1EXVA

Human liver glycogen phosphorylase a complexed with glcnac and cp-403,700
Total Genus 320
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
320
sequence length
808
structure length
786
Chain Sequence
NVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKAFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human liver glycogen phosphorylase inhibitors bind at a new allosteric site.
pubmed doi rcsb
molecule keywords LIVER GLYCOGEN PHOSPHORYLASE
molecule tags Transferase
source organism Homo sapiens
total genus 320
structure length 786
sequence length 808
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2000-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1exvA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1exvA01
5D00A 1E4OA 2WTXA 4RBNA 1RZUA 1WUYA 3Q3EA 3BD8A 2OFFA 2QLMA 3MS7A 9GPBA 3IA7A 5TMEA 3L7CA 1UZUA 2JJMA 3T3GA 4XIFA 1Y6GA 4GYYA 3G2HA 2X0DA 1LWOA 1GZ5A 3BCUA 2F9FA 2QN1A 2ECPA 2P6PA 4MI3A 3VUEA 3RT1A 2IV3A 2QLLA 3HBJA 4RIHA 2GT1A 1L5QA 1WV0A 1P2DA 1YA6A 4LDPA 5I45A 3NP9A 3OTHA 1GPYA 4AY5A 3HBFA 1C8LA 2VSYA 4BQIA 2Q6VA 1XC7A 1NOKA 2XA9A 2VCEA 4X6LA 1FU7A 1VGVA 3OKCA 1Z62A 1XOIA 2C1ZA 1PSWA 1XL1A 2R4UA 3ZCPA 3S28A 2GEJA 5LQDA 2HY7A 3NP7A 2VSNA 4M7PA 1FU8A 4N3BA 1P2GA 3WAGA 1Z8DA 3GPBA 3BD7A 2ACWA 3OY2A 1AHPA 1EM6A 4GZ5A 3PE3A 3C4QA 3DZCA 5TMDA 1IXYA 1F6DA 3FROA 5IKPA 1GG8A 1FTQA 1NZDA 4RELA 2IEGA 2IYFA 2QN2A 1L5VA 3SYRA 4YUAA 2GEKA 1C3JA 3CUUA 3EBOA 2JLBA 1PYGA 3Q3IA 4FZRA 1JG7A 3ZCRA 3ZCQA 4GZ6A 1JIVA 2R68A 5JTUA 4W6QA 1GPBA 5GPBA 2ACVA 2QNBA 3L01A 1PN3A 4MICA 2C9ZA 7GPBA 3Q3HA 5IKOA 2XGMA 3CEJA 3RHZA 2F3QA 3MT8A 3E3LA 2ZB2A 1C50A 2AMVA 1WV1A 4CTMA 3MTDA 3S27A 2G9QA 8GPBA 1WW2A 3GUHA 3RSZA 1NLMA 1L5SA 3SYMA 2R60A 5DLDA 4QLBA 4EL0A 4FKZA 2G9RA 1NOIA 1QM5A 3NAZA 3L7DA 4Z5XA 4REMA 4AY6A 1RZVA 1B4DA 2X0EA 1J39A 3CEMA 2QN3A 1F0KA 4MHOA 3G2LA 1K08A 2XCUA 3ZCSA 1JEJA 2ASVA 3VDNB 3DD1A 2SKEA 2BGTA 3MTAA 2KS6A 3D0RA 2QLNA 4F96A 3WADA 4LEIA 3CUVA 3T3EA 3TOVA 4CTOA 1C8KA 3RSCA 3UYKA 2ATIA 1L5RA 1HLFA 3CUYA 3MRTA 4CTNA 4NESA 2AW3A 2H1FA 3HBMA 3MTBA 4GPBA 2IW1A 3D0QA 4RIEA 4NEQA 2FFRA 3L7BA 2AV6A 3H4TA 2GPNA 3G2JA 4MRAA 3OKPA 2AZDA 4NC9A 2XA2A 2GJ4A 4XI9A 3IAAA 4M83A 1FS4A 2IUYA 2GM9A 1YGPA 4YI3A 4YI5A 2QRPA 1SXPA 2YJNA 5DXFA 1Z6QA 1L6IA 4KQ2A 3O3CA 5C1DA 3E3OA 2QRHA 1P4JA 1FA9A 5TVGA 4GZ3A 4AN4A 4EL5A 2F3UA 5ENZA 1EXVA 4MI6A 3MQFA 3ZCTA 1L7XA 2F3PA 3G2IA 2BFWA 2VCHA 2QRGA 1Y8ZA 1BX3A 3G2NA 3TAXA 4EKEA 2VG8A 2G9UA 3T7DA 3VUFA 3MS2A 2QN9A 4RIFA 2PRJA 1L5WA 3DDWA 4MI9A 3MSCA 3MT9A 3MT7A 1QKJA 1XV5A 1GFZA 2XA1A 1JIXA 3HBNA 3AMVA 2F3SA 1NOJA 1NVKA 4X7MA 4N39A 4RIGA 3CX4A 2XGOA 3S2UA 4WADA 2FF5A 4X7PA 2XCIA 1JIUA 4RENA 1O6CA 1ABBA 2PYDA 3MRXA 3CV3A 3VDMA 2X6QA 1UQUA 2PQ6A 1XL0A 1GPAA 4M60A 2PRIA 2H1HA 3H4IA 4G2TA 1V4VA 1NZFA 3CUWA 3COPA 3BDAA 3NCHA 1M5RA 2C1XA 3T3HA 1AXRA 3ZCVA 1P2BA 3D1JA 1FTYA 4HLNA 4N9WA 3NC4A 4EKYA 3OKAA 4AMBA 2XGSA 4BFCA 1WW3A 3BCRA 1RRVA 3T3IA 5BNWA 2O6LA 3OY7A 3OT5A 3T3DA 1GGNA 2QZSA 3OTIA 4RIIA 1LWNA 2QRQA 5TMBA 2R4TA 3TSAA 4L22A 4F97A 3QHPA 1P4HA 1K06A 2BGUA 5DU2A 2JZCA 2QN7A 3E3NA 4X7RA 2C4MA 5D01A 4BQEA 1P29A 1WUTA 2SKCA 3MS4A 4BQFA 3C4VA 4KQMA 3CUTA 2R66A 4N3AA 5HXAA 6GPBA 3BEOA 2FETA 2IYAA 2XMPA 3ZCUA 1IIRA 3S29A 3QKWA 4F9FA 1KTIA 3BD6A 4HWGA 3WC4A 2GPAA 4WACA 1E1YA 4AMGA 3BCSA 4WHMA 2IEIA 1SXQA 3EBPA 2G9VA 1FTWA 3T5TA 2PYIA 4KQ1A 3DDSA 1FU4A 1JG6A 3S0JA 4GYWA 1UQTA 1Z6PA 1P4GA 4N3CA 2X0FA 4CDRA 3MBOA 3UYLA 1H5UA 3PE4A 3MRVA 1PNVA 3L7AA 1A8IA 3G2KA 3NB0A 4MHSA 3L79A 3C48A 2BISA 4EJ2A 1XKXA 3CEHA 5JTTA 1FC0A 1Y6FA 3OTGA 2X6RA 2QN8A 4PQGA 2QRMA 2GPBA 2IV7A 3NPAA 2SKDA
chains in the Genus database with same CATH superfamily
3G0GA 2ZETA 3CX6A 1SRRA 4ZOBA 5B5SA 4JYMA 3DVRX 2E55A 1QSGA 2YINC 4PX2A 4TZTA 1Y3IA 3U44B 3DBOB 4XRRA 2LUOA 5AKIA 1ZMTA 4HF7A 2NUAB 4JD5A 2CJWA 4ENRA 5AOAA 2ZBUA 3UJCA 4AUMA 1NLYA 2BDEA 3OMXA 1NYQA 4KV9A 1AKVA 2W6PA 1WQ3A 3GJZA 1CVLA 1BXKA 1PG5A 3ITKA 2QEQA 3NEYA 4WVFA 4X8HA 3RSGA 5KWSA 3AL3A 3OQIA 1NXSA 4YUYA 4GYYA 4K26A 3IBTA 2IYOA 2UKDA 3PHHA 3R5FA 4OFZA 2A78A 4Z0NA 2NX2A 2AC4A 2L69A 1K3UB 2RH5A 1VDMA 3BIJA 4GPIB 4JOSA 4M2LA 3VISA 1E1CA 4FHGA 5A4KA 1QB8A 1LXCA 4YP9A 1S7CA 2X5KO 4CKZA 1EFHA 3IV6A 3BCUA 1LS6A 2A57A 2WYVA 2DHDA 1IOZA 4H7KA 2ZTSA 1EG2A 1KBZA 2I55A 4C88A 2OHVA 1MQ9A 3H8JA 1KMQA 4LE2A 2IV3A 4BNZA 1PSDA 1CBUA 5AIAA 1AGNA 1CR6A 4XVCA 2CLCX 4MW5A 4P6VF 4YPVA 3CO0S 4PZUA 1LSJA 1WV0A 3BXPA 3O4RA 4WUVA 1AGRA 1T26A 3L6CA 1LK0A 2PUVA 1U2EA 2R79A 2AEJA 5EINA 3WB9A 4R1UA 1Z2EA 2OFWA 1Z4QA 3AL2A 5EVJA 2YVAA 5FA8A 1PUIA 2WP8J 3TZKA 4ID3A 3VZCA 4AQDA 3K8ZA 2DBVO 1XQ6A 4KUHA 5CA1A 4M0DA 3AUAA 1C7QA 3A9CA 4X6LA 3UB4A 1Z0KA 4YCAA 3OUUA 1GHTA 1WD5A 2DSTA 2FK8A 3GAFA 3SP1A 3U26A 4E5UA 4FFOA 2D7JA 4MDHA 1ELOA 1X87A 4ZHQF 4KH1A 4EHFA 3ZCPA 5FUXA 4NNOA 1Z26A 1V39A 1DSSG 1M34E 4NMHA 3ERCA 1JR6A 3IP6A 2QZ9A 3HU5A 4MZDA 1YZTA 1OB5A 1EKXA 3TNYA 5AHWA 1OPRA 2CXTA 1OBVA 3KZXA 1N5MA 1WLSA 3ZNOA 2VSQA 3VR2D 1BNCA 1ZOPA 2VPPA 5KWVA 2ACWA 3OY2A 2AXPA 2O2IA 5I8ZA 4BDSA 3T8YA 1C9MA 1DHTA 1RSZA 1U8FO 3D8RA 2OG2A 3DO8A 3OQIB 4Q3AA 2HM7A 4L5YA 5IH3A 1G8HA 1RM3A 5ESXA 1Z4IA 1FFXA 2ZJYA 3CW9A 3V48A 4G3XA 2RHMA 5JNUA 2P4QA 3OQPA 5DT2A 2QLJA 4HN9A 4ARZA 2ANBA 1P19A 1E1CB 3OA2A 4KPYA 5FUBA 2NW6A 1UOPA 3R44A 4LBZA 5LZ9A 2MINA 3DOEA 2WUDA 3P9XA 2A9FA 4UEJA 3CRMA 4R8SA 1L5VA 1DAHA 4PC2A 3SYRA 4QYMA 3AV0B 5ICFA 1EVQA 2GM3A 1D03A 3IAS6 3IIMA 2VDRB 3PJDA 3DL7A 3R41A 4KN8A 4MIOA 4KSBA 4QJBA 1PYGA 1WS6A 3IB3A 4RQAA 5I4CA 4ZOAA 1F0PA 3DFMA 1HMYA 1TCAA 2Y4OA 4KK3A 2ZYVX 3DQZA 4YIKA 1JIVA 4LCJA 5HBRA 2Z8XA 1GPBA 1RVDA 1CIVA 3U4IA 3OCVA 2BJVA 2JZNA 1Z2NX 2QNBA 3WK8A 4PO8A 2SECE 3IP5A 3W2EA 1U2GC 5CA1B 3D3KA 3KVVA 4R1SA 2V5UA 1FIUA 4BJHB 2LBPA 3K0CA 2CJXA 3ESXA 5HXAA 5EXEA 2D06A 4NDZA 4DCPA 2WSIA 3T9AA 1U7DA 3I1YA 3D1VA 1WXWA 1JG2A 4A0SA 3B51X 1OBCA 3H2BA 3O4JA 1RP7A 4RJ2A 1F2UB 4GXNA 4Q7EA 1ZLYA 2GEBA 3AHCA 3E9NA 1X92A 3X1JA 2UYCA 1FNDA 1Y9JA 4KBYA 1I4LD 1T0JB 4RANA 2VC2B 3I9NA 1FBNA 2GSWA 2OOKA 2XUJA 3N8GA 4PR3A 1Z7YA 1II9A 1LNQA 4TQ9A 4XVHA 5JMOA 4OTZA 3S27A 1WWKA 1U0NA 1H05A 1E9FA 1KYQA 3TIIA 2YVUA 3DT6A 4D8UA 1FFXB 4LDAA 4EY8A 3GUHA 1NMSA 4ZRNA 4ESOA 3K70B 5JJLA 4LAFA 4ARZB 2OXFA 4KVGA 1BDHA 2HJ9A 1GZVA 3JW8A 4OLBA 1ZK4A 3H99A 4Y6PA 4Y2VA 3OZVA 3D8HA 3Q11A 2ZJFA 2MINB 4GNKA 1X94A 3FRJA 4XWOA 4MYCA 3VHLB 3P2YA 5EMKA 5F78A 1IONA 4D74A 2GQ0A 1T6ZA 2IKQA 3B9QA 4Z5XA 1REQA 2D6FA 3NJ4A 5CFLA 3L9WA 3P0RA 3RVRA 5A0TA 5AK5A 4DWVA 2BLLA 3U3ZA 4PXYA 5CH3A 1GGFA 3IQHX 4IY1A 3V7WA 3TNDA 2EZUA 3U7EB 1FTGA 1VYTA 3DMHA 5EIEA 5K3OA 2QUJA 1MD9A 1O95A 3QUSA 4QYXA 2QTTA 3NU1A 1EWYA 4ZCSA 3G23A 1WHTA 3OPVA 2C97A 4MPRA 4MWTA 4XXHA 3RFVA 1FFWA 2VZ0A 4DSNA 2YHUA 2VQFB 1HUQA 3K09C 4FN5A 1A7UA 3CZ4A 3INTA 1WY7A 3FF1A 4TTPA 4H7FA 3CR8A 3MC1A 3KDPA 1JDTA 3DTTA 3G49A 1G20A 4W5RA 2O5RA 2DBZA 4E1AA 1QDEA 2P2NA 3DE1X 3EVAA 4EA8A 3NFYA 2FN3A 3AH8A 5I8PA 4YVFA 3ONFA 2O50A 3FTCA 3LUJA 1U2ZA 3N70A 3LPMA 2GTHA 3KZOA 4J3FA 4TLMB 3UYKA 3WDKA 5C7LO 1IDN1 3HLYA 4QTXA 3UAGA 1O3YA 4WASA 4MUNA 2I6XA 4CNBA 1XDGA 2XUOA 3SG0A 2HRBA 3DO5A 1DO0A 2C7BA 1ISSA 5EXSA 3NKFA 1QH0A 4GBED 5TEWA 1W44A 1U1FA 2RC5A 3A1EA 3FYSA 1P7YA 1YKFA 3Q9NA 2EW1A 4PHCA 4EHAA 3NT2A 2IW1A 3E2PA 3HB1A 1ZM3A 2ID4A 4XWAA 3TGWA 5I9NA 2D0PB 4HGRA 1BKYA 3PT5A 4BUZA 4AY2A 1LPNA 2ZR9A 3ICCA 1PS8A 2CVQA 1GDHA 2YWRA 4W5QA 1AJEA 4IKEA 2OWEA 3GJ0A 1LJUA 1E9VA 1H0RA 1JNYA 3FJOA 3LX8A 1X86B 1E2QA 2V7TA 3AW9A 3Q4GA 3R6TA 1XZAA 4IIFA 3IBCA 4KXNA 4NMWA 1REQB 3P2KA 2GJ4A 4QUGA 3AKEA 5IBQA 3B1JA 3KALA 1LDEA 4ENPA 1FS4A 4D44A 4CMJA 1I3NA 1EXNA 1VP9A 4AJ1A 1SXJA 3CSDA 5J40A 5JCZA 4XH9B 2EBUA 3QUBA 4HWPA 3GOHA 1UDRA 4LQ4A 2R96A 4RD3A 3B89A 1KKUA 1VCMA 1A9PA 2R62A 3EMVA 4LX8A 3ZDZB 1U0RA 1WHTB 3NNDA 4J7CA 1N3YA 2IW3A 3PC2A 5DEIA 4AG5A 3B7GA 1BDJA 1WXFA 1MG0A 2F67A 4LBVA 1KEVA 4PM4A 4O29A 1U0EA 3RVBA 5BQXA 3T94A 5C8YF 3GPCA 1KK1A 1G20B 1RAHA 5DCUA 3ZBPA 5MN6A 5A05A 4B83A 1J33A 4BE7B 4DDWA 4ZCIA 1I3CA 2QOEA 3NM6B 4N54A 3ZE6A 4S1WA 5LZ4A 5SZIA 5KZMB 5AI4A 2MSDB 5DPMA 2EKZA 3K15A 3LYLA 1N9KA 1K6EA 4HH1A 1X9HA 1NXOA 3NHPA 1TIBA 5BVHA 2VG8A 2GCGA 5DNEA 1E1KA 5E6UB 1SKQA 4PFKA 1D9ZA 1G7CA 3K92A 4CFZA 3MILA 2QN9A 4CM7A 3E84A 4Y2RA 3DHWC 3EZ2A 3SC6A 4UVGA 3A14A 4FGWA 1U28A 1VJRA 1NXPA 5B4TA 1JMVA 2X23A 3A6EA 2OUIA 3GUZA 4IDAA 4Q4JB 4B6JA 4B71A 1Y33E 5BSEA 1U1CA 3GLSA 4JV5B 1H2YA 2A35A 1EK2A 3E7DA 1AHNA 3AM5A 1ZK3A 3IX7A 1OGYA 4UFOA 5FEUA 1CC1S 2PGNA 1GTMA 5HIJA 2JCYA 3CJRA 1RXYA 4QTUB 1NE2A 3DV2A 1MIHA 1YA4A 5I8WA 2D2IA 2O6HA 5HQTA 2JJ2A 4OXRA 2QAIA 4RIGA 5KDLA 1CUCA 3PA8A 3KK0A 4GPD1 4IKOA 2OZPA 4WADA 1SKUA 3R6WA 2EHDA 2ZP1A 3ND8A 5JS1A 4QUEA 1KFBB 1WEHA 4MROA 2NZJA 4UE2A 3EC1A 1SAYA 1DJQA 4HC4A 1D1PA 3VSEA 2HK8A 5EHNA 4TXNA 1N2CE 3BTVA 2DTEA 2Q4DA 3SCZA 4DKXA 2EZ8A 2N75A 4KIWA 4XPIA 4WKGA 3QIAA 2O2SA 1EIWA 1KS2A 1F8FA 2GEDA 1SBTA 5HE9A 3M4YA 5B1YA 4MHTA 5TDHA 5CEFA 1MW8X 2YY5A 3TCKA 2OESA 5FTJA 4FMPA 3AEQA 1AQJA 3ON5A 1WB5A 3T7KA 1XA4A 3NCHA 1R88A 2E4AA 2HK7A 3L4JA 4OQZA 5AK6A 1R7RA 5BVHB 3NVDA 5IAGA 5EPUA 4K0KB 4ISCA 3WX0A 3AFNA 1HDOA 4H0FA 4HLNA 4AZ0A 4V1CI 1K7CA 3OKAA 1K9SA 2RCYA 2ZPAA 4WKPA 1MRNA 1S8NA 4MVJP 4OKNA 3RUDA 1JR3D 3KKNA 3MJDA 3OO1A 4H6WA 1VSBA 4MWEA 4RULA 4IBOA 3CF4G 4TRNA 2UUAB 1K92A 4GR4A 1ZXLA 3VC2A 4C6RA 3P26A 5T4HA 4D26A 2NO6A 4R81A 4LYEA 4HQ0A 2GPSA 3GDWA 4CCAA 2XZTA 2OO5C 4B3BA 4BLSA 4V0RA 4N3NA 4Q7KA 3AV3A 5ITWA 4W5WA 5K0EA 2L42A 2R4TA 1KMNA 1XD8A 1W5BA 3GLUA 5LKRA 2VSXA 4KFTA 3PQ5A 1E2KA 1KO8A 1J49A 4IMPA 3FNGA 1XD9A 3H2KA 2AN1A 3CW2A 4WCVA 1YKSA 2PSJA 3A3YA 3K4PA 4QXOA 4U00A 1QGDA 2GZMA 2NNLD 4TROA 4XPIB 2EWMA 1ZGJA 1DKPA 4H17A 4IP0A 4ZT3A 5AW3A 3NASA 2RIRA 1QE3A 1E5VA 1VRWA 1XZ8A 1NR7A 3LFTA 2CJFA 4QBGB 4XYLA 4HMQA 1UP4A 3JYLA 3AEQB 5CYOA 2ZZKA 4BB9A 4DCMA 2WG1A 4LV6A 1T3HA 4U0JA 4DLPA 1LVHA 3ENKA 1BH6A 3UJHA 3FFWA 2YVKA 1KOFA 1TI7A 3DMTC 5EJGA 1X7GA 2ODTX 1QTQA 2EFJA 5H1YA 3VZDA 2IITA 4QBIA 5G02A 4ZVKA 2ISSD 3C5VA 4JI4B 3WC4A 1JV2B 1FUIA 1Z34A 5H4GA 4HCJA 4GU5A 5KNDH 1YIOA 4EPYA 3K1TA 1M6EX 4K9NA 3OZAA 3UJ8A 3KP1A 1A50B 3WBKA 3I6BA 5CDFE 3L1UA 3KJNA 3UXEA 4EECA 4JOBA 8OHMA 1DINA 4EG3A 2YDYA 1NXQA 1JU4A 1WZIA 1Z2DA 4PIVA 5EXPA 1G7SA 3VR3A 4QG3A 1QG0A 3TLKA 5B53A 3LQYA 4OQDA 4E3ZA 4YYEA 1WMBA 3DEJA 5D5PA 5FWYA 1DV1A 3OIDA 5G4KA 3EBLA 3DDUA 1I7PA 5CW2A 1PZHA 3C3JA 3FMPB 3BRWD 4RGQA 4CDRA 1DRJA 1GAJA 3BX1A 3A7DA 4PICA 1VOTA 2GETA 2NV0A 3IIJA 3OLXA 4D5EA 5JH7A 1RLOA 3K6SA 3ELYA 1YAHA 3NETA 1VL5A 2Q1TA 5T3YA 1CUWA 2CEAA 2X1MA 3DMGA 4NOMA 1SCKA 2VK1A 4B6OA 3TG8A 4C0XA 3BJRA 2FSVA 5TS2A 3UJ6A 1LBQA 4ZT7A 2X1LA 4KGXA 5DYIA 2R6FA 2NV2B 2BKEA 1N6RA 3V2IA 1TM5E 3IXQA 2BGMA 3REQA 1U2DA 1IWPB 2P79A 2O7NA 4FMDF 2LDBA 4ZEWA 4DSOA 2CUTA 5L45A 3C48A 5TQJA 1P60A 3ZGYA 2O2HA 1O5OA 3OF3A 4PLFA 3MJRA 3VR4H 3TPCA 1T6XA 2OCYC 2CUZA 3DLAA 3NTLA 2RAFA 5KVCA 4JIMA 3L6BA 3LT1A 1Z38A 3U4QA 3KJFA 3RRXA 1Q2UA 2Q3MA 3WI7A 4Y9DA 4PO1A 4BMZA 4I55B 2QTFA 1LK7A 3WISA 4KWHA 4UEKA 1EGAA 3RB8A 3LT4A 2ZIVB 3KZCA 5EE5B 2YH2A 1NU6A 2GI4A 1GQSA 4D56A 4YAIA 1NVGA 1L7PA 2ZSIA 3IMGA 3LQ1A 1HI9A 1SXGA 1G20E 3I42A 3I9MA 3TMKA 5AJZA 3ZK9A 2PX4A 1ULZA 2R7NA 4ESHA 3FDJA 1WMEA 2PL9A 3A36A 2JGJA 4MEAA 1H1DA 2YXNA 5IVPA 4QU8A 3D7MA 2YFYA 4PO9A 2IPXA 4WTOA 2UYQA 2OFFA 3EJWA 3HGTA 4NEHB 2P5UA 3TH5A 2IP1A 5JDCA 3K3PA 2AX3A 2P11A 3NLLA 4OGGA 4UVHA 1R4MA 3U3RA 3O2SB 3P0JA 5EL0A 5FWYB 3H3XA 1GV1A 1S96A 2HK6A 3F2IA 2W6NA 4X95A 3PHIA 1IUNA 3NBZC 3QVUA 5G4KB 3SHVA 3QYFA 3B5JA 5DP1A 1VYUA 2QJTA 4ARVA 2AHOA 4NFHA 5KX5A 1LRLA 1SUSA 2GPWA 3A6LA 5F7OA 4B74A 1ORDA 1X38A 2WWHA 3AERA 1LBSA 1K6XA 2QQGA 1GZ5A 3HU1A 3NJ8A 4H0CA 5LP6F 1JFTA 1DUVG 3EE6A 2ZFUA 1JILA 4H16A 3ZDEA 1PJQA 3HRIA 4JU9A 4PSKA 4TS1A 2RH9B 1KKMA 2PSHA 3H0EA 4M9SA 3JQAA 2IZ6A 3OPYA 4MQEB 3VUEA 4G9BA 2B3TA 3M1LA 5L7TA 2C7PA 3H97A 3P9RA 3KHKA 4G23A 2EC5A 3JZIA 2GD0A 3H7IA 1W8DA 2I2AA 2ZDGA 4ALIA 4TXHA 4PVCA 4OH7A 3SZMA 5BUCA 2C83A 4PLCA 3PHLA 4XM2A 4Q9JA 5DGIA 4IQ4A 1L1FA 2D2EA 2E6KA 4WZBE 4FFLA 4HSGA 5DX1A 4I1YA 3PQ4A 4TLBA 4QUIA 3BILA 5F35A 4KQHA 3U4QB 1DQYA 3BXOA 3MWFA 4MPDA 4TVBA 1G4AE 1XZGA 2QTRA 4QDZA 4RK4A 2JLCA 1RC8A 1JEYA 2Q3CA 5MHTA 2X3YA 4W5OA 3BWXA 1Z8FA 3E4DA 4I1SA 1XK7A 4MGEA 4DT1A 2I8CA 2IE8A 2WICA 3D4NA 5GONA 2WMNB 1E7SA 1KIMA 1VZ2A 2REQA 4RADA 1GEEA 1RRCA 5BT8A 2VVTA 2R6DA 3BMXA 1NJ6A 1PJ4A 2LD4A 2OENG 2P9EA 5EJ7A 1P2GA 1R4MB 3D7RA 4O2AA 3C3YA 1O58A 3DEFA 3QZUA 3IKMB 4X20A 2CXUA 1GL3A 1O4WA 4PC6A 4YCJA 1DAFA 2WV9A 5KX5B 1SVLA 2JIOA 2J9XB 1GQ2A 4F72A 3FJ1A 1QTRA 3PX2A 2J6CA 2J3MA 3PE3A 5DHFA 1Z6YA 4KLZA 1LS1A 3AERB 1U99A 4EBBA 2B3DA 3PT9A 2FR8C 3BA1A 1FFHA 3UOWA 1LV7A 3ROEA 2C4NA 1UFQA 3E6AA 2REOA 2IA5A 1DNPA 3HCRA 3F74A 3JQAB 4LSWA 4WT7A 1A9XA 1A5TA 2ID8A 1KL7A 2IYFA 1J9GA 1L8LA 2AIRA 4EUNA 4ZREA 2YY7A 2HJVA 1JIKA 3KV1A 4RW0A 3BWVA 1U3DA 3EHDA 1ST2A 1TMKA 5EKDA 4AXXA 4BJ3A 4QZVA 3ESRA 1SOVA 4C4XA 4FZRA 4G4SP 4L5AA 3EXIA 1UOQA 2HQBA 1C1YA 3TK1A 3K7EA 1XHEA 4GZ6A 2YZNA 4U2DA 2C8VA 3O26A 2QPTA 4U3JA 3ZV5A 1VSTA 1YQEA 3I45A 4KSCA 1I01A 1AS3A 2YV2A 3DUWA 2HNKA 4Y2YA 5D51S 2OC9A 3LP6A 3R7WA 5AM0A 2YFQA 5I7RA 3HVRA 2DF8A 4QM7A 3TFWA 1JEYB 5JZSA 4DV5B 4GR5A 2ZGVA 1OIVA 4FZ3A 4YRBA 2GBIA 1OD6A 3LSYA 2OCIA 5EE0A 3CVOA 4H7HA 4IIGA 5EKSA 4DT1B 2GXSA 2V4ZA 5A3QA 4C2UA 5GONB 4BUCA 2B61A 4U1RA 1HT1E 4HR7A 2REQB 1KO1A 2QX6A 3TZQA 4DG8A 2AS0A 3PFCA 3ND7A 4IOMA 1Y82A 3FCYA 2FOIA 4OUKX 1ACJA 1XSEA 4O2AB 1TNDA 4OHFA 4X20B 4R2HA 1HT2E 3QIVA 2P4EA 4MQLA 1C50A 1JWBB 3QXSA 1TJ3A 1DIBA 2FXVA 1IY1A 2MWMA 4J9UE 3CC8A 3GJ5A 1O5TA 4MP6A 4P80A 4RAQA 3SLKA 3WGGA 1QUEA 1ESNA 1V7QA 3NR2A 3TTVA 4WOCA 4RMNA 2A14A 3TDKA 5KJCA 2RH4A 2BKUA 1KY2A 4V0ME 1XA0A 2ZVDA 1DV2A 4L76A 3L49A 2FPSA 5EJ6A 3TBFA 1GTZA 3WB2A 2POQX 3PR3A 4K8RB 3GLKA 4N82A 3H9CA 3KJIA 4PZYA 4XWKA 4F8JA 1DAEA 1E1DA 1PKXA 1BOOA 2WT4A 1A9XB 3BIXA 3UZUA 3KOOA 5BNZA 5C1OA 2JFWA 2I3GA 3QOFA 3CWCA 4H4CA 1WETA 3RROA 4B3JA 1UKYA 2YMMA 1I5EA 1C9DB 5J1TB 4DNQA 2DY1A 4GICA 4UXIA 1V2HE 5F7XA 3LYUA 1LPOA 2QTAA 3EXIB 3D8UA 2IH4A 3CX8A 2ATEA 4MHOA 1YJAA 1E18A 3OLVA 4S2EA 4U3JB 2XUIA 4M6WA 1O97C 4J9VA 2Q7DA 5KQLA 2IOFA 1PFVA 4BN0A 4CVNA 3R7WB 4TMZA 2PWBA 4KXQA 4P0TA 1ZBDA 4P8RA 1ML4A 2WTNA 3W5JA 4PAQA 4BEVA 1RM5A 5IJWA 1Q1ZA 1OROA 3D6TB 3E15A 3UMCA 3ANYB 3ZVLA 5KJ6A 2I22A 1T9BA 4FOSA 1LTKA 1N3LA 2DEUA 2EOAA 4ZC1A 4ZGBA 1DJPA 1KAQA 3DVQX 3LUKA 3TGLA 3R8CA 3PPWA 1J2JA 1GNQA 1QR2A 1T2FA 4JSRA 5C7YA 1JFSA 3DE0X 5EFOA 4Q15A 1N1GA 2ETVA 2VHYA 2ZVPX 3C3KA 3MGCA 3QOYA 4RXUA 5AKYA 5JPIA 5BSVA 4GYKA 5CXQA 1NI5A 2J0UA 3ZHRA 5C7OO 3CG0A 3RSCA 4C9BA 4GT1A 3ANMA 3ZJ4A 4C06A 3MWGA 3F5QA 3I5AA 4RD6A 3VJRA 2D1SA 1L5RA 1AN9A 2BI7A 4C7OB 1SXIA 1BVHA 5I7AA 3HA2A 2XHEA 1MO6A 2WD7B 4M1OA 4OEHA 1KQOA 2H1FA 3D8BA 4JVLA 5CM2Z 3ED5A 3SAJA 3OZWA 4I14A 1Y7IA 3K2IA 3W7BA 2IZ5A 3PGJA 2YV4A 4KNYA 3VI4B 2P5YA 4PO3X 4WZ6A 2N3ZA 5KKCA 5K01A 3OF2A 5F3WB 2H4FA 2Z4SA 3MG9A 4LWZA 4WBXC 2G71A 2RAUA 2XQJA 3EWIA 4CQMA 4YQZA 4JC8A 1M6VA 1UDAA 2QP9X 4XIIA 1NSYA 1M2WA 2VP9A 2EJVA 3DJFA 4XSGA 1LF5A 4K88A 5TC4A 4UMVA 2UUCB 1B42A 3QU4A 1RAFA 4GOKA 5E1MA 4CKBB 4M6WB 3D9QX 4N7BA 4OXXA 1O57A 2HSWA 1P5ZB 2WB2A 3BM5A 3EZFA 1X7WA 1ZJZA 2VBCA 2VJBA 3QVLA 3FNQA 2FP3A 2OORC 2K87A 4Y1GA 3ONNA 4E12A 3X1DA 4XB1A 1IE3A 3O8BA 1QGYA 4JLJA 3IV7A 3UT5B 1O03A 5JSQA 3CLSC 4A6PA 4E88A 2ANCA 1P4JA 1ZOSA 4MIKA 3LBFA 3FHTA 1I32A 2VI5A 2ERCA 4MRSA 4D9FA 4BCBA 1O94C 1QTIA 4KNVA 5AOCA 5FBHA 5IVIA 5CLJA 1VL0A 2F3PA 4YPFA 4JBXA 2J0UB 5KTSA 3I1FA 2ZT5A 5MF6A 4I4TA 4TMYA 2QT9A 4JC0A 1S5PA 1V16A 1NF8A 2CHEA 3NG1A 4I1RA 3ZDXB 5HZMA 4IUDS 3ASZA 4GI1A 3WO0A 3WRYC 5LMNB 1VHWA 4AJEA 3T7DA 4CMEA 1SHZA 2ILVA 4BECA 3KLPX 2X9LA 2FG7C 2HREA 4I3HA 4RIFA 4R0VA 3ZKAA 3KVYA 3T7RA 3UNXA 1BE1A 3IBGA 2GFQA 3KQWA 3WRWA 3U62A 4DQ0A 1J7JA 2CNNA 4M87A 2BGIA 1FDRA 1V5GA 2JJQA 2QVBA 3MT7A 4CRWB 3J7AC 1XAIA 3HYNA 5E1OA 1D0SA 1WB6A 4WY5A 1N32B 4BEWA 3SU8A 1W52X 1YOVA 2XY4A 5DISB 3S2SA 2PSFA 3C7CB 5L4NA 2FG5A 1B23P 3KXPA 3HS3A 3Q7SA 4ZI7B 2QMQA 4KXYA 4DR3B 1XNHA 1N8SA 3TJRA 1NXXA 2JJ8A 3UH0A 1ZMRA 4PRYA 1QMPA 3IVMA 1HEYA 1U8CB 4Q1DA 3RBAA 3VNBA 1EESA 1E2LA 1T9GS 2RGNA 1L8OA 4WK2B 2YS7A 4BO7A 4FONA 4LKOA 1KO4A 2RBGA 1X7WB 5G1OA 5I6DA 3OUTA 3OEEA 5D3MA 1XMVA 2M32A 3WK6A 1ZNWA 2V5AA 2PGAA 1MC5A 4L7QA 4RESA 4CGZA 2X6QA 4QLAA 4E4YA 4F4IA 2XEXA 3EW9A 2QORA 3ILSA 3RC1A 4UEQA 4YRFA 1RNLA 1KNXA 4D4JA 1WF3A 2FA9A 2J45A 5DM2A 2CLEB 2A0FA 1YOBA 3L0PA 5KO2A 2PRIA 3NDRA 1YF3A 2GLTA 5DTRA 2DR2A 3TIGA 1J8VA 3R7BA 1JQDA 3THOA 1XZDA 1ZCFA 2E85A 4IKPA 4I4TB 1QUFA 1FSPA 3O84A 3IEIA 4ND8A 1TJYA 1VJ5A 1V16B 3Q1KA 1EHIA 2C1XA 2NVUA 2Z9DA 3OCCA 3L8MA 4NRDA 4OJYA 5K09A 4E22A 3O8DA 1RWOA 1B6SA 1U6IA 1Y81A 3Q9SA 3L40A 3VPHA 4R6XA 2IYTA 4WPGA 4NZZA 4ANFA 5JXIA 1ULTA 1OWPA 4Q34A 4N49A 7MHTA 5I7VA 5K0LA 4WWHA 3CB4A 5JLAA 4HXFB 3RSQA 1J99A 1FK8A 4YRQA 3A05A 3LHSA 2ROQA 3HWSA 5JQWA 2H1RA 3P4UA 4JKOA 4XGKA 4DUZB 2IZ7A 5KNLA 2A1IA 3K32A 1P9WA 3IQFA 1IIBA 1GZUA 3DLHA 3LLMA 1LPSA 5CK4A 1T9ZA 3SYTA 2H4XA 1MVOA 3AY0A 3DFZA 3FPSA 4IRXA 3U3DA 4KVAA 5HFAA 3FWHA 4ILEA 3S3TA 5I9MA 3PWZA 5K1ZA 5FADA 2X2EA 3W1WA 2O8FA 3M34A 2HU5A 3AVQA 3UIEA 4TMVA 2V4MA 4AX8A 3FW1A 5K3EA 4JJ7A 3HA3A 5D3MB 3FCSB 3ST7A 4CIBA 2GPJA 3GFGA 4G37A 4UZSA 1PNQA 3UFBA 3HK2A 1HMPA 1G2OA 3GRAA 1W96A 3L77A 1QNLA 3AR5A 2WZCA 5ETJA 4CM6A 1E2EA 5AJTA 3FVRA 5JAPA 5H3HA 4EHDA 2BFBA 3ZJTA 1YZNA 4B34A 4AYXA 2SKCA 4B9AA 4BQFA 2D4AA 1WF6A 4DR6B 3ZBUA 2IY7A 5HNKA 1UQRA 1YI1A 1GUBA 1TYCA 1VL6A 5CFPA 1ZJ4A 3RWBA 3ETHA 2C3MA 3NBQA 3N07A 4Z2AA 3OJOA 1P75A 3MIZA 2BH9A 4MH0R 1R5BA 1L9KA 2X3UA 2NVUB 3ZE0B 1IATA 1S2IA 1L7AA 3LIIA 3ZCUA 5JJKA 3SEZA 4YHHB 1E4VA 3PUKA 4MUHA 5CT4A 2EX1A 4NMXB 4BE4A 5JAIA 1PS0A 2AOWA 3ZY2A 4AT1A 1WMAA 4LTDA 2VP2A 2OFXA 3KOWA 4V03A 2MR5A 5K3CA 4BKOA 2CMDA 2XCQA 3KTDA 4TT3A 4D0RA 4DLWA 4F9FA 1XPOA 3PKZA 5A06A 1ZW6A 3OHMA 3Q6MA 4UNIA 1E1YA 3MGKA 1CY6A 2H2WA 4MWDA 4PANA 2CFCA 4LVUA 2I66A 1PK8A 3D5TA 2XE4A 1A0OA 2PS1A 1FDOA 1ZUNA 5IVDA 3IDOA 1QANA 4E70A 2P68A 4I81A 3C3MA 1EFLA 2WJGA 3UUGA 4ETIA 4FMCF 4L72A 4WKOA 4BNNA 3HXQA 3WFIA 4NCJA 3WB1A 4C0KA 1G3MA 4BLQA 1P4GA 1R3UA 4QOEA 4AUNA 4DUPA 1R8YA 3HY6A 1XZFA 1MMFB 3BK2A 2FPPA 3IAXA 4RSHA 5D5QA 2O8FB 2B34A 2BFFA 4N8SA 3S2EA 1F4VA 2WE7A 3ZV4A 1OILA 1FE8A 1S2NA 1C0PA 2B8JA 2VJMB 1UDXA 4HPWA 3PRHA 4TV8F 4D7AA 4F5YA 4OM7A 5JNLA 1W34A 3D2BA 3HSYA 3PUXA 4LI0A 2CV1A 1XCGB 3EODA 1YB5A 4A10A 1RBQA 4KRFA 4R3WA 5L4SA 1ZP6A 1HL3A 4KNWA 2BFBB 4J4BA 1U3WA 4PR0A 1Z15A 3AZQA 4BKMA 3GJ7A 2A5LA 1JT9A 1NJ1A 4Y3UA 3U81A 3WL5A 1SG9A 1P45A 1SOMA 1XHLA 3B8EA 3E3MA 1LUAA 2BKXA 3IAFA 4XLTA 4ZEOA 3ZXYA 1QHHA 2HD4A 2FR1A 4D8WA 1T1RA 5JNWA 2HA5A 4K6OA 5LZ7A 3FCXA 3IE2A 2V58A 2YOHA 3F5MA 1PJ3A 1SCAA 4IIDA 4NYJQ 1G16A 3Q12A 1QH1A 1HQKA 1YJ5A 2JFGA 1L7BA 3KB1A 4HPJB 5ECDA 1N2OA 1NC3A 5EMLA 3HXKA 3A1SA 2IV7A 4BYMA 2P4UA 1EVJA 1W46A 2VTVA 1XFAA 2CYBA 2OVFA 3EIQA 4TMWA 2IWHA 1L0BA 2PKRA 3JAKA 5AI0A 4RZHA 1P77A 1QIJA 1MEOA 3LXMA 1ZUNB 3GJRA 2VHJA 1FFEA 4PYNA 1Q0PA 1FFGA 1MX1A 1PU2A 1M6HA 3BMOA 3MWKA 4MAFA 4ALJA 4ZMBA 4OMUA 3KELA 5I51A 4B6RA 3OM8A 3OZCA 2R97A 1MHTA 1N0IA 3EAQA 1VE3A 3JVDA 4K7JA 1NA5A 3AVPA 4RY9A 4OF4A 1VL8A 3Q40A 2FPPB 1GQRA 2N46A 5DLPA 5J4LA 1EXMA 1V43A 2BFFB 4M8NE 1VTKA 2HC9A 2WSBA 4KWCA 4A3SA 1TT7A 1YDWA 5BNTA 2JBAA 3QWHA 2QTNA 5FHRA 1P0PA 5FNVA 2QAJA 4POAA 4AC9A 1N5LA 2YR0A 4ZGGA 3X44A 2W0MA 1VKJA 3ZYZA 3F2VA 3U09A 3ZN2A 1H94A 2ZBVA 2OZKA 1LX7A 2BEVA 3E22A 3RG8A 3ORYA 2QDKA 3PPXA 1ISPA 3UXYA 3WLJA 4CYMA 1NI3A 2ZWMA 1Q0TA 1T2EA 2A6PA 3K1JA 2FRDC 4NNJA 1L5KA 3LNCA 1HSOA 1QP4A 4JLMA 1H3NA 1QHHB 2J9GA 2WJJA 1YFLA 5FL3A 1QYRA 4BGUA 3IAM1 5B1EA 3RJZA 1ZN2A 2VT6A 3Q85A 5GZ6A 1P8JA 2XCTB 2FE4A 2OCLA 5ALPA 3SJZA 4W5HA 2J8ZA 1EDBA 1QH1B 3M5DA 3OTHA 4KXWA 4G0YA 4MI1A 4ODIA 2IDZA 2NOAA 3HBFA 5D5HA 5EI5A 2QMHA 2VSYA 3MMZA 4HN2A 4W9NA 2WIKA 4MWCA 2QVGA 5HQ3A 2QTWB 4RTJA 1Z0ZA 4UMFA 5TEVA 1B00A 2IEZA 4BRZA 5IJZA 2NP7A 4AWXA 1UBCA 2EGHA 1KXZA 4DSZA 4DV6B 3CN9A 2C82A 4KJZA 3JAKB 3S44A 4DIUA 4KSYA 2HMTA 1PSWA 2FW9A 4KLRA 4PRZA 2LV8A 3I6YA 3PIRA 1IBRA 4UC0A 2C96A 3RWOA 1GYPA 1CJTC 3OQVA 3ZEAA 3R7FA 3BMOB 2JIZA 3QEJA 4ZQIA 4JBNA 2IIVA 3AG6A 2E82A 3ETDA 3WGOA 2OCXA 4L8YA 4BP9A 2UYHA 2J0VA 3RUIA 4D9NA 2GYVA 2W22A 4BFTA 3BD7A 1VCNA 2FRVA 5IRCD 3JQ9A 3EXFA 3SJAA 4EYGA 2W6ZA 3IHLA 3L8HA 3NTXA 4M3NA 2JA2A 2JBAB 5FNVB 4WESA 3ECSA 3OMWA 1MT3A 2FSHA 4QUHA 4Q4AA 5KTKA 1Y8CA 4XUEA 5LKAA 3EYWA 1Z7WA 2DLDA 3H0CA 4EHJA 1GG8A 3V80A 3J81A 4Q9LA 4FFBA 3WGQA 2AI2A 2BEVB 3E22B 1W0KA 2QM0A 1P4AA 2O2EA 1E6KA 3IEUA 3ZY6A 4ZYLA 3IQWA 4CUJA 3EXG1 3G82C 1WCXA 2INGX 1RD4A 3BICA 5K3DA 1X13A 2EV9A 1UOEA 2NO7A 3MEQA 1CUBA 2HWXA 4GMGA 1SCDA 3U7GA 3ONWA 1QHNA 2QTBA 2YV3A 4KXVA 1MEEA 2M6SA 3TLAA 1U7PA 2O07A 2Q5FA 4WCFA 3EPLA 3EH2A 3LWNA 1EBFA 3EGOA 2WSYB 4MYHA 1PD0A 3EIXA 3AVYA 4BNGA 1T1SA 5LQKA 2QPOA 5FB3A 4DNFA 5GPBA 3NT5A 1YIDA 5HQ3B 1H4VB 2MDTA 1RXIA 3O92A 4JDUA 4W4TA 5A3RA 3WAKA 2F00A 3FGZA 3ZXSA 4DLTA 4E1BA 5IC4A 2H2GA 1ZM7A 2IEBA 3IPYA 2C2YA 1XKQA 3M5PA 3G1UA 1TJNA 2DWPA 2DKOA 1A5BB 3QPWA 3OE4A 4WFJA 4CCSA 2ZS9A 2FZLA 1QK5A 4QOHA 5KJEA 1ZD3A 2P9JA 1XU9A 3AB3A 4CTKA 1B0ZA 1OUMA 4FYXA 4I08A 2F3QA 4EFNA 5TGTA 4FGLA 1C14A 1SZPA 2IYUA 4H7IA 3J81k 4BCDA 2ZB2A 3GCDA 3FCAA 3ZI4A 2B37A 3KYJB 2ZIUB 2CD7A 3MTDA 4MB2A 4OJNA 2FPOA 1FRQA 3M83A 3EXFB 3FJYA 3LZCA 4YJGB 1I3MA 4QPCA 4C1BA 2I6GA 4WESB 1GPNA 3DEZA 3GMTA 1JIQA 2BRUA 2A59A 4J0QA 3RSZA 5JEDA 1T6BY 3EVFA 3OLCX 4Q4AB 4R98A 2CBXA 3GGOA 1OREA 2CV0A 2GN6A 3UHAA 4UUBA 4EHHA 4FFBB 3HDTA 3LKZA 1W87A 2JIPA 3GLQA 1I0LA 3I6ZA 4R7TA 5CVTA 1T2DA 1CQXA 2WZDA 3VDXA 4QRIA 4AY3A 4MYSA 1LLQA 5TV2A 4ER6A 1F48A 4Y6LA 4CF5A 3RBVA 3N2KB 4BV8A 4OJMX 5KAPA 3H83A 2OZLA 1NMEA 2FWMX 4M8SA 4WCFB 3U37A 1GSOA 3RS9A 4ER3A 3DV0A 3C2QA 1WL8A 3D2CA 3GFQA 4QGGA 5ALZA 1UKCA 2OD2A 2ZYRA 1D2NA 1E77A 2H2IA 4IV8A 1KRHA 4RO0A 5FT9A 4ECAA 5GINE 4QBFA 4P7GA 3WL3A 5IXYA 4DR5B 2PQ0A 3AFIA 4HL6A 5K9ZA 2N1MA 4NARA 4FXOA 1E3TA 2QKYA 5AJHA 4FHCA 3ZJYA 2AH5A 2TMDA 1FW8A 2B1IA 3NXSA 2P0EA 2B7LA 3C7KA 2PGIA 4KKXB 4LSZA 4S35A 3VM6A 4F5ZA 4Z7JA 4NZYA 1W0CA 4Q1BA 1TTQB 4NFLA 4PTLA 1I80A 2AEFA 4EI2A 2AD5A 1E58A 2GZSA 4RZ2A 2CLMB 3DNFA 2COEA 2W9XA 2AUNA 2HWWA 2UVQA 3GRVA 4DJJA 2HYDA 4YT8A 1GPMA 2VK2A 4N4AA 1VPWA 1GFWA 2BFEA 3MTQA 3ANNA 4LFBB 5ERYA 3C8ZA 4IRUB 2CHFA 4UU1A 1MGPA 2OM2A 3PDWA 5D7BA 3RAJA 3SJBA 3BE8A 1S2OA 1W1UA 3STXA 4MW9A 3JZMA 2C20A 2FN7A 5KU7A 3BH7A 3K70C 2H6EA 2ZUDA 2XZDA 1XU4A 2WILA 3L0OA 2ONJA 2YWDA 1KHTA 3EQ7A 2JCXA 2R8BA 3O95A 1DUIA 3LOQA 1Z2OX 4J91A 2CJPA 1FB5A 1ZD8A 3G2MA 3CMCO 4W8HA 4AJKA 4CFSA 4LRSB 4ZICA 4PZAA 5GTDA 2ODWA 4C7KA 3RYTC 4DV1B 4NDAA 3OKPA 3Q5EA 3BK7A 3HB5X 4K6FA 4LDQA 3TWOA 5KTPA 2PLNA 4NULA 1M2GA 1ZSYA 2ZTLA 1H1TA 2QXUA 4N65A 2XA2A 4XI9A 2GGSA 4EJMA 3DP7A 3TTWA 1G5IA 4OV6B 2OZLB 1DVRA 4YRMA 1RVV1 3DV0B 2J7KA 1NG1A 1C4OA 3MLAA 4L4XA 1EGVB 4YI3A 5IYZF 4BE9A 5LD2B 1X1TA 5JYDA 1RRPA 2QY9A 1H8EA 4K6KA 3BE4A 2LE0A 2O8BA 1R66A 3DLIA 3GG9A 4EHIA 1D2EA 2QDXA 1LFAA 1PWZA 1NW9B 4KPFC 2VF2A 4IF6A 3HY3A 4X1YA 5FRDA 4LSMA 1Q1QA 1TM2A 4HH4A 5B3JA 1MZPA 1Y98A 1CJUC 1Z13A 3CZAA 3F1KA 2GVZC 5D3KA 2PL5A 1UDWA 5E1DA 1E66A 3VQTA 4AZVA 4EL5A 5ENZA 2F4VB 2GVNA 1CQJB 2KJQA 4TL9A 3O9VA 1BEUB 5EIBC 5EP2A 1SC9A 2F3TA 4IZIA 4MKZA 3TRHA 3M6IA 3KX2A 3C41J 3CM0A 2OFPA 4EFDA 3CA8A 5GY7A 1ZA2A 2JANA 2R44A 4NTZA 4BNVA 2BHRA 5KTRA 4JC4A 1E7RA 4R05A 2CN1A 1D2AA 1JEQA 2FZEA 2IKSA 2HNAA 3G85A 3GROA 4MQUA 2CMFA 5E7QA 3FOWA 3HB7A 4I5DA 4MMZB 3T5PA 1M9NA 1PWEA 4A1FA 5C5IA 1UPFA 3BXGA 4CTJA 1Q0RA 4NBTA 1Y3DE 4ZJUA 1DKRA 1EINA 3N58A 1PTJA 1EDEA 4MKHA 1I2ZA 2PM8A 3H1EA 3OC6A 4KIUA 4RDXA 5I7WA 1XCLA 1C5KA 2W2OA 1SQ5A 2BOVA 2GZRA 4QFMA 3U49A 2Z57A 1TEZA 2QRLA 1PZXA 1AKWA 4UTOA 2AXEA 4CCYA 5AVYA 3EY9A 4RD4A 4ETMA 3IQXA 4X8OA 3VZRA 3DDZX 4MIEA 3VU9A 3W6NA 1A8UA 4C5AA 3JQBC 5L51A 1HE1C 1KYTA 3S55A 1RPNA 1ZIOA 1N5RA 3A8TA 1FDWA 3QLVA 3RWMB 1XLUA 3H0KA 2XRYA 4G86A 3GRFA 1I2DA 1DEKA 1O95C 1IVYA 1SR8A 2AOTA 4HWOA 1NE7A 2CMGA 1AA6A 2O8BB 1J8DA 1OHHA 3NX4A 1A96A 1KEWA 4V2UA 1PP4A 2WSSA 1O6CA 4PC1A 3WDSA 1XROA 2CXXA 2IVFA 2PYDA 1WOYA 4K5QA 5GM1A 3BXHA 5D7NA 3SC4A 2ZWVA 2XXJA 4Q4CA 2V1UA 3PQ8A 4X1YB 4EYSA 2WHRA 2JCGA 4I6GA 3BAFA 2ES4A 1W0JA 2W48A 1J07A 1PCXA 3JV7A 1QGUA 4V0QA 5E7JA 2H06A 2AD1A 3PUYA 1EQUA 2WTEA 2GJSA 3B9RA 2ZRHA 4XDYA 2BHTA 4J1SA 1NSTA 1J0BA 1Y4AE 2P5TB 4BNFA 3ZQ4A 3KSUA 5ABPA 5EP4A 4UPVA 2XNJA 2PR2A 1JEQB 3PNMA 2Q9BA 3O91A 1YUBA 1G63A 2PLRA 1HDIA 5K6RA 2DQSA 1K27A 2Q1UA 2ZQZA 2ZYUX 4LQDA 5HS4A 3D8SA 3T38A 1GCGA 3HJTA 5LLSA 5LYJA 1NNLA 3SYLA 1SPBS 1NP6A 3AKDA 2BP7A 4JUFA 1XDZA 4AUEA 2OEPA 3EIHA 1GZ3A 1PR0A 3IKJA 3NDIA 4IQFA 5EHGA 3S8MA 1BZYA 3G8CA 3G5UA 1JVSA 4GSKA 3WY9A 1DBVO 4LVOA 3GGGA 3QEKA 5SYAA 4CCYB 1I7LA 3HJGA 3MOGA 1Z28A 3MB5A 4LMBA 3FDXA 2D8MA 3GCGA 5KNCD 3OG9A 2JVJA 3VU9B 1T0HB 3FYUB 3ZDDA 3AR7A 1P6UA 3URKA 5A4MS 1SUFA 2ZYAA 3DTNA 4TN1A 1SXJC 4JOCA 4DJFC 2QHXA 4B87A 2QAGA 1U0HC 5DHUA 5EY5B 1U8AA 5BN3A 2AOTB 4L8FA 5LWQA 2VXCA 4FINA 5FPKA 4INAA 3RARA 3WXMA 1L9XA 1XRSB 3TW6A 1QYVA 1D07A 5DBEX 2IXTA 4CEIA 1I3OA 2NZVG 4F12A 4E11A 1K06A 3ESAA 1HE4A 2EARA 2ORED 3P5BA 5FLEX 4BX8A 4EW3A 3VX4A 1JLHA 1FX1A 2XE7A 1E7MA 3HB4X 2OB1A 3HABA 4YRTA 5D85A 3RGWS 1QGUB 3OF5A 3HGMA 2OL4A 3QV2A 1GPWB 3KUXA 4YUVA 3MS4A 4BQEA 4HTAA 3R3UA 1TTPB 4M8KA 2V7WA 4XB2A 4EI7A 3VPAA 4J0JA 4R54A 2VOEA 3ZJUA 3KJEA 1DWOA 3GAZA 2XIQA 3B2NA 3W79A 5E1BA 1M6YA 1RHKA 3O38A 4HGPA 4DHWA 2QLFA 1PQPA 1TLLA 2Z6VA 3HWX1 3HXLA 3AESA 3KTOA 3UICA 4NBRA 3CVJA 5LQNA 2P2YA 4PIMA 1F38A 1GRQA 1U28C 4L6AA 4WIAA 3GEPA 2NU8A 5LYJB 3X1WA 1QIGA 3QKWA 3ESZA 3UMMA 3BD6A 4DA7A 2BP7B 1U8YA 1Y42X 4Q3BA 3ETEA 4JP2A 3VGJA 5HFJA 4IX1A 4OQLA 1W2HA 4R1MA 2WQ7A 3UHOA 4PHHA 2C9OA 1DRUA 1JEOA 1KR5A 1NHWA 2HA4A 4PQEA 3RTGA 2A2ZA 3WYEA 2PQ2A 3FRIA 1GZSA 1SCNE 1FTWA 2ECOA 4V38A 4OHMA 4A15A 3ZWOA 3FFAA 2FEXA 4NX2A 5KWJA 3ZLJA 1SCQA 2W2QA 2W98A 4NYIQ 4YCBA 1EG7A 4RJJA 2QAGB 3O0DA 3O4FA 2X0KA 4BRSA 5IABA 4Q1FA 4UBNA 1UAAA 1M8JA 1X0XA 2O52A 1BO6A 2GNOA 2CLKB 3NBAA 1GKIA 4H77A 4M8LA 2X6TA 1P9NA 4CEIB 4M1MA 1CY4A 1VRVA 1X8XA 2H4ZA 3LUFA 4FOTA 4MUJA 3FOZA 4LY0A 2FK7A 2ZI9A 2FPMA 5JROA 1JR3A 1E1LA 1YJBA 2XDAA 5CX1A 3TPZA 1J0EA 1HDCA 1O0SA 3E2MA 4U8HA 2WF8A 1XZEA 3TINA 4UOZA 2R6GA 3K9FC 3OLWA 4B8WA 4AKIA 1UT8A 3F4LA 5G0SA 2XJ4A 4IDNA 3WV4A 4ZHSA 2RJOA 4GFDA 1JDSA 3NH6A 4X5OA 2WJVA 3FPLA 1B3BA 2IYEA 3HYTA 5DHQA 5FQOA 1YSCA 2UVPA 1Z7BA 3H5OA 3V4ZA 1BC5A 3P9ZA 4JB3A 1G19A 2HF7A 3HO6A 2V5VA 3MTEA 3KQKA 4EY4A 3AESB 3PXUA 4GRAA 2O3QA 4QARA 2AYYA 4B3XA 2FSIA 5D87A 3RYHA 4DA0A 4DVJA 1WMSA 2NU8B 4O4LA 2QUKA 5EZYF 3SXJA 2D0DA 4ZEVA 1NDUA 3CWZA 5DHAA 4E5YA 1KS9A 4FCTA 1XQXA 2W6JD 4Q12A 1KO7A 5D00A 3UV7A 1UC4B 4BFYA 4YRCA 1AMUA 3LYHA 1JSRA 1MRZA 2V6MA 3RVJA 5FLXA 1JMYA 1TD9A 2WKPA 1B73A 3CLRD 4YQEA 4YV1A 3RFFA 4B5KA 4TYPA 3RT7A 3W04A 2WOOA 3T5CA 2XCRB 2VAVA 4KGVA 4KREA 4R8VA 4H7DA 1HE8B 3OICA 1CS0B 1FLAA 1KDTA 1ZC3A 4OATA 3RREA 3GP5A 3ZWDA 4M0KA 1OB2A 3GD7A 1EDDA 1A1SA 3O4GA 4GNRA 5HHTA 5FH9A 1OTXA 2DBQA 2DFKB 2X4IA 4IIHA 4M1KA 3CGWA 4KX5A 2A4KA 1ZH8A 4B48A 4CKXA 3E9RA 4D6XA 1DARA 3RIEA 1IN7A 2HF8A 4JP3A 1PLJA 3TVYA 2JNWA 1F17A 1XTUA 1GKLA 3DSRA 4G1EB 2VRNA 4ZCPA 1UUFA 5BSGA 4LVNA 4YMTA 2CNBA 4N76A 5E4FA 2FSGA 2Y99A 4MW0A 3U13A 4Q18A 5CX1B 4GXQA 1RZRD 1XMPA 4KIJA 1XRNA 1AO3A 1NV9A 1J5XA 4NE2A 5HF5A 3ESCA 1XMQB 4BNKA 5BPHA 3S5UA 3A1DA 3IEMA 4IDGA 2XGGA 1AXEA 4LJ4A 4EO7A 4UEOA 4CLHA 5NULA 3WHKA 4ETWA 3Q8XB 3WK7A 2UVPB 3T4PA 1W4CA 2FCRA 4LF5B 1M8FA 4G2NA 1L5QA 3DP9A 4AX4A 2P9YA 2FLWA 4BS9A 4B0OA 2Y1LA 1DCKA 3EIUA 4NQZA 4MP3A 4DGSA 2IYNA 3OFVA 4Z7OB 3RYHB 1VLQA 2ECQA 5JWHA 4JYZA 4BO1A 4O4LB 4PZDA 2M6LA 5HKKD 1L5GB 1XZHA 3P9PA 1AZSC 4UQPA 5EZQA 4QNMA 3EA0A 2LTAA 1QPGA 3A9RA 2B5VA 3K9BA 4L27A 5EIFA 3T0FA 3ZHQA 4DMGA 5HK9A 4J8PA 5KSZA 1HYGA 1T8PA 2ILTA 2IPNA 3DCIA 4PYOA 4UJ3A 5T6MA 3L0ZA 4Z0TA 2BZ0A 3A0RB 4N48A 5J2UB 4CL8A 2I3ZA 4E1VA 4OA8A 5I5EA 3NDPA 3TAHA 4UM8B 3WXBA 1Q0LA 1I7SB 2Q2QA 3FHLA 3H9BA 5CGQB 4GZMA 4Q7LA 4EG0A 4MW6A 5E7MA 4LF4B 5JUWA 1MC8A 3PCRB 1SKYB 1KEKA 1AK9A 1KZ9A 1SQFA 4EABA 2A92A 3OX1A 3UH1A 4DE5A 2Z6QA 4BLPA 4YQFA 4KEAA 1XF9A 3NHFA 1IXYA 2FSVC 1F6DA 3PJFA 3EZ7A 4HEQA 4P4GA 2B7CA 1T3LA 4G1VA 1H3EA 4P0QB 5ALGA 3ZH2A 1HYQA 1PQ4A 1SIWA 1R9NA 2DZDA 2G77B 4C04A 1E0SA 1U2DC 1YMQA 4II2A 2EU8A 2XGJA 4O0MA 2LCFA 4ZU3A 2I7VA 1LX6A 1THZA 1XTZA 2VUUA 1XVTA 2WP0A 2BZGA 4G6ZA 4WX2B 3M33A 2CC2A 1U9JA 3GVIA 4IIYA 4KG7A 5K3FB 2R6ZA 4MKXA 1Q16A 1Q50A 4M46A 2O2DA 3SC3A 1TAHA 2X9QA 2ZJ1A 3B2EA 2Y68A 2IGBA 5C8XA 4R4JA 4OI4A 3EMDA 2GBLA 3LOUA 2HSJA 3HB9A 1OJLA 3AHJA 4YRPA 1EK1A 3K9NA 4E13A 2HPZA 2LDXA 4OAQA 1BEZA 2IYWA 4PYJA 3DKIA 2Q0XA 4IH1A 3CX7A 1Y5RA 4JFAA 2OHFA 3M89A 1D2HA 3O7WA 4G0PA 5JDCC 3IOMA 1YB6A 2ZROA 4RK7A 5FI1B 1H42A 1O9GA 1YZFA 2QP4A 3ZIUA 1MW9X 3CEJA 2VEOA 1G21A 3FGNA 1DQPA 4E4RA 4WVLA 2COUA 5DNYB 3M5CA 4UBLA 3KYCA 4XOIA 4RS3A 5TR9A 4D3SA 3CCCA 3IQDB 3W3AH 4DBLC 2JEOA 3E9YA 4CUKA 2Q4TA 3M9XA 1ZR2A 3JXEA 1RJ9A 1R5JA 1VP3A 2LKCA 3CF4A 3Q7QA 2PJUA 2UAGA 4WQMA 2M6KA 3SQLA 4J7UA 4E4TA 8GPBA 5IXJA 4FW8A 5J4HA 4PY2A 1L5SA 1O08A 4LGYA 5I7HA 4ZQCB 1CF9A 2Q6OA 3CNOA 1HWYA 3PGMA 4OFWA 4P0PB 1ZM9A 1K2WA 2H00A 5ALKA 2IODA 3KHSA 1C3XA 2HSEA 2WPDA 3PXXA 1T5DX 3E58A 2IDJA 1K3TA 1A27A 4FZ5A 2OYCA 1EDOA 4WD3A 3CLTC 1ZD4A 1CRWG 3CEAA 1UPCA 2AE1A 2Z2KA 4JSTA 2N42A 3VV2A 4UD6A 5CIQA 1CEXA 1OX5A 2OBMA 2YNMD 3IOYA 2GN9A 4IDBA 1B4DA 3EN0A 4JB0A 4LN1A 1FNMA 4LXQA 2GBPA 2MU1A 1QIMA 1YB7A 3I8XA 3UPTA 1CNFA 2PGXA 4CXMA 2Q5EA 1BVYF 5H3LA 2Z30A 3AP3A 3EOAI 1JWAB 5GAJA 5EAIA 1NNUA 2C8KA 4GMFA 4UCFA 3UJ7A 5DO9A 5CA0F 5EXDA 1G41A 1EE1A 4ZZ3A 4GWGA 3CBGA 1Y5NA 2DWCA 4XWWA 3LLSA 2KS6A 5DK6A 3UMYA 4NPAA 4F96A 1NLZA 4GX0A 4DW8A 1TUEA 1Z82A 1SWVA 5DBIA 4YMUA 3PDUA 1J56A 2HWYA 2XVMA 1SUEA 1N5DA 2ONYA 3WSVA 1G21B 1R8JA 1GTG1 2ZS8A 1XALA 3EGEA 3PC7A 3GP3A 2HFJA 1UAGA 3Q7TA 3KYCB 4L1KA 1JL3A 1I0ZA 2AF4C 2OVBA 2QK4A 3D7LA 2AWNA 1Z5PA 1P7VA 2YIVX 1KSGA 5SY6A 3THYB 1GNRA 1R6UA 4RS4A 621PA 1RJ9B 3K9WA 5EQTA 3OZFA 4KO1S 2AW3A 4TRMA 3KV3O 2XD4A 3ZUGA 3FYDA 4OQYA 4PS1A 1QWOA 4EG7A 3A7EA 4DMKA 1SIBE 3RJMA 4B6QA 4NEQA 3AUJB 2PCJA 1F3LA 4AROA 4JA0A 1D9XA 1P1RA 1GNPA 3H4TA 1DU4A 1L8QA 3I8SA 3LBIA 4HG2A 4E46A 1U94A 1YMVA 2PLAA 1E61A 2W2LA 5JI3E 2NMVA 3KO8A 1XB2A 3R7DA 4MVJH 1KMMA 2G7MC 2O3TA 4W7HA 2H52A 2VJOA 3TZHA 1TQHA 5LA6B 1AF7A 2WYIA 2VYVD 3NQ41 2ZTHA 1FPMA 4HS4A 1SELA 1YD7A 3IAAA 4X65B 3L8YA 3RS7A 4DM7A 1MR3F 4XTCS 2DKFA 1KJWA 3G79A 3EWSA 9ATCA 1M74A 1SXPA 2V0NA 3P52A 5DP2A 4CIVA 1XVAA 3KXIA 2YL2A 1DBRA 1OXSC 4DHEA 4LJYA 4HNVA 1OXUA 5AICA 1K8YB 3C6BA 4LI3X 3FNEA 1ZCBA 2FMIA 2X86A 4C29A 1XKLA 4U9HS 2HBYA 3JVIA 4OM8A 3DZFA 2BGNA 4RDHA 1V6SA 4GZ3A 1CYEA 1KR2A 2GO1A 1DTEA 4FGSA 2DFDA 4YN3A 2WF7A 3T7CA 4AS2A 4EKGA 1LLDA 4ER5A 3WRXA 2QLTA 2IX3A 4GOXA 5H16A 2HA7A 1NIPA 5DASA 3G2NA 1FUEA 5G4LA 2RG1A 3F4KA 3H3JA 3G8BA 4JP8A 3HDHA 3Q3JB 4XD7A 5K3BA 4L4YA 5K2OA 3Q9LA 3ZGLA 3OQNA 2RC6A 1LDBA 4CL3A 2G9UA 5A3VA 4KKVA 1TEHA 3MS2A 1G5HA 4GMKA 1ZXBA 1MVLA 3NOQA 1L5WA 5KOHA 4MV9A 3JQ7B 2MMCA 2CNOA 1MNAA 3AVOA 1RXSA 5EHQA 2GHRA 1PW7A 4UKDA 2PRSA 4MVXA 2ZCUA 3RVLA 2VKTA 2EJCA 3OTQA 3BKXA 3QX9A 3UMSA 3KIPA 1JIXA 1B2LA 4LJRA 4NE9A 3EXEA 4L51A 4JBGA 4O2LA 1S4MA 4JBWA 1C3EA 3LXUX 3Q9UA 1C4WA 2Y92A 4RY2A 3IEPA 1R9GA 4EA6A 5F76A 1SKYE 3VSAA 1NX9A 1UFVA 3AI2A 3FPAA 5E8JA 3TW8B 3C74A 2XNDA 4UNQA 3GUVA 1JIJA 2VA9A 3ETCA 2I3AA 1GLGA 3MMSA 1HFWA 1QR6A 2YVQA 2OK8A 2ZVQX 4QX6A 3WR5A 1N9ZA 3EEIA 1TT5A 4P4TA 3H2GA 4PCVA 1JIUA 4NLLA 4YRJA 3R20A 1V41E 4UARA 5F7JA 5B7QA 3KUDA 4O4HA 2P6MA 2Y4NA 3H1TA 4ZAVA 3NOOA 1ZRSA 4FUQA 3AILA 1K6JA 1XL0A 5KKNB 1MAHA 3L7JA 5JQGA 5A62A 2J1LA 1XMIA 4GEKA 4GMDA 4A27A 4BVKA 3L3BA 1Z5ZA 2H1HA 3WJ7A 3I5YA 3BS4A 4G2TA 3GLIA 2IUSA 4RZUA 3FFTA 1DCFA 1PT6A 3JQRA 2WB4A 4TKLA 1J0DA 1KYXA 3AK4A 3SD7A 1JDJA 1SUAA 4G36A 4GOND 1ZS9A 1BFUA 3G8DA 3T4UA 2J67A 4G0XA 4ACAA 2GN2A 3P19A 3EB9A 1P2BA 2RSLA 1M1YA 1DEAA 3CS3A 3F8TA 2JK0A 2XUZA 3AYXB 5KOHB 1LPMA 3DVAA 3KOXA 2QVCA 3OFJA 1AKYA 4S24A 2DPXA 4JQOA 1YRLA 2VPWA 4Z51A 5IM4A 7YASA 4EI8A 3FYCA 1AVTA 5BR8B 2IYPA 4Z2YA 2I67A 4XJVA 2OTCA 1VMDA 3BBLA 3BCRA 3DR3A 4HN4B 1X8KA 3JTMA 3EXEB 4DG5A 4HEJA 3NGMA 4TL6A 2PVPA 5BO5A 1QIDA 3VHRA 3PXBA 5J2TF 1QO7A 3ACCA 4IDFA 4URZR 3RIXA 4CLRA 5IH7A 3RC8A 1M2OA 3QFCA 2FEMA 2EL9A 4DQUA 4B46A 1EM8A 3GXBA 3HCOA 2TMGA 4PAGA 2A67A 2H63A 3OCWA 3NTQA 4UM5A 4DV0B 3RSSA 1TYAE 4ARBA 1TT5B 4YUWA 4D9JA 4S1NA 3E9DA 3OZDA 1IN6A 3AEUA 4L7VA 4OB8A 1CF2O 4XM0A 1S2DA 1WSAA 2ZEJA 4WZAB 3SZ3A 1YO6A 1IJEA 1TUIA 5LYYA 3QOXA 4Y67A 1O4VA 3T0GA 1U3FA 3FWYA 5JQGB 3O21A 1ZGBA 4Q7JB 4Y0VA 3H19A 1CUZA 3UJ3X 2VDOB 1WUTA 1M1XB 4TL8A 5LMUB 3GLIB 2NVOA 2OCDA 4ERXA 3LX6A 1KZGB 3CUTA 3ENNA 2NGRA 3GRKA 3G9UA 4O8CA 4TUYA 2XLBA 1IG0A 1I36A 1ZUIA 5CHEA 5FR2A 4GR9A 2CVFA 3HJAA 4D8VA 4ER7A 3RPEA 1T5OA 5E38A 6GPBA 5LDDC 1EIZA 1EX7A 3FNFA 1V48A 4IUYA 1RQ7A 2Z3WA 1ECBA 4RKRA 1OA1A 4CMEC 4DILA 1IIRA 3ZHYA 2O2YA 1YS7A 4JGBA 3RKRA 3AU8A 2I2FA 1MH9A 5E0OA 4TX1A 2Z4RA 3ZTYA 4EATA 4GF5A 2H4HA 4XASA 1M1YB 3JAWA 5EQJB 3SI7A 3TB4A 3PA6A 4DEXA 2V98A 3MJVA 3DVAB 4W1PA 3UC5A 2GPAA 4ZTZB 4C30A 5KTOA 2C2XA 2UZIR 1T15A 4UU0A 2KBFA 2HDNB 1QO9A 1YH3A 5KQRA 4RCZA 2Q5LA 3I5MA 1C3LA 2WHPA 4CE6A 3PEUA 2YYAA 2BR5A 4Z4EA 2D74A 2PYIA 1SULA 4UDNA 1YZ3A 1MDFA 4DLXA 5IDXA 3A26A 5IFLA 5FBKA 1M2OB 3CE6A 4MPTA 4GI2A 3WMFA 1EM8B 1OLOA 4FEYA 4NBNA 1Q22A 3IMKA 1M0EA 1FDUA 1KQ3A 1UEIA 2NSHA 4B3DA 3VKVA 2G1KA 4A6EA 2R00A 1L6RA 2BV3A 3KSRA 1IFXA 3F97A 2LKDA 4BLOA 1X74A 3AEUB 4IMJB 4LNAA 3OBBA 5KMGA 1RXUA 3R3YA 3V1MA 3I6MA 1SUBA 4OQEA 3UAOA 1B1CA 3I1JA 2XB6A 1JQEA 2CHGA 5EC8A 3RH0A 3BH6A 4G5HA 7REQA 1N25A 4Y9RA 1DBSA 1U80A 3EPJA 1KQNA 1ZGHA 3GVXA 4GYJA 1MAWA 5FBQB 4UD2A 2VF5X 5FOVA 1YHZA 4TUYB 4GG1A 3ZOKA 2BF7A 4L9RA 1EWTA 5FWAA 2ZJ2A 2IF2A 2PXCA 4RTKA 2YKGA 3BN3A 2ATVA 1F2DA 2EJWA 1LRJA 2GTPA 2R8ZA 3D81A 3DTYA 4NBSA 3FTNA 5LXTA 4AJOA 5KAMA 4B1FA 5DNCA 3JAWB 3I2HA 1UEXC 1RWWA 1J20A 3IKLA 5B3AA 4COKA 4JLKA 5I4BA 1P5FA 3EASA 2FUNB 2QSJA 3RKUA 2MR6A 3IP7A 3O2QB 4K87A 3KR1A 5EMJA 1U1IA 5HJEA 4JJKA 3Q3EA 3GQVA 1DIGA 1Y4UA 2VZ8A 5F9HA 5GVRA 2O59A 3RUEA 2EDAA 2WHPB 1S8OA 4P38A 3V1NA 2O14A 2DPLA 2IHJA 3BGVA 1WW8A 2EWVA 3SQMA 3G8AA 3W9BA 2IHYA 2CBZA 2B8NA 3L1JA 4NG5A 1ZHFA 4Q16A 1SIUA 1DEHA 3EOZA 3WLAA 3ZWXA 4KCGA 3O6VA 5AIBA 1FFYA 3LS2A 5IWCA 2JJMA 3FTPA 4JJGA 1OPXA 1I9GA 4OO3A 1ZCAA 3I0MA 1XRMA 3MINA 4M1EA 1ODIA 3SKXA 5KMGB 1XU7A 1LI7A 1TQDA 1MB4A 1V7CA 3KZVA 2X77A 1DOAA 1W4BA 2GCPA 3NYIA 1YTUA 2NAFA 4RABA 4XQGA 3OT4A 4Z4FA 2ZOSA 2G07A 4Y2SA 1QZTA 3JQCA 4GQIA 4ZIRA 5CA1F 3QM1A 7REQB 1QFSA 4LXTA 2Q1WA 5HRUA 3DXXA 4QULA 1GN8A 4NCKA 4H3SA 4WN9A 2VJDA 5A03A 1P5RA 3BERA 4PLPA 5EIXA 5DEOA 2QS9A 3C8UA 1T0PA 3E3AA 4YLEA 2X15A 2EW2A 1XTIA 3GZ4A 13PKA 4PNEA 2F1OA 1QGZA 5I7EA 3CJTA 1XPUA 3SC2A 3JRNA 4C1NA 2GB4A 2AGVA 1FYFA 2V59A 4MDEA 3GA0A 1N0HA 3HVHA 5G0WA 2I2CA 5LXTB 1K8ZB 3DZHA 3CVVA 1U02A 4FQ5A 3TUIC 2NZWA 1QYWA 3TUJC 3SFTA 1CUGA 4O2BA 2Q6VA 1PJBA 1B14A 2WZQA 3VOSA 2KWIA 1YE8A 3VAYA 4L0MA 4OHBA 2BEKA 3ZNQA 4F7DA 2IZZA 1LQ2A 3MGGA 1Z62A 2NZUG 4ABYA 1UFOA 1X6VA 3GLVA 2FZVA 1ENOA 2G9ZA 5E6RB 4EMBA 4IH9A 3MJ4A 2GN1A 2WA1A 4NV3A 1P9LA 3A6FA 3OM1A 3WK5A 3UKJA 1DP4A 4HAXA 1U8UA 2J7PA 3DBIA 4Z9YA 3P20A 3VMMA 2QV7A 2XDQA 2QBYA 9MHTA 2QJRA 2B36A 3UAWA 1BW9A 5DGXA 1WDMA 1KVTA 1E59A 4Q3KA 5LUBA 1WB9A 1NMZA 4IIUA 4IXWA 4NDNE 4A0GA 4INZA 4KZKA 3L8GA 5EERA 3ZVRA 4E07A 3I05A 3TAXA 1IULA 2YRFA 3F6PA 3F3KA 4QL3A 2VS1A 4B4DA 1RJDA 3JYOA 2WJ6A 1N4AA 3MINB 1XR3A 5AJVB 2G6BA 3NTVA 1Z47A 2WY2D 1RYDA 3CT6A 3ELBA 5TMDA 4C03A 5JCPA 1Y1LA 1QX4A 3MMXA 4DWWA 4E7PA 1DRKA 3QPDA 4FSHA 4L08A 1EMDA 2AR7A 3F71A 3KPYA 4BKPA 4ZIRB 4R8LA 3WQRA 1YVUA 3KCQA 4XWTA 3AHDA 2X2FA 3QEMB 3SHWA 3TNLA 2K7ZA 5BN5A 1G6HA 4IMIB 3R9WA 4LRUA 4BP3A 1WABA 3ZNPA 4ZVNA 2Z1NA 3CUUA 1AKMA 1JPNA 2CVZA 1LW6E 2HBQA 3L5OA 3MMNA 3SC2B 2XW6A 4EFLA 3BQMB 5LFAA 2VAMA 2HT6A 1EEXB 3AWIA 4XQ9A 3RBZA 1X7HA 1IK6A 4DXDA 1PGOA 1ADCA 5T5QA 4IW3B 4ZALA 2I2BA 5J4YA 1QF6A 3OE7D 4C21A 3MBKA 4H6VA 5KNDA 4O2BB 1DS6A 4GXTA 1X39A 1T10A 2OCAA 2XR1A 3NWEA 4DTIA 2XNKA 1QGAA 3N9IA 3IVCA 4QQRA 5IKMA 4IJMA 1PN3A 2HLDD 3GLIE 1VBMA 3TQOA 4YV7A 2P3OA 3C6ZA 4KMOA 1NNEA 4Q9AA 1ZQ9A 3TZLA 3N3AC 4JLVA 4DMFA 5G40A 2JLYA 2XDQB 3FPCA 4OHUA 4TLEA 4UQOA 2QUAA 2OK7A 2QBYB 1BW9B 2FNAA 1OFUA 1UPTA 1I1OA 1JZQA 4LMRA 4ND3A 4MVJG 4MGHA 3RHZA 3PGKA 5EJ8A 1TF5A 2D8AA 3FH0A 1IPEA 3AVUA 4LJ8A 3OPQA 5HM6A 5KNBD 3RU7A 2Q1YA 3BJEA 4PGFA 5E9WA 1C8BA 4PC7A 3A04A 4O4IF 5ENDA 1OFIA 5G0VA 4GO1A 3FZQA 4MV0A 4ENWA 2I4MA 2WTAA 3G7SA 3KL2A 3WGIA 2RBEA 5JZOA 1T0UA 1X1SA 1BMQA 5E4TA 1JXQA 3UT0A 4A0HA 1XYYA 2O2ZA 4I3FA 1I6KA 4Q1VA 4RQTA 5FOUA 3QG5A 4MYDA 2V8OA 3LUHA 3QKUA 2G3YA 1R00A 3H17A 4MUIA 1Z4JA 1ZCJA 3HDYA 4MCHA 4N0QA 4UJ5A 3VC7A 3A9SA 3L0DA 4OYRA 5B12A 3OJWA 4C4OA 1KDOA 1EQAA 2EJBA 2IPOA 5BN5B 1FFSA 2G9RA 4HEA6 1NOIA 1QM5A 3NAZA 2VYNA 3NOXA 1KFCB 2C4KA 3T5BA 1N2XA 3MGBA 2GESA 1JMKC 1U1GA 1RZVA 1KJQA 1TRKA 2ZBDA 3VHXA 4LMPA 4DRZA 3E53A 4CIWA 5ICMA 3WOHA 2C2MA 2Z5VA 1Z63A 3PTZA 1Z5UA 5DI9A 3SDZA 3O8LA 4DL9A 4YACA 4W9NC 3TDNA 2GJAA 3OEHA 3GP8A 2HR1A 1R6XA 4ZAZA 3V6MA 4L5BA 1LSOA 1PJRA 2SKEA 4DCUA 3LK7A 1JVBA 2JI9A 2WF9A 3I2KA 3ZHXA 4XR4A 3L4SO 4PWYA 4AJ9A 3GARA 2XVAA 4F3CA 5IASA 2OBLA 3G88A 4JI7B 2A3RA 1T2UA 1SC4A 2RHLA 3ITDA 4S3MA 4XVRA 4R2XA 3IVGA 2F90A 1GGVA 1VRCA 2WIAA 2QRVA 2PZLA 4X6YA 5GP1A 3T3PB 2C3YA 2IOHA 3ER6A 3R0JA 5JAUA 1M2HA 2B4AA 3KEMA 1Z56C 5AKEA 2V9ZA 2WUGA 4B5LA 3JQ9C 3JSXA 1CRPA 1B8UA 5ICGA 3T52A 1N0UA 1V8OA 2NQ8A 2DQYA 1AUVA 2BGKA 4KQ6A 4KRYA 3SX2A 1KYIA 4NESA 4TZKA 3LVRE 2F3RA 3LBNA 2ZS7A 3E0QA 2I71A 1WIWA 5AKKA 1DDIA 1U11A 2DHEA 4AZ3A 6NULA 4Y18A 1AMOA 1BMFD 1TM7E 3UPDA 3AJ8A 1K5DA 4V3CA 4BGIA 2O8CB 2QM7A 3RUAA 1F8UA 5FUWA 4N03A 2HMVA 3DHEA 3PRYA 2Q6LA 5E2IA 5EE9A 1AT1A 2GD2A 1YIAA 4RKYA 2VHQA 5E4JA 4F4JA 4MV1A 4GHWA 4UAJA 3U4MA 2AFIA 1N77A 1E2BA 3SSNA 5DCLA 1AM4D 4K1XA 1QYXA 3R0IA 4PGAA 4WCFC 3VHXB 1JXAA 2A7XA 2XH8A 2OAEA 1Q2XA 3QE4A 3ZS8A 1PWXA 4BP8A 1RI3A 2X4GA 2GM9A 4INJA 5KINB 2IYQA 5DW3A 4CT5A 4D82A 1W36B 4FC7A 1Y48E 1AA9A 3ZX5A 3LBHA 3DH0A 4XUDA 2QL9A 3GLGA 1D0VA 4MR8A 1LQUA 2ID7A 1JDPA 1L6IA 1P17A 1P0MA 2C0CA 3E48A 4TMFA 3LLVA 2WMYA 4JR1A 3K31A 3O3CA 1LC3A 3LY9A 4GP6A 1UKEA 3BJZA 4YR7A 1FTSA 2NN3C 2XUQA 2R6CA 1E9SA 3M4XA 3QH4A 5CH5A 3L8DA 4F56A 3CWQA 4A82A 5CXUA 3GK3A 1R4ZA 2CXQA 1DKLA 2VDJA 3CCBA 2NYVA 3I9V1 3J7TA 2QRVB 1H9CA 1YJ8A 1C0EA 3KYBA 4QJ4A 1RKXA 2FW7A 3R9IA 1G17A 4PWZA 1VLZA 4JI3B 1XQ9A 1YQ9A 9LDTA 2HZ7A 1Q0UA 2P1ZA 2Y9PB 1DG1G 3N8NA 2GK4A 3ILVA 2RDMA 2BRUC 1IG3A 4RETA 5HMMA 2JKZA 1KIAA 4AZ3B 1FXWF 2ODNA 3DL0A 3KPVA 3BMNA 5CYGA 3WKAA 4L6CA 1PNTA 3U0BA 3PDIA 4QQKA 1N5JA 3KKMA 5CM9C 5FTLA 3EVDA 4JGIA 1J5PA 4N0EA 2YBDA 3ZQUA 1A7KA 4PQRA 1EVIA 2NVBA 4J0DA 1SBYA 2ZJAA 3G0DA 2IELA 4IJKA 5DH9A 3WJAA 4YJ3A 1NMQA 3IURA 3ULKA 1KH2A 1WULS 5JXWA 1HM5A 2AFIB 3EZXA 3QVTA 2HQSA 3W1EA 4DCVA 1CUSA 2NZ2A 1CPYA 3DE2X 4AKTA 3L07A 1UC8A 3E05A 3NT4A 3L7LA 2BONA 1SNYA 5LD2C 2R4QA 4LOKA 4F3NA 2CLIB 4EITA 3E5NA 4Z53A 1LZLA 5ALEA 2ZRCA 1MP0A 1ABFA 4X7PA 4NNPA 4Y6GB 4D4GA 4MR8B 2P90A 5IAAA 1IVSA 1VCHA 2D1QA 1N92A 1SC3A 3TOCA 3WMWA 2IYLD 1RWNA 2YTZA 3MB8A 3Q6NA 3VDMA 3KQHA 4YS6A 3V4VB 5AW7A 1CJSA 2LIPA 2ZRAA 3O94A 3LRPA 4N0DA 5BRNA 3RBXA 5F5NA 3CISA 4BFVA 4UUQA 5DN9A 5JSZA 5AW4A 1NJ8A 2D5CA 3A37A 2OHIA 2P40A 3CF0A 3VU3A 1VE1A 2C2BA 1T3ZA 4HXYA 3AUTA 4BEJA 3L05A 4KIGA 4FQ7A 4UFNA 1G9XA 1XCPA 2Z3ZA 4PLTA 3H8VA 3WYAA 5B6IA 2C99A 1ZO8A 3UWSA 1Q1NA 5C18A 4D3DA 3Q10A 1P7ZA 4P34A 3GJSA 2H1LA 5C4MA 4JB2A 3QPVA 3C3DA 1JIIA 5J5AA 5ITZB 3EC7A 3GL9A 4UCXA 3W6ZA 1A97A 4V3BA 3MUOA 2O1XA 4ZAWA 3LPNA 3PDIB 4C4TA 1NBAA 4D9KA 4CETA 3AQIA 1VB5A 2XVXA 4GAEA 4CIXA 4R84A 5HQJA 3TECE 4BFCA 1WW3A 4KH0A 5E9QA 4YEDA 3UCFA 3R24A 4Z4HA 1E2UA 4YJ3B 1Z35A 3HV0A 1L4YA 4LMAA 4Q47A 3FCEA 2CSXA 3ZBQA 3ZIAA 1KZ7B 4FD2A 4IH4A 2C2WA 3PYMA 4EEXA 4WBNA 5LP1A 2ICAA 1G8GA 1HC7A 5KTTA 1WXQA 3IUNA 3KUCA 1QKIA 4E21A 1PFGA 1GOTA 3KXLA 1Z0AA 2QZSA 2XI4A 2ZWOA 1V26A 4P4UA 4D9HA 4DANA 3RTCA 5FWXA 2Y1DA 3TSAA 3UG6A 5FUMA 3PC4A 2I6UA 2F17A 2ZTVA 1KORA 3GJ4A 1MCZA 3LECA 4F91B 3PEWA 3ANLA 3WP1B 3WYBA 2JD2A 1TIPA 2O5CA 4LDRA 4I55F 2PJRA 5CIYA 3ECAA 4HNTA 1AD2A 1PBNA 4JXZA 3THYA 2X2OA 4KW7A 5B3JC 2PN1A 4WERA 1AE1A 4G81A 3ZWNA 6YASA 1RFLA 2PNJA 3QY9A 3HCDA 2W4IA 4RZ3A 1YRHA 4XCVA 1KAEA 3W5HA 2V7VA 3VVLA 5JSZB 3EF3A 4CWAA 1L1QA 4CV1A 1SU6A 2WM9B 2YIMA 4OI0A 2J85A 3IMEA 3Q0TA 5KTNA 4UBOA 1FXUA 5KTYA 4MUFA 5E2AA 1GD1O 2C2OA 1SB9A 3KEFA 4ZVRA 3FX2A 4QEZA 3VZSA 1W49A 1W2GA 2YW2A 1IY2A 4BU1A 1QYDA 1WO8A 1ORRA 4X0EA 2ZKLA 5KSYA 2ZUSA 5CCXA 1QDUA 1JZTA 2KBEA 2NIPA 2PEYA 1PTJC 3H5VA 2C4UA 1M0WA 1ZZGA 1NFFA 2P6UA 3JQQA 4LHZA 1W30A 2YJZA 4JJZA 4PZLA 4S1VA 4J0KA 4U5QA 2F1HA 2ZT6A 4FHEA 4DAOA 4DLZA 1K7YA 4KUGA 2OQVA 4K05A 3IR5A 2GYYA 3Q5DA 4IILA 4RSMA 3STTA 4Z7NB 2PUBA 1BA2A 1QDLB 2FMXA 4RVFA 1GPUA 1LA2A 1H2AS 3EZNA 3PUWA 4HY3A 3RHTA 4FEAA 3FYUC 2JLRA 5DRYA 4ZYYA 1G60A 3GUCA 2ZRFA 4CGYA 4WBNB 3DWEX 3ROGA 2UZAA 3QLVC 4HSEA 4AMUA 3JD3A 4P22A 1V5EA 2XYGA 2DPMA 3H2SA 3HYSA 5AT1A 3GLGB