4LHSA 8OHMA 1H8EA 5TF0A 3K0FA 1M0WA 2DHDA 3HO6A 4KCGA 1G60A 1W5BA 4MV4A 4N6NA 3MJDA 5AR1A 3THOA 3ZCXA 4BO2A 3OHPA 7YASA 4D9GA 2OLKA 4JFAA 4NH4A 4BBZA 4OVKA 4IILA 3G0HA 3CIFA 1KJNA 3BREA 2Y77A 2YFHA 2XQKA 4J4BA 2PLAA 3W4KA 5DHRA 4EG8A 1KKUA 4AUEA 1I6LA 4JEIA 2P9ZA 2B0CA 2OCPA 4UTVA 1QF6A 3K1AA 5EFOA 3ASVA 1DIRA 4PNEA 3UYLA 2FJPA 4H7HA 4IFEA 3NS7A 1A88A 1AQUA 4W7HA 1GKLA 5L3VA 3R5XA 3CVUA 1MC5A 2Y3IA 5EERA 2WIJA 1IN5A 5HIIA 3ECAA 5D1HA 3G9TA 2Q5QA 1TMKA 3EGIA 4CQMB 1C80A 1E6UA 2C2BA 1PZXA 3SU8A 4TZKA 3KEGA 2IBSA 3KFXA 4HWOA 2P27A 1C81A 2R79A 2BFPA 1Z8FA 3Q2IA 3LBNA 3R3HA 3UC5A 3VR0A 3HB9A 5JSFA 1B93A 3FYSA 3TZBA 2LP4Y 4I6JA 5BV7A 3AB7A 3GMDA 3SNHA 1YC2A 3HZRA 4Q7MB 3KSBC 1XQ9A 2W00A 1XX6A 5D6OA 1N2HA 5ICCA 2FN9A 1P8AA 1TJ5A 3MFYA 3FFTA 4AWBA 3U80A 4EJ0A 2XCSB 2FE1A 3LW7A 4KYVA 1U8YA 4GL2A 1K5HA 4OLHA 3JQBC 5LMNB 1RYBA 2QZ4A 3AG6A 1PYOA 1UEXC 2B2XA 3L1UA 5LXTA 3WGVA 1WDKA 4UEQA 3HJNA 1EUDB 2WSBA 1Z83A 2DSTA 3PUVA 3UJBA 5CDFA 1M2VB 1GEGA 1XDDA 4WESB 3JASB 4IS2A 2HBZA 3VI3B 1B7GO 4BIIA 3NG1A 1G1MA 2X2FA 5JQWA 4PZ0A 1KR2A 4XUGB 2H06A 2AMVA 3EZGA 3JV7A 1E5QA 2G5PA 4IH9A 1ZESA 4NJMA 4Z53A 1GZVA 2IIQA 3LF1A 5AHXA 5G0TA 4X6UA 4YT2A 4GGMX 1AGRA 1A82A 4YUXA 1RT9A 1QG6A 5J43A 3TSZA 5KJ6A 4JLNA 4OUKX 5FLKA 1E5LA 1JFFA 1G3QA 2QJTA 3E8XA 1ZJYA 2X8WA 4M21A 1U8ZA 1ZIPA 2O5EA 1RJEA 3C5WP 1UCFA 4FB4A 3HEAA 2A9FA 1MA3A 4MUFA 2O8EA 3UJPA 4QJBA 2QE7A 2CXSA 3U19A 1I5OA 2BEVB 2Z9BA 3QHAA 4UVDA 3ID6C 4B4KA 4ID9A 4HRYA 4CMIB 1E2MA 2PUDA 1N2BA 1M33A 4Q3BA 3RF7A 1GP2A 3VO9A 2A5GA 2D0DA 2Q21A 3PIRA 1MB2A 2ANCA 1MF7A 2XBUA 3EW9A 1QC5A 2C92A 4OMCA 4EFLA 4KPYA 1RCFA 1TO6A 1YHYA 1O96A 3NCTA 4Y0NA 1X8XA 3S1SA 3VVCA 1HLPA 1CZUA 3QEJA 3TVDA 2F59A 1DMSA 3HJCA 4IMPA 3IO3A 2CVZA 4LYEA 1AMOA 4HYEA 1JWAB 1G5IA 3BGIA 3OOEA 2R6FA 3FBWA 4FU0A 4HS4A 4DUGD 5B1EA 4Q9NA 1O97C 1XE3A 2FF7A 3JPYA 3ONDA 4BVAA 4JLBA 1PBNA 3L77A 1UJMA 4N0EA 5CVUA 3D3EA 4RZIA 1L8QA 2E48A 2JI9A 5EE0A 4F8YA 1XIVA 2W6OA 3FROA 4PAOA 4D25A 1UBOS 2O8BB 2C7BA 2IHZA 3O90A 2A9VA 1REQB 1ZSNA 1M2FA 2R5NA 3CZ4A 3O84A 1XD2B 3IERA 4DBLE 4DG8A 4M9XA 3W5DA 2WWGA 5BYBA 1HEUA 4QDXA 1YQXA 2HEGA 1HX7A 3SHOA 3SVLA 2EKZA 1KQ3A 3CO0S 4KQIA 1J09A 4BLVA 1B0UA 4EPRA 1AB6A 3OQIB 4KWHA 1GJRA 3HRIA 4UVIA 2O4UX 5LP6F 3WQHA 1MHTA 4YRCA 4Q15A 2DPYA 3JRWA 4HVLA 2AX4A 5EP3A 2WFZA 3EA0A 4RU1A 3KE8A 4D1YA 3DR3A 3I12A 3PNSA 3CPSA 4G1MB 1O5IA 4UUBA 4Z1OA 5A62A 3SZRA 5J5VA 4US2R 2VP5A 3GGGA 1GCAA 1IOVA 2QAGC 4PFQA 3W3AH 3PF8A 1KJQA 2PL9A 2NTJA 1E9FA 2DQ4A 3G5TA 3ZJTA 1R10A 3DOHA 5T4HA 3LPDA 5CCBA 3TH5A 2A5YB 3TQHA 4P0PB 4UZSA 4BGEA 3K53A 4G0NA 2ON6A 3K70B 3QWBA 4BUJA 3CZQA 3QBTA 4MB2A 4RIEA 3V8MA 3FUTA 3W6OA 5HHTA 1WUTA 4V2UA 1FXUA 3RS5A 2RSLA 4Q9JA 1IWBB 1CUBA 2FFBA 1M1NB 4UOEA 1AKUA 1E2LA 5JWRA 2FMXA 3UHJA 2QXUA 1G17A 3R5HA 1E6EA 4I19A 4B0PA 2Q4BA 4TUYA 4UM8B 1GTG1 1P1BA 5BW5A 5H16A 3K72B 1QGOA 1BKDR 2NZYA 3G68A 4L75A 2ZZMA 3N8IA 3OHSX 4ZVMA 4CMKA 1EUZA 2Q5OA 2E6KA 5DBFA 5DULA 4QQRA 4KXMA 2IQIA 4YQZA 4CIBA 3GLIA 5F76A 5LB4A 2P5YA 1VE5A 2WNIA 1ESNA 1IATA 1YQUA 3CW9A 4KXXA 4GSYA 3W3AA 4QEKA 2VJYA 2GZDA 2QSYA 1EFPB 4X0EA 1QP4A 3T7TA 3MMXA 3A4IA 3TGWA 4N5DA 2DPMA 2R8XA 2VA8A 4INOA 4FHCA 4RETA 2H4ZA 3M6MD 2AE2A 2C9OA 2GEBA 1VJCA 4CEJB 1WEKA 3WHLA 2VCHA 4ZPXA 1Y6QA 4I4TA 5CXQA 3OPYA 1NW8A 4FXPA 1NJGA 3B1ZA 3U7RA 3V34A 2ZRIA 3R3XA 5L3SB 1JHAA 1H5QA 2I1VB 3C3YA 3DDWA 2D62A 4HAWA 4L16A 4CCWA 3AZPA 1ONSA 1HWYA 2NU6A 5CGZA 3T35A 3TQFA 2VDLB 4E51A 3V6LA 1NBAA 3C3PA 1R8XA 3H1AA 1YQQA 3DE0X 1O57A 2F9FA 3BGWA 4YI5A 4CBVA 1O94A 2FW8A 2DTDA 3QKUA 3TLJA 5JALA 1FTSA 4B85A 2H5IA 2X9LA 2C7OA 2HSEA 2BEJA 3JD1A 5AVSA 5KTOA 4AKGA 4MJXA 1CR0A 1MPTA 2ZJ3A 2NM0A 4EYKA 1Y3CE 1PW5A 5AVKA 5TPWA 2WA1A 3KKOA 4KOEC 3LUJA 2WSIA 3A9CA 4BWYA 1YGPA 1UMBA 4J76A 3O91A 2G8NA 1CVLA 1WG8A 3C5HA 1HG0A 3L1JA 4FYXA 4GYWA 2CXQA 4PX3A 3G9QA 4XPZA 3SLGA 4A16A 5BNIA 2OZLA 1OFHA 2V6GA 5T64A 2MSDB 3D59A 2CE7A 1MPXA 3FCEA 2DUJA 5KCZA 2ARKA 2X4GA 1XPJA 4X97A 4G0UA 2X8BA 4NMMA 5JISA 3MBKA 3MRSA 5TQ0B 3SF0A 2ZWVA 1TCUA 4ZV4A 3P0IA 4UBLA 3F97A 1QE3A 1YR1A 1PR5A 1ATIA 2R5WA 9LDTA 4M6WA 2RB4A 3TNLA 4Q48A 4HPJB 2HRZA 2GS9A 2IHVA 3I04A 2ZE5A 3LBAA 3R4CA 4KLAA 4MKGA 4P80A 1H0HA 3GI1A 3FSGD 4AG3A 3C15C 2JI4A 3R1IA 4Y2QA 3ZOZA 1NX6A 2Q4RA 4TXMA 1WB9A 2DTXA 3INGA 4HB0A 4PANA 2LDBA 4PXAA 1S7CA 3JVUA 2DR0A 4Z0PA 3VR3A 5L51A 3A4TA 4OYHA 4R5HA 4RQUA 5H3HA 3OPVA 1EI9A 3BE4A 1SCUA 4U7WA 4B5KA 3CIOA 4CZ2A 3SFTA 2BGKA 2O3UA 3RASA 2WD7A 4A6PA 2WUDA 2O0JA 5H3LA 3JVDA 3OM0A 2CV2A 2AF4C 4IH4A 1AKYA 3KSRA 4FC6A 2ETVA 2RHWA 2DBRA 4NOMA 2FEAA 2VT3A 4TLAA 3D7NA 3TFOA 1V1RA 2JLZA 5ALPA 1BE8A 1MAUA 3U4IA 3DXXA 3T1NA 4PG4A 3H6GA 1OIXA 4DR3B 3RI3A 4B75A 3O5AA 1YB5A 4BLPA 3WGJA 3PUIA 1VCHA 5T5QA 4A2WA 5AOAA 3MTAA 3L7JA 5CIWA 1BRMA 5B6PA 3CE9A 3N86A 4J0CA 3UHOA 3BWXA 1NXOA 4H6XA 3H2BA 3PVCA 3RAFC 3KQSA 4M0EA 4QKQA 3BL8A 3K2BA 3UA3A 4TVOA 3ZC3A 4WRRA 4EPYA 2XHZA 2FV8A 2PWPA 3IOBA 1I2CA 3N3BC 3V2IA 2FDCA 1YVUA 3N2KA 1RPZA 4F60A 1TVCA 2HU2A 4WOPA 3M33A 1D6NA 1LB1B 3I1YA 1LPPA 1DV1A 1E5VA 2HGSA 3P45A 4HK4A 5U1PA 4AUNA 2WU4A 3GJ8A 5BWBA 3ML1A 4WKPA 1C8BA 5GJVC 2AW3A 5BNFA 3PZBA 4ZZ3A 3R8FA 4NNPA 5AW1A 1CQXA 2L19A 2NZJA 4QPDA 1TECE 2WJVA 4GPZA 5HPYB 1SQ6A 5JQGF 1VPWA 2PANA 3ZHQA 2Q45A 4K6KA 5FBWB 5JS6A 3V4LA 4C29A 4FR2A 3AETB 1USWA 1PVOA 4OI4A 2J5QA 2PKEA 4ZTBA 2IH2A 4WXHA 4PRYA 2W6QA 3LKVA 3NBQA 4FR0A 3KUXA 4U7DA 1OFUX 2W58A 4G65A 1GNTA 5F33A 1NDQA 4FFBB 3P52A 3MNFA 5EVJA 4EG1A 4H17A 5E2IA 4E1BA 3HWRA 4EZBA 3SF8A 1CG6A 2AFHE 1BXKA 3QQ5A 3QUSA 4PSUA 3CRMA 3LQQA 3C3MA 4IVQA 5ITZA 3HBMA 4UU8A 3UMMA 1QDEA 3QKTA 1GO2A 3OFKA 4DKJA 1TK2A 1II9A 1BXZA 3KTOA 3OKFA 4HUQB 4ZQBA 4GP9A 1RQXA 1EXWA 1W0JD 2C61A 2GO7A 1V41E 3PC8C 4Q3DA 3ZHBA 3K5IA 1GRCA 2CNLA 3QFFA 1PV1A 4NIMA 2EP8A 2FXVA 3BGSA 3WWCA 2H7YA 4PCLA 5AM3A 2A9OA 2X1MA 4M9ZA 5HK8A 1QQ5A 4KU4A 2VHYA 4WCFB 5IBCA 4KFCA 1CUXA 5AOVA 1XMJA 4YMTA 2C99A 2YS6A 4RFSB 1CJSA 1H0KA 3D3WA 5FTLA 4OG2A 3WSTA 5JMTA 4MW7A 1SXJA 3R9XA 2NT3A 1A8SA 4MICA 3UJ8A 4I14A 1U0HC 3LBYA 4MVJA 4ARCA 1V4NA 1JHYA 1NOKA 5DE3A 1CIPA 2B98A 2QLLA 4NAUA 1NUUA 3LTEA 5FFNA 1Y8QB 5IZCC 5DX8A 1ADGA 4IEIA 3CF0A 1CDZA 1GQOA 1RJGA 4LSGA 4UMDA 4OHMA 4QSHA 1RQGA 3Q8KA 3VJLA 2AI1A 3Q2OA 3WE7A 2KQUA 4JY7A 1XELA 3RBAA 2FPPB 3KJGA 1PSWA 5FWDA 5I5GA 3E9QA 4FYMA 5DKFA 2Z1NA 2R1UA 1E66A 5DYYA 3S1AB 4LZAA 4Y6SA 4Y2JA 4BB9A 3IESA 4EZIA 3DUFB 3UVEA 1S7GA 3CZRA 5CX1B 4IWYA 5CA1A 1Z7GA 1V16B 2BEWA 2G9VA 3DXYA 3L0CA 2H65A 2X5NA 4ZAYA 3RUEA 3EQ7A 2OQVA 3NUQA 3VR5A 2LKDA 2IQ5A 2D8AA 3G0DA 5KNLA 2LKCA 1U9JA 5EXTA 2AW5A 1JNXX 1G8MA 4NY1A 1Q6ZA 2XMCA 1W2GA 3MTDA 4NENB 3S6JA 3UMSA 4A3SA 4YECA 2XQIA 4XVCA 2X13A 3L79A 2G28A 2H1RA 2ZUUA 1J8DA 4H7IA 3KYJB 4ZQCB 3TJZA 4C6TA 3HCNA 2WAAA 4LWQA 5AHOA 5JNTA 3AV3A 3FOCA 5FKJA 1VP9A 1Z5PA 1WTAA 1XVVA 1QIIA 4HQLA 2M6LA 4DVGA 4F97A 2RGNA 3UG6A 1FLAA 3MRVA 3VBCA 4YWHA 5IJ0A 3GZ4A 1QRAA 3LQKA 4OH7A 1Y33E 2PS3A 1QWSA 2ZUTA 3OX2A 2HPZA 1ZKDA 3KOZA 4DRYA 1KI2A 3KHUA 2OD9A 2P2YA 1GA1A 2A8YA 4KACA 1NUQA 3EGXB 1T35A 4ZA2A 1MJNA 4ZCSA 1LZLA 5SY6A 1M54A 1B3BA 2B94A 2W0MA 3CX4A 2PVCA 5HA5A 4OKIA 5BSRA 2BTQA 3OZTA 2Y0DA 2QPTA 4M55A 2XKBA 4FS3A 3P5BA 4WHMA 5CVVA 2PZLA 2GZMA 3H0EA 4G84A 1SPXA 2VRBA 1FZQA 2C4KA 2HMTA 1AN0A 2YZGA 3ADOA 1AB5A 1L2TA 1SEVA 1T8RA 1U7TA 2CBGA 4HQOA 4J7XA 1B26A 3DPUA 3WDLA 2QX6A 3TNFA 5LXTF 5FNZA 4LWPA 3R75A 3AF2A 3HJRA 1IBRA 1D2HA 2HU7A 4J1SA 4UDYX 3O2SB 4KN8A 3GA5A 5EHXA 3OCJA 4B09A 2QD4A 4RA6A 1LDBA 2XF8A 1DMRA 5IAGA 5JMOA 5B1DA 4U8GA 3HG7A 4AYWA 1TA9A 3VC1A 2BCEA 4HNGA 4MO9A 5LPNA 2ZZNA 5SV2A 4N3BA 4H60A 3WJAA 1JTVA 3KP1A 2VQ6A 5C4GB 1JPUA 4MDYA 5DM60 3COPA 3B70A 3TPCA 4CGZA 1RE0A 1E8NA 1YWGO 2OQ2A 2LCIA 4P3OA 4U02A 4XGIA 2SICE 4FFRA 4ZCRA 1X38A 2O0HA 5GONB 1U4SA 1UWKA 3I2GA 3JATB 4EZEA 4GE0A 1R0BA 3ZXIA 4IYJA 4Z7JA 4F86A 3R5KA 3Q3IA 3O47A 3BCRA 3D7SA 3WXBA 3M82A 4AUMA 5C4IA 3TDMA 1LQTA 1P7YA 2NX2A 3KG2A 3ZU3A 4E11A 1LSUA 1QHHB 1CJBA 3D6HA 1WQ3A 3O4RA 3PRYA 5EQDA 4ZVNA 2FRXA 4AF6A 2O7QA 1T4BA 5REQB 4Y2YA 2VAWA 5C31A 2SKCA 4DA7A 5B30A 4B3MB 2AEJA 4ZXPA 3SNKA 4EGCB 2FWJA 4YH1A 3AP2A 2OGTA 3QVWA 4IJWA 5B58T 4Z3KA 2EOAA 5I6DA 1UPAA 1EVJA 4MW9A 1SRQA 5F1YA 3CLRD 2YBEA 3PUZA 4TL7A 5ADVA 5KYGA 4AZ0A 2PX8A 4YRBA 2IYWA 5HQ3B 4B6JA 4BE4A 4BEJA 1JHXA 4RD4A 4HGNA 5FA6A 4RV5A 4IDDA 4WJKB 3QIAA 5D5PA 3C1UA 1XKTA 2YDXA 2IHNA 1PJQA 1J8YF 3ICPA 4R8VA 1L1RA 2P4SA 3L0BA 3E8MA 3U48A 1GPMA 4G0VA 3WLNA 1U0LA 4GEKA 4TT8A 1KAGA 3TQSA 2ZSDA 5I9NA 2XWPA 4D45A 1U2RA 1SHLA 3IUYA 4N3CA 1CUUA 3QVJA 3CUYA 1BE1A 3AR5A 3X2EA 2J3MA 5B64A 1J9GA 3GG9A 4BGUA 2ADOA 1XRLA 5BV2P 4R84A 5KOJB 1E5DA 2IZ5A 4Z6KA 2BSAA 3N2EA 4BKRA 5HFJA 2C5LA 4A8JB 4DV6B 1M6VB 5G1NA 5AUNB 4LJ6A 2V7BA 1NM5C 4YI3A 2ZANA 1YK1A 1NATA 1TX4B 2HBQA 3I9MA 3IPRA 3VH4A 5COAA 5KYKA 3D0KA 1WSDA 1NUSA 1PE0A 1KK1A 3NIWA 1KE2A 4ZK2A 2O6HA 2XW6A 5HKOA 5KSZA 1LVGA 2PTGA 2WUEA 4RS4A 1M5UA 2VHQA 3ETLA 4YALA 1JIVA 2FSPA 3ZU5A 1RU3A 1V4VA 2OBLA 4OP3A 3TSOA 3UBTA 3QVMA 2AGVA 5KYXA 1P2UA 3RS7A 3RWOA 1UR5A 1X15A 4ZCTA 1Z5UA 5LQAA 4UDNA 1Z74A 1XDGA 3RUFA 5DT9A 3VAAA 4TTSA 3ROFA 4Z4IA 2CL5A 1A76A 1EX1A 2E2WA 2GNAA 4UHEA 4UTRA 2WMYA 2OV1A 1FX0B 1KSJA 4REOA 1DKQA 4OAOA 4ETNA 3B3JA 3LQFA 1R5JA 2JNWA 3I58A 3JQGA 1X7WB 4NZOA 2BN4A 2JLWA 4F3RA 1KZGB 3Q9NA 3GZJA 4K05A 4MEAA 4UNIA 4TUYF 1ZKMA 3NASA 4PC7A 3R9WA 2X7JA 2QYHA 2PUWA 4J0IA 2PE5A 1Y4DE 2GA8A 3QX7A 2HA5A 4W1QA 4EECA 5HUQA 4LGVA 1R0XA 1P72A 3PU6A 3ZLUA 2EIXA 3CX6A 3LBFA 5CW1A 1DFHA 4MV5A 1EVKA 3WRWA 1JHVA 2BTOA 3AW8A 2QM7A 1RM4A 1NFRA 2Z2IA 3LOQA 4DLUA 3UXEA 1HL3A 4DB2A 3TLMA 2R47A 4N1AA 3HB0A 4UUAA 3B2QA 2GKOA 5KMGB 4LTDA 2R4UA 2Q46A 3DW1X 3SVZA 2FUG1 3ABRB 4BVEA 4PLWA 2W2TA 2XZDA 1I14A 3L0PA 4RMGA 1KEEB 4I4TF 1N2EA 3A7EA 1ZW1A 5DBOA 2GXQA 3WZLA 4YV1A 3S40A 1X2BA 3A14A 2O8CB 1J8FA 3VDMA 2JFBA 3ZWNA 1VFPA 3KLOA 3CGWA 4NABA 4NPAA 2NP6A 4P53A 2XCOA 1EZZA 5ER6A 5SZKB 5IUKC 2XIJA 2FWAA 1N1GA 1J7JA 3DHVA 3DEZA 1H9AA 3LLMA 4JQYA 4QNNA 4WPGA 3TEFA 4GKBA 4BRZA 2SECE 1TO2E 2B7LA 2XYGA 3B8HA 4GR4A 4FLFA 4JIGA 3OUUA 3ZH2A 3ZWWA 2JFHA 2BP7B 5AOBA 5JJ5A 3GGPA 4Y1RB 1SBTA 1PN3A 4TQGA 2QIPA 2PZMA 3TX2A 2WM3A 1JPVA 1PF7E 3TMKA 2P3OA 1M34A 1ONPA 1Z33A 4ZVQA 3TDNA 3RRMA 2RGAA 5EWJA 2PRYA 3CR8A 4OQDA 3GLGA 1MAHA 2CNWA 3H42B 2NUTA 3PV0A 4Y1EA 3E5RA 2XKJE 4EG0A 2XB6A 4LRYA 1X7ZB 4UZEA 1IN1A 1M7HA 1YKFA 3AT1A 1RXYA 1CNFA 2PMDA 3TKYA 3TN7A 3B6EA 3M34A 3OH8A 4NNOA 1CUCA 1EGAA 1K6IA 1CY2A 1RHUA 2C97A 2YHSA 4ZOAA 3ST7A 3U2QA 2FRDA 4W9MC 3C3KA 4LW8A 4ZN6A 3CVWA 4DA6A 3FJ1A 2ZAGA 2V7XA 3IEXA 4DGSA 4EYQA 2LWIA 5AKHA 5H4HA 1QYCA 5I45A 2QRLA 5I3ZA 4L4RA 1Y3FE 2FP4B 2WMDA 1NJSA 3JQ8A 1E9RA 3EWAA 2X23A 2C5GA 4K6FA 4QYTA 5B3LA 5KNDH 2IPMA 3DOOA 4FGKA 3CEJA 4KE6A 4Q3AA 2A2ZA 1V6AA 3MCAA 4FLEA 1F4PA 4TWZA 1T4CA 2QR5A 4I5FA 3QJ5A 2HWWA 1QV9A 4P33A 4RXTA 1R0KA 2HSDA 1NQ5A 3THRA 3WYDA 1XEWY 4DADA 6LDHA 4R8MA 4G25A 4UCWA 5ICMA 3DOFA 2CKDA 1MX3A 1XNJA 2FQWA 4FD2A 3BBPA 3SX2A 4Z51A 4C20A 5K8UA 5I7OA 4KWEA 3CVOA 3CISA 1IH8A 4F9EA 3LUBA 2BGGA 4R16A 3O94A 3A3KA 1SXHA 2CEKA 2IITA 2QU7A 4Q4LA 5EI5A 4F71A 1LU9A 1Z22A 2IOFK 4YP0A 3BMQA 3FCCA 1XZHA 4ND7A 4X45A 4JVMA 4BNTA 5KHLB 1OR8A 3I1FA 2AQIA 3GGDA 5DW0A 3VZSA 3WGLA 3RAPR 4EHDA 3PT5A 1JAHA 1KDYA 2KYRA 5BV0A 4XVQA 3U5ZB 3DFUA 3DE5X 2GXSA 2ZRDA 3AEUA 4QGBA 2BL4A 2JVJA 4AW9A 2PBFA 2HRBA 2YWRA 3PYXA 5KNDA 1JE1A 4D3YA 3IEMA 4E2ZA 2XNJA 5I3CA 2ZRJA 4KKVA 1L7PA 1NASA 1Y3AA 1Z06A 5EUQB 3JQCA 4KE8A 5EQFA 3OKCA 4QQFA 2ZJAA 2WTNA 5F51A 3JALB 5CFQA 4GBJA 3R6DA 3FPEA 4RTRA 3EGWA 4WSOA 4RC9A 1RQRA 2VJNA 5EWLB 5K2MA 1DLJA 1XRPA 3ZCQA 1C0IA 4YUAA 3LXUX 5BN4B 1THGA 1YRYE 3PHGA 3BGVA 821PA 5FUBA 5AK5A 1BROA 3HN6A 2W8BA 2WKWA 3I2HA 3RODA 2CLHB 3A2LA 1CQJB 3PC4A 5BORA 2WIDA 3HA2A 1JF8A 1JT9A 4WY2A 1U2DA 2OCBA 4TSKA 4UTZA 3VO1A 3U3MA 2O1EA 3VYUB 3F4LA 4ON9A 2YDYA 2C8JA 2PLWA 3HCDA 2IPNA 4HNSA 1LPSA 2Y1XA 5J9FA 4BO4A 3GCWA 3ZZ1A 4JQSA 3GRFA 3OJCA 1XMQB 2YJTD 1HO3A 5FAKA 1QR6A 4KDRA 4ZPJA 4XVUA 5ELXA 1Y81A 2FJ0A 2G88A 3S1LA 4YQYA 1SQFA 2B4QA 3AF3A 3KZVA 4Z0NA 2Y9MB 1MJ5A 1Y48E 2CL6X 2B6HA 1MTOA 5JCZA 6PFKA 1XAGA 3PE6A 3QP9A 2AFIA 4HQ0A 3U44B 3AB8A 3AY6A 2ZJ5A 2WHRA 3ZBUA 4BBJA 2IKQA 3D1JA 3I9KA 4D56A 2AWOA 5JIBA 5JS2A 1ODSA 3AFHA 3HADA 1QIJA 3OICA 3B3FA 5ADWA 4DLNA 3T7SA 4QJ5A 1L8LA 1XLTA 3QLVC 4Q7KA 4ZDIA 2R6R1 2QYSA 4CQMA 3NAQA 1Q2XA 4LV6A 3WO0A 1VECA 3LYAA 4DTIA 4P98A 1IAVA 5HSGA 4DIKA 1SGWA 1YHZA 3A9RA 1JG1A 4J4TA 2WIGA 4OQ4A 4D8YA 1ZMBA 5H80A 2DC1A 1ZZEA 2QG6A 5FQNA 2J0QA 3BA6A 5FPQA 2VN8A 2C5HA 2YNMA 4UQPA 3M6AA 1NRIA 1Q91A 3SZGA 1LVUA 1U0EA 5I8ZA 3HBLA 1QXSA 2BFAA 1JEJA 1IHPA 4JT2A 3IP5A 8ATCA 4WN3A 4J3JA 1NVUQ 1PP4A 3VHQA 1XMPA 3T34A 1JU3A 2A58A 2HMYB 3PUJA 4PF1A 2FQXA 3TE7A 1FUYB 2X7HA 1EUDA 1C0LA 3TEJA 2HY7A 3BIJA 2VPIA 3P2IA 3RVOA 3ZLVA 2J33A 1CF9A 1V2HE 2FCAA 2IYTA 1M2VA 4MVJF 1XLUA 3KQHA 4WESA 3JASA 3FCAA 2VAMA 3SIXA 4UNQA 1UXIA 2EKQA 5F3RA 4ILEA 4DRXB 1N3LA 1U9IA 4ZDJA 3CF4A 2IYLD 1HDOA 1T9GS 3NDIA 4K2HA 2X2PA 3B13B 3TL6A 4C0LA 1Y1RA 5G41A 3W04A 1DPGA 1T8YA 2ORED 2H1FA 1BYUA 3VGJA 4IV8A 1ISHA 1IDOA 1DARA 1TQ8A 3D0RA 3DNMA 4RPHA 3H65A 4WK2B 3G2OA 1BEEA 1RZRA 2RHOA 5JRJA 1G42A 2RK4A 3ETCA 4RDHA 4W6QA 5CA1F 4RAOA 4L4UA 3PE3A 1VDMA 3QLJA 4GX0A 1N33B 1YB1A 1VSVA 4X7PA 4BPBA 3JWGA 2Q1TA 1AGPA 3M6WA 5DMHA 3MJ4A 1K88A 5K3BA 3RC7A 1PRYA 1FEZA 2ZUDA 3F6YA 4TYNA 2CV0A 2YXNA 4JH0A 3T5TA 4B4OA 2C9BA 3GLKA 2IZ0A 4MUYA 4ADSG 4YMHA 3HWSA 3OCZA 4MWSA 3G5UA 3TOXA 3FDZB 2WPDA 2JJMA 2FW7A 2QYTA 3FSRA 3PGMA 4W4TA 4LFAB 3KZMA 3MFQA 3PHLA 4GBED 4E22A 1JL3A 1RM0A 2ZWOA 2YIDA 4WADA 4C0HA 1DCTA 3T3OA 1TJ3A 4GQIA 2N1BA 3N0TA 1NVFA 2BGJA 2IL1A 4L1KA 4MQFB 4BNJA 4WKBA 2O1XA 3WWYA 1M8KA 1SZPA 1DCFA 5MFPA 3FR7A 2EZ4A 1C4KA 1OJ7A 4XLZA 1RPJA 3GFRA 4A8TA 1LX7A 2E82A 2A14A 3KXKA 1BXGB 1D2CA 1B42A 1EP1B 1I5EA 1O95D 4RD3A 1P9WA 3V33A 5JNRA 3U1BA 1REQA 4C30A 4OK6A 5H5JA 4GIBA 4ECEA 1CB0A 3PKJA 1U04A 1TYZA 2GM5A 3QUBA 2BKLA 4KMSA 1W49A 2C95A 5KSOA 3STUA 4TMXA 3RUCA 3LXMA 4DV3B 3GC6A 2RG7A 5FV4A 1P45A 5TLSA 4MX8A 1U0BB 1IUOA 2EV9A 5ITSA 3OQIA 2QAGB 3KSDO 2OHIA 5DHPA 2OB1A 5IJXA 3S27A 1YTLA 3TRDA 5KDOA 1EJBA 1FFHA 1I2ZA 2IJGX 3G2LA 4LI3X 1NURA 3W3AD 1W5TA 1VBNA 4BRWA 1RI4A 1UFOA 5IXYA 4JI7B 2JVKA 3PEEA 2XOXA 3RS0A 2A84A 1FLVA 1K3FA 3C7AA 4KN9S 4LX8A 2DAPA 4AVYA 3WAJA 3K0SA 1T6BY 2W4MA 1E2HA 3A32A 2ET6A 4P3PA 1KI9A 2Q41A 3GEEA 4KHZA 2W2MA 3G7SA 4F2PA 1I4LD 1YFZA 4LXQA 4RJLA 4RV4A 3VNQA 5G53C 1RWXA 1IZYA 5FRDA 2LGJA 1E94E 2CLMB 4PN7A 1W44A 3LX4A 1QDLB 3DXFA 1NUPA 4KKXB 3FCOA 4IRUB 2E9SA 4G1EB 4ILKA 5K5EA 1RZUA 1GZ7A 1B3RA 2XQJA 3R6LA 4PAMA 5GWXA 3NXKA 1NV9A 4DNXA 1HL7A 2C00A 3PDUA 1O94D 4X3PA 1M1NA 4MUHA 1S9DA 2WY2D 3KKMA 3KV1A 1HE1C 1HKHA 2Z4SA 1WMEA 3FPBA 1CFJA 1FRFS 2Y2VA 3KKPA 3GN1A 2D3TA 2QLBA 4NV3A 1G9TA 4OXNA 3BE6A 5EEGA 4NOKA 5HKAA 3FWYA 4B7XA 4F8EA 2AK2A 2XDYA 3LUDA 3O38A 2VHJA 4JBNA 5J1TB 3K94A 1OAKA 1VLMA 3NC1C 4IX9A 5TY0A 3QY0A 5A4JA 4YRGA 1PR4A 2OT3B 2PXAA 3C74A 4QDTA 3GL9A 4X7BA 1P6QA 3VUFA 1GU7A 1K7YA 1VFNA 2BDEA 2VDVE 2O6LA 3C5VA 3IA7A 2IDMA 4IJUA 4U7HA 1G3MA 5AHRA 3ZQKA 4BATA 4D99A 5HGXA 1AQYA 3TQOA 5KQSA 1TA4A 2CEAA 2F1JA 1IAQA 4TS3A 1ECFA 5IHXA 5G02A 1Z08A 3I9NA 3HUDA 4WQMA 4KMMA 2OBBA 5HKKA 3GBSA 4MXDA 3W8NA 4C2AA 4MITA 3IFSA 4N8EA 3IULA 1N8KA 5AM5A 1P2GA 1NZJA 2WP0A 2Y1KA 4CEJA 1NQWA 4GOKA 3E9MA 1BCRB 4A92A 4DC1A 1CK4A 5G4KB 5DCUA 2PKXA 4JYCA 5JD5A 3WKBA 1A4XA 3AY0A 1T3TA 5KJCA 1TMYA 4H77A 4HAXA 3BIFA 5KSWB 2Q7DA 5L3SA 1MLDA 1PTKA 1Y9ZA 4GPD1 2QJWA 3EY4A 1JQ5A 1Y4ZA 3LPLA 1ZI8A 3HNOA 1C0PA 1TB4A 1W4LA 2R0QC 1FFBA 3DHWC 2W48A 1I7PA 5KWEA 1E32A 1S4MA 3RSSA 1BRTA 1YI8A 1ZY2A 2CLSA 2P67A 3CO5A 4PNPA 4RYLA 3EVNA 1GUDA 4Z1MA 2I6SA 3VMMA 1U28C 3W06A 3E9CA 3N8NA 4DBZA 1VCIA 2O0LA 2WK1A 2YUTA 3ZJYA 3UAGA 4GUAA 4E4RA 1E62A 2ZPUA 4LE0A 1KWGA 2ORWA 2C4MA 2C2GA 3FRHA 1XXHA 1GAWA 1TYCA 3QX8A 4M9SA 4CLDA 4MGKR 4F3KA 4KN5A 4WLOA 2ZXUA 1QG0A 3JRNA 1LTKA 4B6PA 1G21E 3TI7A 2IYFA 2GZ1A 3DUWA 1M2NA 4DEYA 1O8BA 2R6GA 3PDWA 4MVXA 4LF9B 3KOYA 5L7TA 1C9YA 3TTYA 4EPXA 4C1NA 1SH7A 2GBLC 4A2CA 3PG5A 4PLPA 1UBCA 4BLRA 2X77A 1FXWA 3HUUA 1CWUA 3AFOA 5EMLA 4GYJA 5CAEB 1GQRA 2OOSA 4JASB 5TQ0A 1OD6A 2GKGA 5IG2A 2UXCB 3CJTA 2WMOB 2XZOA 2ODBA 3AONB 2JATA 4EGFA 1Q16A 3HSYA 1IPFA 2Y05A 3CNEA 1AQ6A 4HDSA 1H85A 1P9NA 2HJHA 1P7PA 2DE0X 1GVHA 1CEYA 2P2CA 3BDVA 1CJTC 1FJ2A 1JJBA 4R6XA 2H17A 2ODNA 1VIDA 2QMEA 2H18A 2QV7A 3V8EA 1RWNA 2PGAA 1NC3A 1WHTB 2BH2A 3NIFB 3W5UA 3KE9A 3GRKA 1FUEA 3PLAE 4ARZB 4BQIA 3KVOA 5LYJB 3THWB 1PYDA 2ZITA 4ML3A 1YCGA 4L0MA 3DAGA 2W5UA 1RACA 1P31A 1VI5A 2Z8XA 3BIOA 4YCSA 4OEHA 2A7QA 4RYDA 3ZW7A 4HDNB 3ONFA 1NONA 1F48A 2WABA 3NM6B 3FHJA 3OQNA 2FQ1A 1GZ3A 3CG4A 4GH5A 3A1CA 3X1JA 1ZGGA 2G1UA 1YZGA 2KE5A 4Q66C 2NZ2A 3RVLA 3ZE2B 4EHFA 5JCXA 3IJ5A 4NDAA 3SR3A 1KETA 1Y4UA 2VEOA 5JRDS 4QELA 5EJ8A 3Q3EA 4N39A 4FB5A 4X60A 3M2TA 1QO0D 4UHDA 5I9TA 4BB5A 3RGGA 4D57A 5AUPB 1CIVA 3ZDQA 5CFOA 2WTUA 2HAEA 3PLNA 2WV7A 3W6PA 1PGPA 3U5TA 2GAAA 2WU3A 4PZEA 2R48A 1OA0A 2GYUA 2Q1SA 3HR8A 2JGIA 3T9CA 4E5UA 4EJSC 1FMFA 4AT1A 4UHHA 5ENVA 1RHJA 1RKXA 1TTTA 2X41A 3FPCA 1U98A 2P6MA 3LZCA 3TQTA 4BWVA 2J5KA 4Q18A 2OXRA 1OXTA 3T9EA 1DEXA 1PJTA 3I4CA 2OV3A 1VHJA 2DVMA 3OIFA 4UQOA 1T8UA 4KZKA 2EBUA 2H7XA 3IXMA 3MMNA 1LZKA 3VJMA 1ZM3A 3WIBA 2OORA 3P2KA 1JYSA 2CLDX 3EFEA 4QOEA 2YXLA 4XLTA 2GLXA 4XKJA 3VTFA 3HMQA 3U1TA 3VNVA 3FLMA 5B1SA 3M6IA 4FHZA 3E9YA 3P94A 3P0FA 4F3TA 3NEJA 4D98A 1LWOA 3RSQA 1S6YA 1UBHS 4NQZA 3IQGX 2Y2UA 2ZIZA 3FNGA 4FFBA 1U2ZA 4ZDWA 5IVPA 1BG6A 1BO6A 4ER7A 2X14A 4JLWA 3LUPA 2PCJA 4X1KB 3SS8A 1P3JA 4JJIA 4B7CA 2ZVJA 4HXGA 4O3FA 4ACBA 3HA7A 3S8MA 3ZZUA 1X92A 2Q0XA 2X2OA 4GMXA 4HDQB 3DDNA 2CL7X 1TTHA 3MA0A 4HUQA 4J2TA 3FHCB 3FRIA 3LS2A 4RQAA 5EIWA 5H02A 13PKA 2GD0A 5JEDA 2B7BA 1N75A 3HV0A 4LYGA 4CG2A 3NWEA 4NBTA 1VA5A 4RE5A 2QVLA 1NQUA 4AB1A 3OC6A 3QRWA 4WCFA 1BOOA 3B8EA 4YMVA 1V25A 1KXZA 2XBMA 2XZTA 1UBLS 4RFSA 1G6KA 3RHTA 3E2MA 1XZEA 3CWQA 3PJEA 3HU5A 1ZJZA 3PLRA 4HOYA 2OP0A 4LYYA 4M9UA 4MA0A 5G0SA 5BOSA 4G4SO 1L8XA 1E7RA 4RHFA 5JPIA 2JC3A 3ZY3A 3IO5A 3QELB 1Y6JA 2H2GA 1DHTA 1G3IA 1GTVA 1YQ9A 2C20A 1Y8QA 1TW3A 3AEZA 4FKMA 4WK0B 4BN4A 4DV5B 4ESOA 2PMBA 1GTL1 2WHQA 4OJKA 1D5CA 1GADO 4BC0A 4Z2AA 2UXBB 2F43B 4GG1A 2O8DB 1T8SA 4N0PA 4XDGA 2FPPA 4OB6A 4V02A 3HB7A 4MUXA 4PZ9A 1G5HA 2FLKA 2RHBA 2YV2A 3A4VA 2ODPA 3K6RA 4GP6A 4OHXA 3HXMA 2BFOA 3CUTA 2YMLA 3ZXYA 4WL0A 3S1AA 1EESA 4P2GA 4NAHA 3F3SA 2YWCA 3E03A 4LI0A 1XVIA 4OJNA 3STXA 2PGJA 4PC1A 3DUFA 1XOIA 2CK3A 5ANRB 1GUZA 1KKLA 4QUDA 4RY2A 5CX1A 4BKUA 3G2HA 3QSYA 3TVYA 1QO9A 3QVXA 4EPVA 5K3EA 2O5RA 1E6LA 1M2OB 2QD2A 4AIIA 4NENA 2IIBA 1IBSA 3OWHA 5DT2A 2ZJYA 1BEZA 1H2HA 3MB5A 1ZSYA 1UZNA 4G9EA 1WXGA 3GBVA 2X0RA 4HMQA 4HLUC 3WK8A 2WKQA 2RK3A 3T7IA 4HEQA 4BAGA 4QJIA 3SBDA 2WOOA 4MRPA 3EC1A 3PPXA 2WYHA 3O4HA 4KIGA 1C7JA 1E9AA 2B8NA 3AXSA 3GZNB 2DECA 3REGA 3K31A 2ZWMA 2UZ0A 1UZAA 4MGEA 4C22A 1GZHB 4D02A 2MR5A 2YMMA 1MO5A 1EK2A 3ABOB 1Z36A 3BD7A 3LECA 1A2BA 3SOZA 3TM4A 2XXAB 3EGXA 3AHCA 1AMNA 3BSWA 2J0EA 5A0VA 3U0BA 4BCCA 1FDUA 4BMXA 1SIBE 4JYMA 5C1OA 1BD3A 1Q5PA 3EZ7A 3NRJA 3TZEA 1WMFA 2ZBGA