1FZTA

Solution structure and dynamics of an open b-sheet, glycolytic enzyme-monomeric 23.7 kda phosphoglycerate mutase from schizosaccharomyces pombe
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
MTTEAAPNLLVLTRHGESEWNKLNLFTGWKDPALSETGIKEAKLGGERLKSRGYKFDIAFTSALQRAQKTCQIILEEVGEPNLETIKSEKLNERYYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAPPNGESLKDTAERVLPYYKSTIVPHILKGEKVLIAAHGNSLRALIMDLEGLTGDQIVKRELATGVPIVYHLDKDGKYVSKELIDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of an open beta-sheet, glycolytic enzyme, monomeric 23.7 kDa phosphoglycerate mutase from Schizosaccharomyces pombe.
pubmed doi rcsb
molecule keywords PHOSPHOGLYCERATE MUTASE
molecule tags Isomerase
source organism Schizosaccharomyces pombe
total genus 46
structure length 211
sequence length 211
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2000-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1fztA00
4PZAA 3QPWA 1UJBA 3O0TA 1ND6A 1QFXA 1QHFA 2WNHA 4IJ5A 2EKBA 1C7ZA 1SK9A 2EOAA 5AK0A 2P78A 4IJ6A 1H2EA 4GPZA 3E9EA 3FDZB 4JOCA 1H2FA 4D4JA 1E59A 2P2YA 1T8PA 1FZTA 4E3WA 3NFYA 1SKBA 1SKAA 1BQ3A 1DKMA 2IKQA 2F90A 2RFLA 3MXOA 2H4ZA 1FBTA 2P9YA 2HIAA 3ZHCA 4EMBA 4AROA 1YJXA 1DKPA 3C7TA 2YN0A 2P30A 1C81A 4PGMA 3MBKA 4TSRA 2AXNA 2A9JA 1EBBA 5AJXA 4D4LA 1K6MA 3HJGA 1DKOA 1BQ4A 3IT0A 3LG2A 3K4PA 4FDTA 2WU0A 4QIHA 5HR5A 5AJWA 5AJZA 3IT3A 4ODIA 1V7QA 2DWPA 3E9DA 3KKKA 2EKZA 2ENUA 2QNIA 3E9CA 2WNIA 4D4KA 2P6MA 3LNTA 2DWOA 5CDHA 2P2ZA 3EZNA 3K4QA 4EO9A 3GP3A 1QWOA 2YN2A 3LL4A 4PZ9A 3NTLA 1ND5A 2P9ZA 5AJYA 1CVIA 3GW8A 2ENWA 2OWDA 2A6PA 1TIPA 4HBZA 4JODA 1RPAA 3OI7A 3DB1A 3PGMA 4JOBA 2P75A 4ARSA 5HTKA 3FDZA 3IT2A 4D4MA 2I1VB 3FJYA 1UJCA 2HHJA 1E58A 2P79A 4FDUA 2H4XA 3F2IA 2HPAA 1XQ9A 2BIFA 3DCYA 3GP5A 2P6OA 4GPIB 1RIIA 3EOZA 4ARUA 2OWEA 2H0QA 4ARVA 2GFIA 3IT1A 5AJVB 5CU7A 2P9FA 1RPTA 3R7AA 4MA4A 1DKQA 1DKNA 2PA0A 1V37A 3D6AA 5PGMA 3F3KA 1IHPA 1BIFA 2H52A 1C80A 1SK8A 1YFKA 3QPUA 1DKLA 2P77A 5CX4A 3D8HA 3QPVA 1NT4A 3D4IA 3BIFA
chains in the Genus database with same CATH superfamily
2VZ9A 2HIHA 3AUJB 4HC4A 4GKKB 3QEOA 2AX3A 1Z4NA 1X42A 1R6TA 2RK3A 4I6EA 5BVHA 4EG5A 5LP1A 1C0IA 2J33A 3MS4A 2W5UA 1XZEA 4P5EA 4Z49A 4U2KA 4ILEA 5EIHA 1YA6A 1X77A 4E94A 2R97A 1YRLA 1VZ3A 3DBRA 4M7OA 1MVLA 3IOMA 2P3LA 3N1UA 1G3MA 4HR7A 2M9MA 2VK2A 1DS6A 3T0GA 1YVUA 1SBIA 4YX9A 3A8TA 1DGQA 2DC1A 2AN3A 3WLJA 3I73A 2FW0A 4MW2A 4YYZA 3U1VA 4A1OA 4TZ0A 3OM0A 3Q7EA 1QV9A 4QOHA 4GMHA 1CUFA 1GGEA 1QYXA 3HWSA 1YZQA 1VHLA 1Q21A 2G1JA 2ROQA 3NVDA 2RH8A 1TOAA 4L08A 4OBEA 5MN5A 3OCZA 2QTAA 3DHWC 3H17A 2A5GA 1YKSA 3JD1A 4MS4B 3E81A 4RGQA 5GGYA 2BFMA 2BFBB 3KR1A 4OB8A 3WE7A 3PNBA 4P36A 3BFKA 3RYTC 3TQOA 4QYTA 4DA9A 5DXFA 2WU4A 4F3KA 1NMEA 2BONA 2C9ZA 3CRRA 3QVXA 4OX9Y 1R0BA 1WDKA 1XEXB 4TKZA 3L07A 5B1EA 3WFZA 1T91A 3W1EA 1AV6A 2ZSDA 1GZ6A 2EX4A 2XDQB 2YWJA 1N9GA 1PQ4A 2BRUA 3KDPA 4D9NA 3NDRA 4R8MA 3TXXA 1IG3A 3B7PA 2JHPA 3EXHB 2P1RA 5K3AA 1D1TA 3V1KA 3EF3A 4Y18A 3WICA 1L7QA 4ZAFA 4B43A 3KPYA 1PR3A 4TRMA 2JRCA 3PS9A 4LWZA 4PCLA 5AOBA 2E55A 2Q4BA 4IH9A 3A0UA 4A2QA 4KNYA 1NI4B 3KVYA 2QL6A 2BGNA 2X86A 2QK4A 1GEEA 3KCNA 2LW7A 1XALA 4M49A 1R4MB 2IPMA 4HLDA 1GVHA 2PKQP 2ZJBA 3K1JA 3ORFA 1FSPA 3TL6A 2A0WA 1T9HA 5L4LA 4ND3A 4ABTA 3EBOA 1D2GA 1I3LA 4HVTA 3Q0IA 3DONA 4W9RA 1LV8A 1TT5B 3LBAA 3UT6A 1DVRA 2GK4A 3D3WA 3AKZA 1PR0A 3L7KA 3ZDQA 4PBRA 2EF0A 4UE2A 4YLEA 5GQSA 3ZHZA 1Z6AA 1LS1A 5BYKA 4DLTA 2Z3WA 4JB2A 4JGBA 1GR0A 2Q49A 1A2KC 5JLJA 1YDGA 3FFWA 4EJ2A 3ADDA 3CEJA 2FX3A 4UBJA 3K70C 4BNMA 3AUKA 2ZB4A 2ZTHA 5TVKA 1HQKA 1ZJ6A 1AKTA 2QI9F 3IBSA 4G86A 3WGLA 5A3SA 1WCIA 1IEWA 3KQUA 4UMVA 4P35A 2VYND 3HJBA 3G5UA 4EG8A 2HIMA 2JLWA 4AZVA 2N75A 1XKLA 2Y0BA 1SCAA 5HGXA 1HE1C 4ZCSA 5E95A 3E15A 3IRUA 3L5KA 5E9JA 3AH8A 3I6IA 5LQUA 4R1UA 4PN7A 2DHRA 3D6JA 5I9LA 2RG7A 4UCWA 3GWGA 2QZSA 1S8NA 3ZIAA 4AWXA 2PRIA 1QDEA 1DIOB 3EMBA 2R6DA 2ZJ0A 4GSYA 4YFYA 5DMHA 3B6MA 4M0PA 2FHPA 4LXHA 1UIMA 2RKWA 3TE7A 1JJ7A 2IYTA 1RWVA 1ZOLA 2R7AA 2V45A 5FTWA 5FYDA 3A2NA 4HB0A 3PX7A 3FCEA 4MO9A 2IHBA 4DYHA 4DRZA 4QJIA 5ESRA 2EZTA 1WLSA 1YR8A 1Y8ZA 4NBUA 1BHSA 4TWAA 5J9FA 3WWPA 3IHLA 3H18A 1SCBA 4GGOA 4OHRA 2GHQA 2AA3A 4Y6PA 2JGIA 4XLZA 4MMYB 1PBNA 3F3MA 1YR9A 3VO9A 2J7PA 2JVIA 3QPAA 4ZRMA 2ZI6A 3IV9A 2FUNB 2G4VA 5CTAA 3H2YA 4RTOA 4GMDA 5L7WA 1R6XA 3EXEB 4UHKA 3SFVA 4DUYB 4FGUA 1DUIA 1RMYA 3EVAA 5CCEA 2B94A 3UCEA 3RC3A 1ESEA 3NFYA 4EATA 1T8UA 1T9BA 1USUA 2VDOB 5F1PA 4YRBA 1KPIA 1PZNA 4M0LA 1PT7A 3OFJA 4AQDA 2FSHA 2FRDC 2FZGA 5IJ9A 3CEHA 1ZD2P 3J81A 1M8FA 2FW9A 2PL5A 4LX0A 2DFVA 2LV8A 1T15A 4KYTA 1E2QA 2QTVA 3QMPA 2AJLI 2YN0A 1SU7A 1RWXA 1VYVA 2MSEB 4IFTA 4IXDA 4JC0A 5K99A 4BLUA 2VJLA 3SJAA 3FLEA 4J2HA 4JYAB 2AV6A 2FZEA 5LNK6 1FSSA 3AV3A 2W71A 3S29A 2V5AA 2E21A 4LHXA 4F2WA 4IX9A 2F3UA 5E8RA 1Y9ZA 3IT3A 1MQSA 1HL7A 1XCOA 2WAMA 3QOYA 4Q02A 3SN6A 1TZJA 1CJMA 4GUAA 4GL2A 4WLVA 2VWHA 3ZHYA 2Z3ZA 1WZUA 3D8RA 3QWIA 2QVGA 3ETEA 3E9CA 4HLUA 5DBHX 1NVXQ 5C1IA 2DQKA 4BMZA 2JFNA 4LS3A 2Z83A 3A4LA 3K09C 4OSEA 2LCQA 4OPMA 4J29A 3VAYA 5A4FS 1CJBA 2XMCA 1MHPA 1RRKA 2D8MA 2PUDA 2XXAB 4H18A 3V97A 1PR1A 3C8MA 2HQBA 1OSNA 4XTRA 5ER9A 2XXBA 1VJGA 4L07A 2IH5A 1XL0A 4GI3A 3DM9B 4R9UC 4EVQA 3C8ZA 4B3XA 3IR5A 4KXWA 4S1NA 2F1RA 3PPYA 4PGFA 2W0SA 1XLWA 3RS7A 1TKAA 2F43A 2WY2D 2NNWB 1TNDA 2IV7A 4A8JB 3QELA 2NX2A 5AKGA 3MTDA 4ETNA 3I5XA 4ZV4A 4QTYA 4JX8A 3V8RA 1UJCA 5FPTA 4RFLA 3K6JA 1C7QA 1KO8A 8LDHA 2GYVA 1RU3A 3AEUA 2E18A 1LBTA 2FF5A 3W4JA 3C5WP 4S24A 3C3JA 3DNPA 3SS9X 2ATEA 1Y1LA 4I2NA 4ZVLA 1IZ8A 1X1TA 3MZ0A 2ZRAA 3B3GA 1L4EA 3OEED 5BSEA 5CUQA 4K6GA 3BD8A 3OU7A 5BQOA 1SHTX 1RI4A 4YV0A 4AN1A 3DV2A 4F1WA 3QPDA 1T4BA 2CFSA 5ENDA 1CF9A 1PL6A 1TUEA 2QA5A 5BSFA 4LHYA 4X62B 4AKHA 1U28A 1WLYA 3O90A 4UKDA 3FGZA 1U2PA 2FEPA 2HQSA 5K6TA 1DKNA 3WHKA 2PS9A 4DE5A 4G2NA 2QVXX 4YAOA 2ZFUA 2QSYA 4Y9SA 5CJPA 1RWNA 1G6OA 3AG5A 1F7UA 3QEBZ 2WTEA 5EWMA 3L49A 4WXPA 3B89A 4LZNA 3W5VA 2VDPB 3WXMA 3GVXA 2IEYA 1G66A 3AIOA 2D2IA 4QODA 4ECEA 1WXIA 1YFJA 2IYXA 2P4HX 3OHPA 4Z0PA 1NVWQ 5COBA 2JBWA 2UV8A 3UFBA 1E6KA 2ZIAA 3N5KA 1TQHA 3U7QB 4IJ5A 4F3RA 3PU6A 4JLVA 2PIDA 3K3PA 3U48A 4HXEB 1ADCA 4JB8A 4WZAB 5AI9A 4FSXA 5BN4A 5AVZA 1A88A 4L27A 1KI3A 2PZJA 1X74A 3V3TA 2OBFA 1AKNA 3WYNA 2XGGA 1AQIA 1C29B 1CUIA 2ZAMA 5DPMA 4R2XA 1D7AA 2XRFA 3QFCA 4U7HA 3ZDEA 2VZ8A 5HSGA 1QG2A 3MIIA 2GYWA 4KQ6A 2BEUB 2XRZA 3SWWA 1ZAYA 4BCBA 4AY5A 1UINA 5EZYB 1DBVO 3N7UA 4WI1A 2WSLA 4CETA 5F9FA 1YF3A 2I91A 5HG0A 3INGA 5FYQA 4XPIB 3GJ5A 4D2IA 2H2DA 4O4IA 1EVLA 1IMJA 2HWXA 1DKPA 1LWNA 1N7HA 4IGKA 2IBMA 2XUQA 4QNMA 4LGYA 5IXYA 1BTOA 2KLHA 3H97A 3OESA 4UHBA 1MDFA 3RADC 1IHXA 4FQ7A 3N05A 2OHXA 4U7TB 1HT0A 2IITA 4W1RA 2FWAA 2O1XA 3LX8A 3UB2A 4EI8A 1H2ZA 1RKVA 3W6UA 4C0LA 2VS1A 2VHQA 2VNIA 3VVCA 2FZCA 1XWWA 3AILA 3G1WA 4X1KA 5I8WA 2XI4A 2Q41A 1YC2A 2HMTA 3PBKA 3RYCB 4B9AA 3W3AA 1V16B 3MILA 3IPXA 3AF3A 3KQTA 2HRQA 2Y68A 1E3MA 2WRZA 3BJRA 3IODA 3HDHA 4V0KA 3TVYA 3M6WA 1SBNE 3V5NA 3IUJA 4YCAA 2QQGA 3C1UA 4KE8A 3K4HA 4RC9A 3UWMA 1PWHA 2FY8A 1ZYUA 2B2NA 1VG1A 2I54A 1SC3A 5HF6A 3AFHA 1RLMA 1LDYA 4G1MB 2D1RA 1XN1A 2C8KA 1IHDA 2G5CA 3ISJA 4E13A 5TQJA 5HQ3A 1I4OA 1TT7A 1VPWA 4Q3CA 3JAWA 4A1FA 4HDQB 2R1TB 3WJ2A 1N5MA 3WMEA 1L2TA 2ORIA 1XCJA 2CNOA 1FMFA 3F47A 2DF8A 2PBLA 2FWIA 2JI9A 2CLFB 5EHIA 1V26A 2Y1EA 3KWJA 5EUBA 1ULBA 1NIPA 4LXYA 4WKPA 121PA 3KT3A 2R87A 2YJNA 3D6VA 4GE3A 4OHUA 1BH6A 2FWBA 2QVZX 3AG6A 3OF2A 3V1NA 4TYYA 4Q9NA 1J09A 1UPTA 4CIWA 5ALFA 1P77A 3PGXA 3PRHA 4G09A 4XYLA 3F2IA 4GRAA 3L0DA 2QZPA 5CEFA 5K03A 1ZBDA 3KXDA 3C6XA 4YAKA 2BMDA 1YHYA 2NPFA 1U5BB 3A10A 1RZRD 3V6LA 3Q3CA 4ZI7A 4LSZA 3F6RA 4QDTA 2QR3A 5FL7A 4G1UC 3BIJA 4DLXA 2IBSA 3I2JA 2KHZA 3JX9A 1XVIA 2X8JA 4X85A 1XMXA 4FR5A 3ZJTA 1G21B 2EU8A 5B4VA 4WLFA 4KWCA 4M0UA 3T35A 4OK5A 1QZUA 4TSFA 1LZLA 2P41A 4NMWA 3MJCA 3D6MA 5DE3A 3FKJA 1IIBA 1FNDA 1ZJZA 4Y1RA 3VO8A 2XTAA 5ULLA 3OQIA 1XTZA 5KYGA 4QEDA 1MQ9A 1E1NA 3R2JA 1EUDB 2AFIB 4P98A 1DU4A 4QOSA 4EG0A 1K5HA 2IXDA 5K0JA 4TLMB 5EPEA 4NBVA 2GBLA 3ENVA 4E7PA 2HMWA 1F2UA 1YS6A 2V98A 3BB4A 4OI4A 5H83A 3ND7A 5HJ5A 5JXWA 4AY2A 1C7ZA 4OG2A 2R4QA 3IE2A 1NVEA 4YXWD 3FPGA 3NTUA 4MO2A 1W0CA 4LHEA 3T3NA 4EI2A 1CUUA 5BVGB 4RPCA 2Q2WA 4KI0A 3SOPA 4AJKA 1L4HA 2XVMA 2YC4C 3KQYA 1HYQA 1KZ1A 3ESAA 5LUBA 2HT6A 3AKCA 4RTNA 3HH8A 4GLLA 1SVWA 2MSCB 1W4BA 1KI2A 1R66A 3QXSA 1UXGA 4X00A 3L0YA 4F9TA 4HH4A 1PZMA 1GADO 4K9MA 3ROQA 4C05A 3EA5A 5LP6B 2KBEA 4BLPA 4DA7A 3UC9A 5JSUA 4ZK6A 4ZPJA 5IXSA 3L7YA 2YMQA 2J9RA 3HP1A 4DJDC 3R6LA 3A26A 5JO9A 1Z4QA 2PBFA 4BPBA 2AL7A 3I58A 3AY7A 5HUJA 1T2CA 3W5IA 1E0DA 4B6OA 5JNUA 1SVSA 4QBIA 3O8OA 1WBBA 3G8YA 1DDOA 4PZ0A 4Y9DA 4CUZA 3WSVA 1PVOA 4P1ZA 2AMLA 3DZCA 3I4FA 5E1BA 1UWKA 3OFND 2ORVA 3BRCA 1JWAB 3BDVA 4ZICA 2RKOA 2QYSA 1EUCB 1E6EA 2NZJA 2QT9A 2FKAA 4R1PA 5FEUA 4FWIB 2PGXA 2DWUA 3W8EA 4TKVA 4MARA 6CHYA 3DBVO 4ROTA 1E4EA 1KR5A 1KYYA 3UOWA 1GGJA 4HVLA 1HQDA 3C16C 4PZ9A 4KXMA 5JUWA 2XB9A 1SVOA 1GL9B 3A1SA 4G0PA 3EEFA 1CDOA 4RQAA 4C87A 3U1BA 3FUTA 5GZ6A 1HYBA 3H11A 4EP1A 3HMKA 2ZYRA 1T8YA 5E7IA 4FFNA 4C4ZA 2VSQA 1KP9A 4JBGA 1IE3A 1JW9B 1TCBA 2FP4B 3KQWA 5IU6A 3MVEA 3U1TA 1SIWA 5ALIA 3RD5A 2F67A 1DPGA 2XQFA 2YIDA 2Q4OA 3PX3A 3PA6A 1V39A 1RAEA 4W5NA 1KNQA 3J81k 5LLDA 4FDUA 4IAOA 3TSOA 4D02A 4EB0A 4YDQA 1TU0A 2EATA 5DYYA 4P0QB 1FXWA 4MW4A 1UKCA 2OGTA 1FP6A 3PR1A 1EM6A 1GPYA 5FH9A 4FZ5A 2GBCA 4RVUA 5I9BA 4DDHA 5LMUB 4NTZA 4RXMA 5UKDA 4UAJA 3GJ8A 2BHRA 2H5EA 2IPLA 2TS1A 2YWCA 4KWHA 4BFWA 5BWMA 4ITVA 3G2KA 1ZKMA 3NOOA 4LTNA 3V7FA 3BD7A 5HWSA 2G28A 3ZI0A 5LQMA 1AMUA 1ZOPA 3SJ7A 1U2EA 3R5TA 1MFZA 5ESXA 2KWIA 4IZIA 1E3EA 8ADHA 3OE5A 2YASA 1OPXA 5AOVA 2I2WA 1V5WA 2OFOA 1EIZA 1ZD4A 3KXIA 2YNMC 3I5YA 4MQBA 4QLAA 2C4VA 3AC0A 5IC6A 1E9CA 3PLAE 1G8GA 3C15C 4KIFA 4DLRA 4N82A 3VZQA 1NNUA 2ZIXB 1VE7A 2UDPA 2AMYA 2QMOA 1Y3BE 4MYUA 1W49A 1RAHA 3UY4A 5F98A 2DHQA 3F71A 4P4TA 2VF7A 3PQ7A 4R9SA 4DV7B 3PEYA 3M9XA 1QAMA 4OUDB 4EDFA 3QLVC 1SK9A 2O5EA 3G9QA 3R6TA 2P78A 1Z5PA 4LJSA 1NVGA 2AEEA 2ZTLA 1JIXA 4I55F 4UTVA 4XUEA 1X15A 3LM8A 4UEWA 1R12A 1CVLA 2AR0A 1NQUA 5F33A 4YO7A 3SOZA 4AO8A 2X23A 3CKYA 1KDOA 2ATIA 4NABA 3CLRC 1L8OA 2E3JA 5L53A 4Z4QA 2C3OA 4PNHA 4KZPA 5AW2A 1L5VA 3O9VA 3LUFA 2PKCA 4RX1A 1XZDA 2JHFA 3NV7A 3T5GA 1RWWA 5DRYA 3QE4A 4WH0A 2ECPA 3T9BA 5JD4A 2HXYA 3UQZA 2WI8A 3OOHA 1KIAA 2WTNA 4V1CI 3PF8A 2Z4SA 5MGBA 2GDJA 4CV0A 4W5RA 2Q8NA 3ZC3A 4L22A 2B8TA 1I1QB 3QWFA 1WULS 4PLYA 4IDEA 3CSSA 4LC1A 4PIMA 2C3YA 4D98A 3U39A 2E0IA 4D96A 1JR3D 3FYDA 1FFBA 4R8SA 4RF4A 2LPMA 4O2BA 5EJ9A 1Z5VA 3WGUA 4CUJA 3LNCA 1NYLA 3MMZA 1V2HE 3K70D 4A0SA 1MNAA 1R8XA 3MD9A 3RVKA 2LIPA 3KKKA 1NW7A 2WD8A 3GHYA 4V2IA 2HCFA 1GD1O 3M70A 4E5MA 5HUQA 3DCIA 3T4UA 1QCCA 4B3GA 4EITA 3QI2A 1B74A 3F90A 3TX6A 2SICE 4ERXA 4D80A 3RRYA 1F2VA 4IBOA 4BQIA 1I24A 2P4UA 3M5CA 3SSNA 4YBZA 1R2QA 4Y2JA 3UAYA 3BMOB 1CNFA 2FWJA 4MI6A 1QGAA 2R6HA 4EELA 1RC8A 3O3MB 3AJRA 5EXEA 5B1IA 5ALVA 5SZHB 5TS2A 5BR1A 2WKQA 4EG1A 3PXUA 3L0ZA 4JDPA 3KBBA 4J1QA 4ALNA 5CGZA 3DKKA 5CT8A 3PHBE 4QHYA 1W9HA 3EA4A 1KQOA 3PVZA 4YACA 2PZBA 1R0LA 1E1RD 3Q10A 1Y80A 2YRFA 1Z36A 4W1PA 4YJGB 3WVNA 4QSMA 1JHAA 3I9NA 3A9VA 1PV1A 3PUVA 5GY7A 1UZUA 2DUNA 1A77A 4JVNA 1NX9A 4WK4B 5JDIA 1GNRA 2AF4C 2PS3A 1MDBA 2X9VA 2FEXA 2NSDA 3QNWA 5T4FA 3ZK9A 1UZMA 2JGLA 3H3FA 4DY4A 4E07A 1QTRA 3ETDA 1TECE 4DG9A 4UHFA 5H4HA 2VDWB 4CR7A 3AX6A 6PFKA 2RGGA 1ZJYA 4JA0A 1DO8A 3IB6A 2AC2A 3L93A 4OU5A 5AKIA 5IHPA 4FINA 2DJ5A 3RKSA 4C07A 4PQFA 1U9IA 3PQ5A 2ATCA 4Q1AA 4Q9LA 3G2HA 1EUYA 2IYFA 2XITA 1SG9A 3MD0A 1N2BA 3ECAA 5I45A 3UMYA 1KEZA 2HV8A 3BVPA 3AHCA 1XZLA 1CU1A 3R5HA 2VCYA 1PP4A 1AGXA 3PNLA 4JUIA 5CLIA 4ARZA 4ESEA 1G3RA 2QTMA 1P72A 5FTLA 1HEUA 1P1BA 2FMIA 5CGQB 3ZY2A 1Y8QB 1DQRA 1TO6A 1P62B 1R9GA 2MINB 3DBLB 2GARA 4L2IB 3A3NA 3FVQA 3Q2IA 4F96A 1EG7A 4HH1A 1N36B 2I34A 3FLAA 2QS9A 2O3JA 3R8CA 1B8PA 5B2FA 1SZJG 4QOJA 2YL2A 1V8BA 2CMFA 2HI0A 4P2BA 1D8TA 4YCNA 1DBPA 5B3AA 3WLHA 1UKBA 1Y4UA 4O4HA 3DBOB 4BDSA 4RYDA 5CDFA 4D9GA 1YJBA 1NNLA 3NTXA 5F1YA 4ZHQF 3JR3A 2Q8QA 3K70B 3SZOA 3SY8A 1KR2A 1PEKE 5JQGB 2PEYA 4RPHA 1G21E 4EQZA 3GLFB 3QBJA 4IJMA 1ULAA 3ZKAA 4KBGA 3O4IA 2YJ5A 1K75A 5CVDA 4CU5A 3NHKA 3TLKA 3WRXC 4CKCA 2OCYC 5DEIA 1VLZA 2JG3A 3EY4A 1CUZA 1BQ3A 4DXDA 4K8RB 2X4DA 3HKEA 3IILA 3QVGA 1TC2A 2PUGA 2WICA 1BJTA 1SOMA 2EAUA 1L8AA 2KJQA 2XNCA 1SD2A 2AFIE 5EIWA 4KHPB 3S2GA 2PSEA 1I3KA 4M1YA 3O31A 4BECA 4M54A 2H1OA 1DOHA 5KJ1A 4FT4A 4OKSA 4EBBA 1U1GA 1H5QA 3FPSA 4Q7KA 4WZBA 3FOFC 3C6KA 3VDQA 5A4KA 3RSCA 3FWZA 3WJAA 3WYCA 1E79A 2C95A 3F3SA 1XX6A 2E4UA 4YHBA 4ZOAA 2QD4A 2B2XA 2QSJA 1TIBA 2G80A 1UMBB 1ZP6A 1RAIA 3SICE 1M6YA 2ZRQA 3IA2A 2EQ5A 3OA2A 2BEVA 3TD6A 1BNCA 2B3TA 1HNWB 1P9WA 3M5DA 4QJ5A 4TV8B 1ITZA 3DSRA 3IH5A 1XL1A 4BO7A 1COWA 4ZOLB 3KYCA 4CRWB 3IAS6 2OFPA 4NK4A 4DLKA 4F9FA 1S2NA 3FPEA 2YBEA 2OLEA 3ZDBA 1B41A 1GRNA 3LW8A 4C1BA 5L6LB 4BQNA 2P8JA 3KJQA 2C3UA 2FWPA 4IV5A 3WOHA 1TU3A 4OA8A 5JAHA 1FNCA 1JALA 2W6JD 3NATA 3AB3A 4NESA 1BOFA 4U8HA 1MW8X 2ZB2A 3ZUPA 2DFPA 4IINA 4HB2A 3N70A 4LCJA 4BE9A 3C7AA 1J8YF 1EK5A 1ZJ5A 2QU8A 2DUUA 2Y4NA 5KS2A 2OXCA 4UNIA 3UZUA 1PGOA 4PFSA 2Q9UA 4X45A 5G02A 3OPVA 2ISCA 4L0DA 4Q3LA 3F9RA 4URFA 3RVBA 1I0IA 2NQ8A 4LY9A 3SEFA 3LT1A 1JX6A 4S05A 4KH1A 3NHJA 1IBCA 1RHUA 2HA4A 2VTBB 3V7UA 5AW9A 1IJEA 3FM9A 1QMPA 3NT4A 1MPTA 3KEQA 3ENWA 3QUQA 4B32A 3E1KA 5HILA 3TN7A 1F7VA 2UYHA 4R1LA 3G6KA 3B1FA 3L7DA 3ED5A 4BGVA 1RPNA 4PFKA 2Q9AA 4QUAA 2ILVA 3ZGVA 1VG0B 2OYRA 5B37A 2O2ZA 4MS1B 3SR4A 1I7SB 3ASZA 1G8JA 4CQMB 3CEAA 3UK2A 1F0PA 2I1QA 3NALA 4MW5A 3TTWA 4I66A 1Y4DE 5DI3A 4M8LA 2BCEA 3G0BA 5EZ6B 3PIRA 2QRPA 4QXMA 3LT0A 4M1EA 3VU0A 1JA0A 4HFMA 1WR8A 1BQEA 5CT4A 5K51A 1AN9A 4QT4A 2NPOA 2AFRA 3FY4A 4NNPA 3DCNA 1QFXA 2Q2QA 3KK0A 1CE8A 1L5MA 2PFSA 1V5EA 1E2FA 1RRVA 4R3UC 4D8WA 2O19A 5LMZA 3A6PC 5FPPA 4YDHB 1MB9A 3DAOA 3F4KA 2JZNA 3HV0A 4WKOA 3WXBA 1S0UA 5JMPA 1Y5RA 3CKKA 3IVMA 5T6BA 4INAA 2PGLA 5TEVA 2DR3A 4BN0A 4UTRA 1ECGA 4DCGA 4TMYA 1FSZA 1ZJJA 3T7IA 2SCUB 3PT5A 1YO6A 4PX2A 4QDZA 4UOQA 1MD9A 4BZPA 4WASA 3MN1A 4HFJA 1JKXA 1GSAA 4BMOB 6Q21A 3VHXB 4R2IA 3C5CA 1TK9A 2YJ6A 5HFNA 4B1FA 2CSUA 3PRYA 3EDRA 2AD5A 3H9QA 4CQLB 1U4NA 2QJWA 4L72A 3NVKI 4GKJB 2Q7XA 3N2NA 1KQNA 4K03A 4LK2A 4O25A 2G07A 2YJTD 1E69A 4LDJA 5HIJA 4MVWA 2QPTA 4EGSA 2OAP1 1EVJA 3ZY5A 4B71A 2VPIA 3HB4X 1FLAA 2GN9A 4GSLA 3WY9A 3C0KA 2WYIA 3A4NA 3F7MA 3JWGA 5K6AA 3D31A 4EI9A 1B26A 3W1WA 2IHVA 1NGSA 2OV3A 3OFVA 1T4MA 4Q6WA 1V43A 1S8FA 2FJUA 221PA 3CH6A 5B2ZA 4B7XA 2P5SA 3AFGA 2XH8A 1U2DA 3NHSA 2AEFA 3OJCA 3VVBA 2BI7A 1O94A 1M8GA 1GPKA 2AN5A 3FLBA 4LCBA 2P6MA 2FLWA 5ICEA 1N0IA 1BG6A 3CF4A 4RD1A 3RTEA 1WZCA 2G7MC 3HKBA 4PC2A 4BO2A 2OEPA 1U9ZA 2MIIA 2WJHA 3D7RA 3U09A 5ICSA 4H7EA 4B6RA 3GUCA 2OWDA 1MTZA 4NOKA 4UNNA 3RVSA 2IJGX 3RAFC 3T4EA 1W46A 3CG4A 3ITDA 2AVDA 3LWNA 4JODA 3FDJA 2NT4A 1W8IA 4GAEA 4JUCA 2AZDA 1JIJA 3ZYCA 1GL6A 4M89A 3TLBA 1HUQA 4A0FA 4DXAA 3ZWQA 3M6LA 1WSWA 4AMZA 5KPJA 4C7OA 2MSNA 4LAFA 2I7VA 2QX4A 1ZXXA 5B1YA 1VJ1A 1P2DA 5L4SA 4FGJA 1QCZA 4HZUB 4MUNA 1ONBA 4HMPA 3NTOA 5LD2C 2NU7B 2QW0X 2CEAA 3LE8A 1QU2A 1Y1QA 4HDMA 1UZLA 2EARA 4Y2GA 1NQAO 2F3QA 5ALQA 1SHZA 4CTNA 5BQXA 2JCBA 1CK4A 3PWKA 1XZHA 4EA9A 3AYXB 4HK4A 3KR2A 1VJTA 1UPFA 2AOTB 3QUTA 4KUHA 1SC1A 2OORA 1NLFA 2DXIA 4BZZA 4MEBA 3ELDA 4QUDA 2OV2A 2E4ZA 4KQMA 4YP5A 4EJSB 2M2IA 3OQOA 1LV7A 1RJGA 1TKBA 3O4VA 1EWQA 4ML3A 1QKKA 1UMCB 2GBLC 1E2UA 2PUVA 4FU0A 2C9CA 2ZI4A 2PR2A 3PQ3A 3DDHA 5DM4A 4XDHA 2YBDA 1G8FA 1O2DA 1VCNA 3HYTA 2P0AA 5F21A 3WFJA 3U4QA 2VPQA 4ZPXA 2AKAB 4DARA 1JA1A 5DTRA 1RXYA 1YQ9A 2LD4A 1TJPB 2A2ZA 2NYUA 5K0BA 2YJGA 4JEMA 3TPZA 1B73A 1ZQ1A 5FI5A 3UJAA 3TQIA 1U0LA 2XE6A 4K28A 1HF3A 4AK9A 3MTEA 3GNTA 5AM0A 4F4DA 1A50B 5FADA 2TRSB 4PVCA 3W79A 3WBBA 1NNI1 2ECQA 4KFCA 4DY6A 4NHEA 2B37A 3N87A 3Q41A 4XRRA 4YR9A 4KPYA 3WV5A 1M2GA 3IV6A 3VZCA 2ONZA 4RLFA 2PBZA 2CD9A 3UW3A 5DGHA 1W2HA 1FTNA 2E85A 1TQ2A 3NDJA 1U2RA 2GZAA 2EFDB 3ZIDA 1N6NA 1XN4A 1EXDA 3IIJA 1LLUA 1HDGO 4JP5A 4K9SA 4YCDA 3AOGA 1V9SA 2JVJA 3TZLA 2G88A 3F5QA 2AX4A 3EGOA 3GOHA 2Z08A 3P0JA 4XCQA 1JBQA 4FX5A 4RD2A 4YRPA 3NYRA 3GLHA 4GRDA 4KQ2A 3T7CA 2NO6A 2BMEA 2HB6A 1P4SA 2NXNA 1QFZA 3RSQA 3UBTA 3A2LA 1QX3A 4YY3B 2N42A 5KREA 2ZIZA 4KLRA 4CW7A 2HGZA 1XZCA 4MYHA 3GLFE 2QV0A 2BM0A 2UZ1B 1BKDR 4KQFA 4YPFA 1MAUA 4D79A 2NU6A 3UJ6A 3IHWA 4PV7A 4LSWA 3GJTA 5CP8A 2WAAA 3UMGA 3GFVA 4MVXA 3KAQA 1RI2A 3S2IA 4AMBA 4CIAA 4ZN6A 2ZRBA 4OHMA 4BOYA 5FWNA 2I22A 3BFVA 4DL9A 1AT1A 4RK0A 4S0ZA 4CM9D 1C8BA 1NFQA 2RBKA 4N7BA 4QYIB 4GS5A 4B7ZA 4R3WA 3LHDA 3HWX1 3EGDB 3IO5A 3UUWA 1ZH2A 1CD5A 3C3PA 3E70C 5A7FA 4LXQA 2P9JA 2XKAA 2D0PB 5DHPA 1GKLA 2F00A 2QG4A 4HWOA 3ABQB 5KYVA 3GRAA 3GCDA 4HAOA 3VKFA 4C9BA 4M99A 1U3DA 4XYGA 1XU4A 2GD6A 2WFLA 2WSIA 1LLFA 1WVMA 3TMKA 2WIDA 1GZSA 1NOJA 5DNUA 1X7XA 4H1TA 4IIDA 3PXGA 3S1LA 4D44A 2O8DB 4RZQA 3ZLTA 3LH5A 1HV8A 1B76A 3MSXA 4HS9A 4U6NA 4U4AA 5JFOA 3DOCA 3WO0A 3SXUB 5DLPA 1KF0A 2BHTA 1Z7YA 3T7KA 1RABA 4P8RA 1KSFX 3NHUA 3CLRD 1FP7A 4EGCB 4OFWA 3NJ8A 4JEIA 3AF4A 5KYWB 2FCAA 4K9NA 3G59A 4UBLA 1RJ9B 1UPUA 2VF4X 2ORYA 4QULA 5DB4A 4CTMA 3QE9Y 2PSJA 1L1RA 1RPTA 2B1QA 3KD2A 3QKRB 1V48A 2QPOA 3H1FA 3OJLA 1GFIA 1LF5A 5B6IA 2I76A 1SBTA 1OMOA 1PUXA 3VJMA 1GNPA 2DBYA 2B1RA 2JCGA 3C6ZA 4FX2A 4U39A 3Q8MA 2BBTA 2RIRA 1RW4A 1PDOA 2Z1MA 3R7BA 1PRYA 4PXAA 1OGJA 4QT0A 1DUSA 3HZRA 5B7GA 4XB6B 1CLUA 5C0OE 2EL7A 5JBNA 4OHYA 5AXBA 4NDZA 4TSKA 3O03A 2XB4A 1RQNA 4UBKA 2CCKA 4ZVSA 3OX2A 3QEAZ 4J16A 1PV2A 1FTYA 1BZYA 3RFVA 5KINB 1BS9A 3ZCPA 3L41A 3I2GA 1WZIA 3RIMA 2P6UA 2PU5A 4MQFA 5JDCA 3HEBA 3FCSB 5EINA 4R69A 2Z2KA 1M75A 2FMFA 4WESA 2L18A 3RLFA 1XK6A 5T4HA 2R7KA 4F2GA 4IJQA 4UUPA 2CT8A 3I5UA 3DULA 1ORRA 3PF9A 4JZKA 4M8SA 2UYCA 1BN7A 1N3IA 1W25A 3HU5A 5JRZA 5CFRA 5K2MA 1NJFA 1W19A 4EFDA 1DXOA 4DWOA 4AICA 3WC4A 4DC9A 2XD9A 2OR3A 4X3CA 2E6KA 3ZXYA 5JG7A 2GAJA 3STUA 1TC1A 5MFPA 4RADA 3HBFA 2VF8A 5ICFA 3IE0A 4EFMA 2GK7A 4B2IA 1P33A 4PO1A 3HGMA 1ZOIA 2B82A 5CG1A 4ZOEA 3O9ZA 5JYEA 4ZA2A 2FSVA 4DQDA 2A92A 1MB4A 1UXJA 2ODBA 1BDMA 2BGRA 2QTNA 5LB4A 3W3AH 1ZD1A 1WB9A 1V5FA 3ET4A 4Q03A 2DB3A 4NYIR 1VJCA 4G63A 4PZPA 1BN6A 4RTLA 5FT9A 2H1IA 1CR1A 4DDTA 1ST3A 3CE9A 3LCMA 4MI9A 2GVZC 4P3KA 1ADBA 2AGVA 3SBOA 3FKSD 2NUBA 1Z82A 2BHSA 1RI5A 3FUXA 3VC7A 1DARA 2RGUA 3E35A 5CYGA 2GILA 4PG8A 4BFTA 3AR9A 1A2QA 2C98A 1EP3B 1CUWA 3TO5A 3VPHA 2D5LA 3GW8A 3IPLA 3L2OB 4L7QA 5EMKA 1LBQA 1CUVA 1SOAA 3CW8X 1AHPA 1OI7A 3ANTA 3MTGA 2AJ8A 3M6FA 3LT2A 4F60A 2Y67A 2ZYTX 1OLUB 3L06A 3UGKA 2GRJA 3PDJA 3UFXA 1LDEA 1B6SA 1M34B 1EK0A 2WG0A 2VHUA 1XQXA 3AHIA 1A04A 2XSZA 3FTNA 2B4RO 3D8TA 1OKKD 5A4IS 1KBOA 2JJYA 3LY7A 4AZ0A 4I14A 3JTEA 2A9KA 4YP6A 3UKJA 4H3SA 3ICCA 5CB8A 2IFTA 4II7A 3WL4A 1GPUA 3Q3GE 3COPA 5FPQA 1BVYF 4LEIA 4MQ4A 3RK4A 2YS7A 5FPYA 2QRMA 2ERXA 5FBHA 2R8RA 4EMTA 2P9FA 3QEKA 2LKDA 3EHDA 2GLUA 4JP8A 3IEUA 4LJLA 3L3BA 4WN9A 3D3WB 3DYVA 3MT0A 1ZGJA 1QK4A 1IVYA 4YRFA 2LRHA 3D1JA 4J2OA 3MWKA 4K6HA 3GJZA 1P2VA 4J4TA 3GPDG 1N2HA 2JAPA 1YSCA 3GLGA 4WQMA 1PQYA 5E0OA 2I0FA 4EKGA 2XT6A 1TW3A 2WAOA 4IDCA 5K3OA 3LQ1A 5DGDA 5TQVA 3W5UA 3BE8A 4IGFA 5E8JA 4GFDA 1WQ1R 3PHCA 4FTWA 5CFPA 4RLHA 1IU9A 4LVNA 5LSAA 1R00A 3UWDA 1F60A 3DZKA 1X19A 1THGA 3TQHA 4HNVA 3ZZ0A 2FDRA 3O73A 4ADSG 3QX3A 2VP0A 3TW6A 5EJAA 5EYPA 3ZE2B 1JAIA 4GH5A 1ZNXA 1OWLA 2K2QB 2OGSA 2AT1A 2DCUA 3IB3A 4IH1A 3TS1A 1BS2A 2OO5A 4IOKA 1G18A 4L95C 3GRPA 3W6NA 1RPZA 3GFSA 3ZHXA 1L5FA 1W5EA 2J6BA 2VWPA 1UK6A 3MUEA 1A4XA 1KKUA 2GJ8A 2JD1A 4RPIA 5CJJA 5AW0A 3F5MA 2IUFA 4EHDA 2DKOA 4G5OA 4F97A 3EGXB 3L6EA 5L3RA 1X9GA 1FP4A 3B3JA 3P9YA 3KQSA 3U4AA 5IABA 3QITA 3ZHUA 4EHLA 5EZYF 5IC5A 4KAJA 4EENA 3CG0A 4YQYA 3BL5A 3E3NA 1RCUA 2SKEA 5TGTA 1AM4D 2WJJA 2H9YA 4U8GA 3O2QB 2G9QA 4K05A 1U3GA 2I1WA 4TM7A 3AL3A 1Q16A 2ZBGA 1GCAA 3PFGA 3M3DA 3T5MA 1S2DA 4DQUA 2H2AA 1E9VA 3G0DA 1MRSA 1W30A 3QQPA 1Q19A 4P4GA 1QKJA 4TT3A 2H1VA 3LXUX 2FH5B 5DYNA 2BBWA 4A0GA 1BMDA 1K7FB 1QAOA 2DH6A 2DH5A 1K06A 3K9WA 2VRCD 3F1LA 3HL4A 1M1YA 2IODA 2IS1A 1RJEA 2GESA 2BDTA 3CH4B 3YASA 1QU3A 1VE3A 4BIIA 3DP9A 3QQ5A 2VAMA 2JGNA 1T9DA 3VM6A 3K4QA 4K46A 4KPFC 1AB6A 2CK3A 3Q0EA 1ZVMA 1DX6A 2A3NA 1IQPA 4MZDA 1T25A 4YC7A 1CJTC 2AXEA 4C7KA 2P0EA 3WGGA 4DPLA 5JZSA 1NG9A 1UJ5A 3IAXA 3NWPA 1ULZA 4AKSA 3K1AA 5KWJA 3SXPA 2HU5A 3M2TA 4H7IA 4KN5A 4E2WA 3DE7X 2XCIA 4CF3A 1MO4A 5LMNB 1QLWA 1G98A 1SU6A 2HRRA 2J9FA 4UASA 3AIMA 3F7NA 1P1JA 2Q5HA 4X20B 4ZI2A 4M9RA 5I47A 2F59A 1Z17A 1D2HA 2G0AA 3D7LA 3JQ7A 1BA2A 4MUBA 4NWIA 5KTOA 2Z1NA 2HY7A 4PSVA 2VTVA 4DMMA 3DAHA 3M3PA 1ZS9A 2CC2A 5CBPA 2VEDA 3HXOA 2PANA 4MPPA 5IZCA 2BFNA 5D00A 5LZ4A 3LZCA 2OXFA 3CGGA 4LJYA 2ZSJA 1MVOA 1QJ4A 4O4LA 4Y0NA 5BUCA 2ZTSA 5ESDA 3H5TA 4AZ3A 1ZN7A 4L3VA 5JHHB 1BXKA 1O4VA 3MGBA 1R5BA 4D3YA 3H7IA 1J23A 2PJDA 2PO5A 3K1ZA 2O48X 4P7GA 3WSTA 1LBIA 1FNMA 1C30A 2JFVA 3LZDA 3QWBA 4M0MA 2C58A 2VSYA 2XDWA 3JZFA 1TRKA 5IT0A 3A9TA 1DX4A 4XGRA 3GAFA 4H6XA 3S2SA 3TW8A 2BF7A 1JQ5A 1MLDA 2D7CA 4FOSA 3VNUA 3GLIA 4QQKA 2YHIA 4JCCA 1HTWA 1WKBA 3I1JA 4FJ2A 1KETA 2NP7A 5DT9A 3GGCA 5FJIA 4NBWA 3OMLA 1DTEA 1JILA 2I3GA 2V7XA 3OZIA 2E1RA 3EXG2 3NT2A 2BTEA 4X7MA 3FHOA 1ZQ9A 4HWTA 1EG2A 3VUEA 1BE6A 1O57A 2PKQO 3PQ6A 3JSXA 3I4CA 1RQ7A 4G36A 4GC5A 4H1WA 5EJ4A 4EO4A 5KDLA 1XTIA 4B6JA 2I78A 1L4UA 3IQFA 1O6CA 4KODA 5T5QA 4AMGA 4H59A 5GADl 4CKEA 5C1DA 1NBMA 2UZAA 1O7JA 5D8DA 5EWMB 2WIAA 4R1MA 2GD1O 3WJ1A 5EKTA 3DW3X 4GOJA 1MQAA 1GFWA 3QH4A 4MKRA 4L8LA 1KXJA 3TQTA 5EJ6A 4X1IA 4ZV7A 5F3WB 5I3CA 1DBWA 4B85A 1DAOA 1E0SA 3DOIA 4NVRA 4ZCIA 3P2KA 4HXYA 1G5TA 1KS9A 3F4LA 3UB4A 1U7WA 1A9XA 2O8CB 1QGYA 1X7GA 4LPSA 5I9IA 4CEJB 5BN4B 5LP6F 1Z2PX 5T64A 5CK5A 2W70A 3Q40A 5FL7D 2RGCA 3SJBA 1DKOA 1XD2A 3CS3A 4M9XA 3D4LA 8ABPA 3H04A 4WKBA 4EFLA 1YB4A 3OLYA 3M6AA 5TPWA 1CZUA 4KE7A 1NM5A 2P2GA 1XZMA 2GPAA 1FFWA 3QKSA 4MITA 2WQ6A 2C7VA 2X1LA 4C89A 3IAM6 2QMHA 3PC2A 2YJ3A 5AVOA 5TB5A 5A9SB 1LLQA 1VP9A 1CR6A 3IQGX 3QXGA 2IYQA 3OX3A 1C50A 1Z56C 4PZZA 4KITB 1JWBB 1YNOA 4RKRA 1T0IA 5EFZA 5CDHA 1B2LA 2AZTA 4J4BA 3UV3A 4C78A 1FA9A 3BF8A 5DEOA 1M6VA 4IUYA 5BUSA 3HCNA 5K3FB 5C7YA 4I1YA 5EERA 4CKWA 1NKSA 1ZL2A 3NUZA 4DJTA 4FE4A 4UUMA 2FZ5A 2YXPX 1OE0A 1XTBA 2B83A 2VTEA 3EXIA 3P0RA 1B14A 2PXCA 1V7PC 2GAOA 3D5TA 4GDMA 4PAOA 1LRLA 2PO7A 3BMCA 4MR7A 3PGMA 4RZ3A 1L5LA 1GFSA 5FBRB 2Z2IA 4EJMA 3KXKA 4DCJA 3SJUA 1FK8A 5KMGB 1O87A 3BOSA 3Q85A 1DC6A 1J6UA 3GAMA 4CG3A 3CZQA 5JYDA 1UFQA 3NHZA 3N8HA 2EIHA 4YP1A 4ZTZB 3E0XA 2XYRA 2HCBA 3O3OB 1NYTA 1N0WA 2X40A 3O91A 1AJEA 4AO6A 2CE7A 4NC9A 5I01A 3CYFA 4J76A 4YAIA 1NR5A 1I2AA 5FR1A 1I0ZA 4MP8A 4N01A 4D4GA 1AK1A 2ZVDA 2IPAB 4OJKA 1A2BA 5HQ3B 3RVLA 3ZGLA 5L6MB 5EMHA 1SOWA 3KZOA 1INLA 1II8A 3OIUA 1RS0A 1YCHA 1JB9A 3K0FB 1TVKA 3ZLBA 1B6RA 1XHLA 5CB4A 4UUQA 2H1CA 3H86A 3D6AA 1KL7A 1RKUA 4KNVA 1YCDA 3Q3EA 3RC2A 2CV2A 1G9TA 2XMRA 5DYIA 1PL7A 2QQ5A 5KWEA 1AB5A 3H9BA 2JGDA 3AXSA 1DCMA 3GRUA 1H0RA 5IBPA 1KI9A 4V03A 4BQSA 4ZIRA 4ZO4A 4YCLA 3OCXA 4F4IA 3AW8A 4CMEA 4ZI7B 4C4AA 9MHTA 5A9RA 2EIXA 4ZGWA 1Q5PA 2PTHA 4NYMQ 1CB7A 4TS9A 4YQFA 1CY1A 3BGOS 1KJYA 5PNTA 4Z4EA 4RKFA 1ZM4A 4GSKA 2ZB7A 2GVDC 3ILVA 3KVNA 4PNEA 4DLBA 1J8QA 3LP6A 4O63O 1H05A 1L1QA 1L3CA 3MT8A 5LD2B 2EFGA 2ZRGA 3IAUA 4FEAA 4M8NE 4YJFA 3PTAA 3AERA 5EEHA 4KK3A 4BNUA 5L9AA 4OAPA 1IXSB 5B1DA 1GAJA 1G6HA 3AHGA 1MJNA 1SCQA 3I2YX 4JNCA 1ONSA 1N8TA 4KXLA 4OGLA 1HDZA 1M6HA 3HCBA 3UV7A 4H1UA 3A9RA 3DF9A 4PAWA 2REQB 1RMTA 4Z4IA 5A0VA 1NG1A 1P0IA 3CCFA 4A0QA 1PG0A 2ALJA 3NQ41 1QYVA 3MJFA 3M0EA 2YY7A 4OYHA 3OZUA 4E5NA 4HAWA 4PF1A 2NNLD 1F2UB 4OJQA 4YRQA 2YYAA 3ZHCA 1P74A 2IYWA 1ZOSA 2AF3C 1E3JA 3EE6A 3L8ZA 4YCBA 1W88B 1CUSA 1H69A 2O6HA 3WTCA 5K0ZA 3WL7A 3KS9A 5K05A 1J20A 5DO9A 1ZK1A 1LZKA 2CWWA 3F49S 1CY6A 1OZHA 4FS8A 3VJKA 1MC5A 4IVRA 1ZL0A 2HR1A 4HKTA 3V2HA 2A0UA 2HUNA 3S7ZA 2RC6A 2O6LA 4W82A 3TMAA 3BH7A 2O1EA 2P9TA 4Q1FA 4CF5A 3FR7A 3DFKA 3IJRA 2BUAA 2HMYB 2Q6KA 3A06A 5DVZA 2OL4A 4LV8B 2QN8A 4EHJA 4ZO9A 5FL3A 2GRUA 1ESMA 2DU8A 3DP7A 1N2SA 4ALIA 1A9RA 4NYIQ 4CYMA 4XIGS 4GI7A 5A0TA 3LVFO 1PZHA 4N6NA 3CO5A 3PD1A 2PUFA 3DVLA 1GARA 3ENKA 2NO5A 4PZUA 5KAPA 1PUJA 5IKMA 4NJEB 1GP2A 1DQSA 4JI6B 4PG4A 3ZW8A 2ZYVX 1M72A 3EVDA 5DKFA 5FUXA 3ZJ4A 5JEEA 3QX7A 5TX7A 3RI3A 4XCXA 4HH0A 1EK1A 5A3JA 3P9KA 1MJHA 4RHCA 1CUDA 1LLDA 3D6UA 2ZWOA 3LQRA 4L8YA 4YDRA 5IANA 1QANA 2D6FA 1BKYA 1TJYA 4XIYA 4MEJA 1U63A 2P79A 1T4GA 4UFNA 2JC3A 3BWDD 2Z6AA 3SSAA 1GVNB 3GUUA 4IDQA 3MSCA 4C7XA 1FL9A 2O20A 3OIYA 3BGVA 3A1TA 2C20A 3QF4A 3WGQA 2FFRA 2VH2A 1H6CA 1BFDA 2YV3A 2OB2A 3PQDA 1N25A 1O95C 4CEHA 1LVHA 1WAMA 3HKCA 2JFHA 3BB1A 3NX4A 1GA6A 1HSZA 2Y1WA 3UGQA 4ZOBA 4D46A 4Q82A 4HBGA 4UNPA 1T9AA 4JR2A 3EZ6A 4M7PA 4D9EA 1QX4A 2H52A 2XLCA 3F6BX 2JDIA 2ZAOA 2C83A 4LRSB 4N39A 3OD1A 1B0PA 4K6OA 3FGNA 2C03A 5J5AA 1GV0A 2SECE 3CR7A 4NBTA 4P83A 4R8KA 3CLSC 4Z51A 2DWCA 3PEWA 2D2VA 2E4XA 3GL9A 4ALMA 1V96A 1ZAKA 4WKCA 4GBMA 4YAFA 4LQLA 3HWWA 3MNFA 4BKOA 1M54A 1NJ1A 5EP1A 1YZHA 2CDCA 4OREX 2B4TO 1HX7A 4R68A 2CVOA 2WD7A 2O7SA 4YUWA 1JFVA 1CR4A 4E5KA 1B8NA 4WXMA 4FNAA 4PZEA 5IJAA 4JUDX 3HO6A 3S2ZA 1SBHA 2BM1A 4R5MA 4XVHA 3GLTA 4P2GA 2WJWA 1TZ2A 4BU1A 3VDMA 1H23A 1HH4A 4MKHA 1AH2A 1Y7LA 2C3PA 5CRIA 3RK0A 3KQQA 2I7XA 2J3JA 3IUSA 3QYPA 1T2FA 4MWTA 1UPCA 2FTKE 4GI2A 5IAEA 1JTFA 4M1WA 2IKSA 1X14A 1XJ0A 5JQGF 1QHXA 4GZ6A 3UUGA 1T0BA 1G4AE 5AI4A 2XW6A 3CZMA 1DO2A 1P0PA 3CUKA 4BV3A 2BDEA 4IQ4A 3DGEC 2FPIA 2M6LA 4B7UA 4BS9A 1AO0A 1YGPA 4WMLA 3VH1A 2AI2A 4CT5A 2R8OA 2XODA 5BORA 1YOVB 4R7TA 5H3CA 2BMWA 4AJIA 2Z09A 1QYCA 3QTTA 1A5ZA 5B1SA 4UJ5A 4CL2A 1B7GO 2PX2A 1P45A 1NF9A 3B6ZA 3DV0A 3AJAA 3GT3A 3ACCA 3ACBA 4J7CA 1AZTA 1RZ3A 2CNDA 4W4TA 2R751 2A86A 1V8OA 4M0CA 2O2YA 3A04A 5T8KC 1Y9AA 2JFWA 3ORRA 3FUUA 4JFRA 1E1MA 3PEEA 4ZMBA 1NW5A 1XLTA 1ZD5A 4P7BA 3AETB 4H7KA 4GMFA 4LXUA 1K7CA 3FOBA 2BVNA 1JXAA 1PJLA 1S2LA 3CMCO 3LGSA 1C3OA 3ETJA 3JQGA 3EN0A 5E6RB 4DWJA 1GN9A 5JECA 4WOCA 2X0JA 3IEKA 5FKJA 2FE4A 1SZCA 3NNNA 1Z37A 2ZR9A 2BMAA 4TV8F 3FHTA 6ABPA 3F8TA 4PWYA 4ZOLF 1XZJA 1TCAA 4MWOA 3LQ2A 2ZREA 2CL6X 4ZCPA 3A05A 1NKVA 2JFUA 3GHHA 2CLIB 1R27A 3FJOA 1GZVA 3VC2A 4RHTA 4EB6B 1RAGA 1REQA 1XZAA 4NPHA 3TSWA 1OVGA 4XAQA 3N6VA 5IVDA 3MWLA 5SY4A 2QMZA 4MIEA 3A28A 4ZU3A 3LUJA 4N7JA 5C5EA 1R50A 3JZAA 4RZSA 5BSUA 2FPGA 1FX0B 2W90A 1M10A 1JIIA 4G81A 4TQGA 4WFKA 5FOXA 4YQZA 2H08A 3DEYX 1RKQA 4BQOA 2EFJA 3CRNA 1WNFA 4EJFA 1E1LA 3L02A 4Y2XA 3JQCA 3R3YA 4LI0A 1DC4A 3DEHA 2GPBA 1Z7WA 4C6TA 1P3DA 4R2MA 1U8XX 2DQSA 3GPIA 2HEGA 4NOLA 3ELYA 3SK0A 4I6JA 4F8JA 2ERCA 3P4YA 4CHTA 3EEYA 4UULA 3BK7A 4L9AA 3CWZA 2CLEB 5KOJA 2HD4A 1PG5A 3PWZA 5CPFA 5DHUA 3PXBA 2TMGA 1E79D 4RGBA 5BUZA 4NF2A 3AV0B 4FXOA 4HG2A 3Q3IA 3WOVA 5CXUA 3O7MA 1O0SA 4JQZA 1WO8A 3HCFA 4O5OA 4B40A 2JZCA 3PICA 1XRMA 1T5BA 2QSUA 4BMSA 2CYAA 2J87A 1E6LA 1NBEA 2GLXA 3F5FA 2YWBA 1NT4A 2XB6A 2FN4A 2OT3B 1MORA 1J0XO 2H92A 2UVPB 2A9OA 4UXIA 1USIA 2HJGA 3BILA 4CBVA 3OCVA 2OZPA 3WGVA 5L95A 2EKBA 1L9XA 4RA6A 1WHTA 4WJZA 1WJGA 5G1NA 4KKVA 1NUTA 4MWCA 4BGDA 1PZEA 1JHZA 2V6MA 5FD8A 5K01A 3LW7A 3S4YA 3BREA 4X91A 5EWJB 3GK3A 3NC4A 4LPKA 4MVYA 5T4EA 4J0IA 4M8IA 1YTLA 1WQ3A 2NO1A 1XCBA 2X4GA 2X0RA 4DIFA 1L4FA 4OL0A 2YRWA 1SC4A 1S6YA 2H2HA 4LZWA 2DUWA 1CFZA 1FDTA 1O8BA 3FTCA 4BASA 1WQ4A 2W4IA 4OGFA 2XYGA 1QHSA 2MMGA 4Q4JA 2O8FB 2NUPB 2RGRA 3FSGA 1A7UA 2H2GA 3MQ4A 4PPGA 2QB5A 4EW3A 3H5RA 4KHZA 5KSYA 1J0DA 1OIVA 3DD1A 3IEIA 4XIFA 2XOEA 4V3BA 4V0QA 4BP9A 5FQNA 3SF8A 1YVRA 2GD2A 1H9CA 1Z0FA 1QLJA 3H9JA 3ILYA 4NMLA 4Y2HA 4DR1B 3C7KA 2QN3A 3EMKA 4I1RA 2ONJA 2HSZA 1DIHA 2VOJA 5CA1B 3RS9A 3SQXA 3LBNA 3HUTA 1XMSA 4E1BA 4MWBA 4JBWA 5IARA 5DWDA 3E3AA 4BVEA 3U61B 3CBGA 3W5AA 3OY2A 4XX0A 2C5BA 1Q1BA 2WTBA 4IX1A 5C8XA 5EJ8A 5KTRA 3G02A 3ZVKA 2Y1KA 2W2QA 4TWBA 1UM9B 2O07A 4QM7A 3PQEA 1NJ6A 4JI0B 3G0CA 2NO4A 3NANA 1PF7E 1PW5A 4WGFA 5HP4A 5CITA 3OEWA 1QS0B 2VAPA 3AR3A 1EFPB 3QXHA 1B0UA 4TT8A 4X65B 3ZVNA 2AUMA 3I72A 2HO5A 1EINA 2IX9A 5DGTA 3TFWA 4LF7B 1Z34A 2VPTA 4XM1A 1JQJC 3N7TA 4RV9A 3AJ9A 1NUHA 1EFKA 5FNVB 4DMKA 3T1HB 3WKBA 3U2QA 3HJNA 3NWJA 4KACA 4NCJA 3UJ8A 5IZCC 1FUEA 5J4YA 1NTOA 3ZVMA 2HHHB 5KYKA 4JYBA 4YMIA 2O1WA 3DHYA 3E2IA 1QHYA 4EM6A 5FEMA 1NU6A 1HLGA 4ACAA 2ASEA 2ZIEA 4U0KA 3AWIA 6REQA 5HF9A 3NEPX 1ZNZA 1Y9EA 2BIFA 5KOYA 3L7MA 1S1CA 2PGJA 3L0PA 1EQAA 3LYLA 4D9JA 2F64A 1JEQB 1AOXA 1XTKA 3G0GA 4L4YA 4KDRA 4OHVA 1N3BA 4PFQA 4DC1A 1UQTA 4Q18A 2HMUA 3TSZA 1EUZA 3H2BA 1ISMA 4Z7JA 3G5MA 1Z0AA 4K7JA 2W2TA 1DV2A 1EFUA 4TYQA 1HEIA 4PLFA 5IWCA 1UC8A 4BN4A 3T5PA 4GL4A 3L84A 4EX6A 5JPCA 3I01M 2X2EA 2WWXA 5JS8A 1HDOA 4EPXA 4Q39A 5ALNA 5LUAA 1UC5B 1VHJA 3K9LA 1JSRA 1T3ZA 4GO1A 2WPDD 4P7FA 3ZHBA 5K4HA 2Q62A 4EF5A 3PGLA 4YN3A 4U7PB 3RE1A 3NKLA 3RGWS 4RCVA 2WT8A 1IY1A 5GJWC 4P92A 3CTMA 5CH3A 1QVWA 1PSZA 4H15A 3ETGA 1KIFA 3E53A 4YJHA 1PS9A 1XDBA 3D6FA 5D87A 4LSMA 5COQA 5G3ZA 4Z2AA 1AUVA 2BGJA 4CTJA 4M83A 1VKNA 2VI5A 4E46A 2BFFA 5KYNA 1E0AA 2VKQA 3OTIA 3LDHA 1NOKA 4G5SA 5JXHA 1QONA 4BMNA 3TSCA 4QUKA 5G0TA 3TLEA 3K9HA 2RGBA 4UW9A 5DI3B 5I3ZA 1WMSA 2EF1A 1XUOA 3T0FA 3QX9A 2ECOA 2WB4A 5KTKA 1N92A 2OK7A 3WWZA 2BD0A 4ITUA 1ZCAA 4D8VA 2C2ZA 1Q14A 1GRCA 4BO4A 1IWOA 1YK1A 4BLTA 2A84A 4BGIA 4HSEA 1U7XA 3S8MA 2Z2YA 4I0WB 2ZZMA 1SCKA 2CFTA 3FI0A 4J0HA 1N7JA 4GP7A 1F0KA 2AXNA 1EBBA 3RR2A 3KZ1E 4Z2YA 1W5TA 5I7FA 3GP8A 4AKIA 4DRXB 2FB9A 2BKAA 4O29A 1SKYB 2CDRA 3GDWA 1Q12A 4LDRA 3C3BA 1WMBA 2Z8ZA 4Y1FA 4DYVA 4ZTBA 4HGNA 1AMNA 1FRFS 1T2VA 1BXZA 3E05A 3TOZA 2EL9A 5IS2A 2V7QD 1UP4A 4ROSA 3IPRA 4EPTA 1ZMOA 3W8RA 3K35A 5EMMA 5IN4A 5THQA 2C4MA 3N6RA 3DVAA 3I8SA 3KOXA 3ZD9A 2EW1A 4B8YA 2V5UA 5I5EA 1JIQA 1WMAA 4OCZA 1YFLA 1AC5A 3UICA 4N41A 3WKDA 1OXVA 2EZ4A 1K5GA 3GN1A 4JBHA 1YE3A 1BS1A 1EVZA 1FYDA 2JJ8A 2B3DA 4FYHA 1RXIA 3UH1A 1WP4A 2G0TA 3E9MA 4M36A 1OTHA 1OBCA 4ER5A 4AIRA 1H0KA 4G0VA 2GNPA 1KDVA 3WAGA 2REBA 2I2BA 2DLNA 4WZ6A 2JARA 1ZUD1 1I5OA 4XFKA 5HTKA 4ARSA 1TM2A 4TVOA 5AH0A 3TW0A 2FZWA 5G40A 1C4KA 3F8SA 4WFQA 4ALLA 4HH3C 5CB0A 3EWNA 3WWCA 1BD4A 2J3QA 3FVWA 5AUQA 1P5ZB 1YH3A 1XHEA 4NMMA 4Q3OA 4QU0A 3REFA 2PMWB 4XWTA 1TDJA 1LX6A 2H48A 3HKBB 3VU1A 1TMGE 2VFAA 2X42A 1Z4KA 4DDUA 3EEOA 5F9MA 4NICA 4TX1A 3GP5A 3KE9A 4GU5A 4N8DA 1VMEA 3Q7PA 4OGGA 1BWRA 3BSWA 3HRHA 1RDFA 4RPJA 4Q00A 2GM9A 4J6EA 4JYMA 3RUEA 1OGYA 2D0DA 2EJBA 3QUCA 4GVLA 3CPJB 2WDZA 4X66B 2XCOA 5ITZB 1U0TA 1GO2A 2X1VA 3IT1A 3FYHA 1QGED 3OU2A 4HCJA 4AX8A 1U8CB 2WIBA 2QRJA 5ITWA 1FDWA 3IAFA 5E4YA 3CPEA 3W78A 1DRJA 4CMEC 2WJGA 4UU7A 1U2SA 3CZ5A 1U90A 3PQ4A 4RAOA 4CCYB 4DZTA 1XV5A 2FUG1 1PEAA 1E2NA 3WRWA 1O6FA 2WYVA 2CYCA 2AQKA 2ZATA 5IFLA 1Z2AA 2FPOA 4OMFG 4KRGA 2I1LA 4EG7A 2XOKD 4MJLA 3F3YA 3ZE9A 4DMRA 4BO6A 5B57C 2QMEA 4JGGA 3WGJA 1ZXLA 3T5CA 2FK8A 2FRVA 3HPRA 4GX5A 4PRLA 3FGOA 4S2UA 1U4OA 3IMKA 1Y6RA 4U7WA 2FPSA 1N2CE 1OAOA 1C8VB 4CV3A 5H4GA 4YT4A 4IWYA 3CFYA 3IDOA 3PITA 1Z0DA 3MTIA 4I6GA 3IBFA 3KO8A 5ALDA 4G0YA 4NXNB 2ZYDA 2HZBA 4D9MA 5D6NA 2VH1A 3P20A 1ENOA 3LT4A 3SPXA 3AVQA 1JKJA 1AUXA 3NNDA 1KBZA 4FOLA 4NU0A 2XZOA 1NDHA 4BMXA 1ZD8A 1J25A 1JG3A 3I0MA 5EMJA 4IWXA 2IDKA 3RWBA 3L8CA 4BJ6A 4Q24A 3RUHA 3U4QB 1TQ6A 3BS4A 3IPCA 4PYMA 3A70A 1TVEA 3UHJA 4PYOA 1FBTA 4DA0A 4E5YA 1U8ZA 3L1HA 4ECAA 5MN4A 3IE1A 1OB5A 1ZM9A 3ESZA 2XTNA 4DW8A 2ZROA 2J3KA 4UJ3A 3OQNA 1XEFA 1XO1A 1ZCZA 1M1UA 2AE1A 2QRQA 1PLKA 3W2IA 5IXJA 4V3CA 2HHCA 2C4TA 1Y8RA 2HCJB 4JT4A 4FC7A 1L1FA 1PTJC 2ZDGA 3KZCA 1HNNA 3LUPA 3H2GA 3LLSA 2N0SA 2YIMA 1HORA 1GL3A 3OLCX 2XYPA 2IDJA 2B5OA 3E18A 3IQWA 5CM9C 2QL7A 3D02A 4QHSA 3UMBA 1PV4A 2ZCVA 4MQ6A 4PO9A 3LA6A 4NAHA 1O95D 1Y6QA 1L7XA 2I87A 3ENQA 4LJ9A 1WB5A 2FETA 3JYHA 4TTIA 4URWR 2RIPA 3GEGA 2WQ7A 1C14A 3EUEA 1V11B 1U6KA 3I76A 4W8GA 3MBOA 2UKDA 4F46A 4U0JA 4EO9A 1U7TA 2NUAA 4I55A 3HA3A 1UK8A 2PSFA 5A04A 2NP6A 4ZO7A 3ZD8A 5LVAA 2J48A 1EFAA 1QNFA 1KY5A 5BV7A 5BT8A 2ZJ5A 4O4JB 4TQAA 3W4KA 3CLSD 4CLXA 1KYWA 2QN2A 3RH0A 5KNDD 2QOEA 3BMNB 3FZNA 2UUOA 2H1WA 4RTKA 5AIBA 3E23A 1H2HA 5AM1A 4CG0A 2I1VB 4QDUA 1H66A 4YO8A 2NU6B 3ZCTA 4CKYA 1JEYB 3KSAC 4Z3KA 1ZW6A 2QROA 1P6UA 4K9KA 4RS4A 3THOA 1XCLA 2PTGA 4FW8A 2BP7A 1E2IA 7ADHA 4W7HA 3OO1A 2WV7A 3K5WA 2JIPA 1NUSA 2PMEA 3ABZA 1QC5B 2ZR0A 1NQTA 4OQZA 4TMTA 3FA2A 5EFOA 3I42A 1K5DA 2EP7A 4ZP1A 4JVLA 3S2FA 1EXMA 1HI9A 5AK5A 2UYQA 4GUDA 2AK3A 1J8FA 3KPJA 4RS3A 1NVBA 1XPUA 1SKUA 3PHJA 3A9UA 4MEAA 4X60A 1GCOA 3L7IA 5AJUA 4E2ZA 4ES6A 4RM2A 4AURA 2YJ4A 4QPJC 5KHOC 4MTLA 1TJNA 1V1RA 4OXIA 1G7RA 4C4RA 4D81A 3DC2A 1C7RA 2FF7A 2G9UA 1A7KA 4C4PA 3F67A 2ZSFA 3HDJA 1GNSA 5FBLB 1BVHA 5JSZB 1Z2EA 2OHOA 3BTOA 3VOAA 2GZRA 4Q15A 1YV9A 1EDDA 1UBTS 4N5NA 3SLKA 2ZJOA 4LE2A 1T8SA 7ABPA 2IU4A 3NKVA 3QKTA 2WD9A 3NIDB 5P8WA 3O5AA 4I4TB 3L4EA 4ZOQI 3SKXA 1XQVA 2ZBPA 2EWMA 2M32A 2CN1A 4FFWA 4BEBA 1OLXA 1QDLB 2J45A 2ZOSA 1Z15A 2A4MA 1U0NA 1KEPA 1XXHA 3E7FA 3KB6A 3K9QO 1G60A 1WA5A 4HFRA 1FFXA 4K88A 4MP6A 3LL7A 4UHDA 3D5EA 4QASA 4JI3B 2I4NA 1HTTA 4UCQA 3QFFA 5CIWA 3VX4A 1YBVA 5H8WA 4EY4A 4S0XA 4WX2B 4DT1B 3VJRA 3RASA 3H2KA 4OXQA 4MSUA 3UK1A 4BWVA 1Y5MA 1V1MA 1PFVA 2A35A 1S7GA 1S01A 2XSZD 3EBLA 3MS2A 4HEA1 4YMWA 5LQRA 2ZS9A 4TMXA 1T26A 5GV8A 3ZIUA 1YZLA 4OHFA 4IXTA 4YRMA 3GOQA 5K9ZA 4KL8S 2XDAA 3WRVA 1HKHA 4WAUA 3TWOA 2O8BB 1X13A 3LLVA 3CT4A 3R5KA 1XYYA 3ZU2A 2A9JA 1IULA 1QTNA 1XLTC 2HMSA 3K6RA 4JQSA 4ZU6X 3WYBA 3KE8A 2OZLA 2FZVA 3LY9A 3X2FA 2OGWA 2C29D 2ONCA 1F8XA 4ZZIA 4MQFB 2PLRA 2WZBA 4PRYA 3D2BA 3AL0C 2BMFA 3H4TA 4HDSB 1D2EA 3QYFA 1Y9DA 4LFCB 1LPSA 4FFVA 1FUYB 3KVOA 1GHTA 3T3IA 1IQUA 2EBWA 2PSHA 2WHYA 1OXBB 4NHOA 3B5EA 4S12A 3IAEA 3GGGA 4CN9A 2Y4OA 1XRQA 3OLZA 3OMWA 2NTJA 4F4FA 3CVYA 4ZHQA 1WF6A 2OCIA 4ZQEA 1PJ4A 1HM5A 5EIXA 4JLSA 1YI0A 3A1UA 4BUCA 1MF7A 1IAQA 1A97A 5HIKA 3K2QA 3DQZA 3G85A 3LP8A 4MGKR 3V4SA 2ZT6A 2HMAA 5IAOA 2ZJ2A 3BPSA 4PO8A 2X8BA 3SHVA 3R3ZA 4CIDA 4GP9A 2H17A 2QU7A 3M6IA 1A7AA 3KVRA 4ILKA 2R2AA 2PNFA 4JOBA 5HKBA 1SKYE 3AI2A 3V32A 2KM1A 1DBRA 1TYDE 3GDOA 3R3XA 4IDNA 2ZWAA 4JI4B 4KB5A 1XRPA 2YICA 2RHDA 3CM0A 3VSDA 3GRFA 1O0BA 3K9CA 1SZPA 4O2AB 1YL7A 2XEDA 1QE0A 2AG5A 1Q11A 4QG7A 4BKMA 3KUXA 1J7KA 1BU8A 2ZRFA 3NBQA 4PS0A 2PGAA 3ZZNA 3H3JA 4LQDA 2PN1A 4GPIB 1JPNA 3IDAA 2ZBDA 4MUGA 4BBZA 4AUMA 2ZRLA 2A58A 2J6IA 3VR6A 4RH3A 1ODTC 3IVGA 2BPOA 1QH9A 2H0AA 1NASA 3CE6A 5I7OA 1VHWA 1QIIA 3DKRA 3LC1O 3ZHRA 3UGJA 3HDGA 4DNPA 1VA5A 3S68A 5DFAA 4XX1A 1YBAA 3IRVA 3B8HA 2BGMA 3V46A 2XZLA 4PXSA 3D4PA 1Y6JA 4YUYA 2I4MA 2D1SA 5H1YA 1CIVA 1SU8A 2ZG6A 5JVDB 4RZUA 2WJPA 4I5FA 2NO0A 4X6XA 4KFUA 3JQ8A 4R1TA 2X0EA 4BNGA 2GEFA 1W5AA 1S8OA 1AHNA 1OA1A 3BXFA 2CHUA 2QUHA 1P9NA 3JWPA 3KNZA 4G89A 3E5NA 4N7MA 4PLGA 4OMCA 5F23A 2BR5A 2WLTA 1YUNA 2NGRA 1WKCA 4HUQA 4QRHA 5IVIA 3HN6A 2AR9A 3K0BA 2GEBA 3CJRA 4WN9B 1KERA 5CT9A 4HNGA 5E3IA 3ROEA 4BBAA 4EQ6B 1L5HA 5C4MA 2ZE7A 3T6KA 4WK6A 3UT0A 3O2JA 4MK4A 3I52A 3S0JA 1FLVA 3UYLA 3DFIA 3OHSX 4PLZA 3VOBA 2JFYA 3LKBA 3KALA 5AXDA 4H7PA 1FU4A 4CJXA 1EQUA 4I3GA 1PWEA 1AUPA 3VKHA 3SDZA 3WSWA 3QU2A 4KR6A 1MX5A 1XVUA 2OHIA 3I9LA 5E1MA 3T9CA 1RXEA 5E2IA 4CUKA 2CFCA 1ZA2A 1TJ5A 1YB7A 1F14A 3ANMA 2FE1A 2P9CA 4Q4HA 4RKYA 4Z99A 4UTNA 1CR2A 2AVNA 2IXGA 4OMDA 1TUBB 2KB0A 4QUIA 4B79A 4F56A 1GN8A 2PZEA 3U7EB 3TW4A 1JIKA 3H4MA 2WU0A 1Z08A 1LVUA 4FCCA 4X92A 4Y6GB 3WAKA 1Y37A 2R6CA 2ZJ3A 5ECGC 1JQDA 4PYNA 3GN2A 5IJWA 4AS1A 2RH9B 3SNKA 1G7CA 5BN3B 1KHHA 2EV9A 2YHUA 3K6SA 1AQ6A 4KLAA 2V55B 4YASA 4EJ0A 5A9TA 1GLGA 1CZRA 1RKXA 3E1GA 1QHNA 4V24A 2MYNA 2ZU6A 4R84A 5CX1A 4BVFA 1A5AB 2WVJA 3REGA 3C6BA 3S44A 1PWYE 3OQMA 1NN3A 5LWQA 2FW1A 5C5CA 1DOZA 1GGMA 2CJWB 5CXQA 1PGNA 2FMUA 3BORA 2FEOA 5KCMA 3CUSA 4FWTA 4FOOA 2PUCA 1H4VB 4DIOA 4ND7A 3WIBA 4DR3B 5HRAA 3E84A 1TA0A 1GL7A 3VYRB 5CFQA 2LBPA 1T6NA 3NJRA 4NE2A 5BWNA 2JL1A 4TMZA 1E61A 4QPDA 3EVNA 2JIBA 1EGQA 3RTBA 1UK7A 3V8MA 4G41A 2H4YA 2KX7A 1RFLA 4KPUA 1ISHA 3BEDA 3ETLA 4FHDA 2ZJFA 1RCTE 4NZZA 1RRGA 4P84A 5ED0A 3HUDA 3ROMA 2ZE6A 2XCLA 2RONA 3OZ7A 3WBKA 1J33A 1QRRA 4M87A 2QJFA 3GYBA 1PJAA 3DE4X 5J43A 4OXKA 3E8MA 1IN6A 1W85B 2ZITA 1EQ2A 2MSWA 4DMGA 3OJOA 4NLLA 5JALA 2P65A 3PTZA 4M60A 4CR8A 1PNQA 1PO7A 4TXHA 1LI7A 3R76A 3WMXA 3BRQA 4MKXA 1XKXA 4PRZA 3PHGA 4HT3B 3RABA 1DHRA 1KGSA 3IDZA 1TB4A 4RU1A 3HPQA 1NAIA 3KTFA 2A5JA 1ULHA 1NVDA 5FTMA 1OFVA 4XGIA 3MJEA 1IIRA 3B7GA 5CDGA 1K6EA 3DFFA 1ABEA 4AY6A 2UYYA 1B8OA 3ES9A 4CDGA 1Z0SA 1R9MA 1NONA 4YJDA 5JBIA 2I3ZA 4V2UA 4B2LA 1IZZA 3JYQA 3FPJA 5C3MA 2W2LA 2Y71A 3N59A 4H0FA 2Q46A 1HXHA 3KOUA 3AFNA 1C0KA 4J07A 4MR8B 4AZ3B 1GG8A 3RS8A 3A1FA 3MHPA 4Y6OA 3SG0A 3CTPA 4TL8A 1BCRA 5G4KA 3U3ZA 3BSFA 3H87A 4EA7A 1FYFA 2VXOA 1URPA 2OZVA 2B35A 2J9XB 3P9SA 4D56A 1U7ZA 1YD7A 3VUFA 4IF6A 5FLEX 1I51A 1MCZA 2BJVA 5EMNA 5AXCA 3WA6A 1R8SA 1WW8A 4BNNA 2FPWA 2X14A 4G97A 4Y9TA 3TW8B 5IDWA 1MJGA 3NGXA 4UVDA 1SRQA 2EQBA 3GLIB 2QRVA 2EKLA 1ZWKA 5CLFA 3TEMA 2QM0A 2RFLA 5AHXA 2OBYA 5CHYA 4HDKB 4TLCA 4L15A 1YR3A 3M49A 1GZ3A 3KJIA 5DSXA 2X6TA 4W1SA 3CUTA 1KYQA 2CUNA 1ZHHA 4QPZA 3D3EA 4ZDWA 4XGKA 3GGPA 1P17A 1TM5E 1X1AA 1XKQA 2F1HA 4LV6A 4UMFA 3VPFA 1QTQA 1BQ4A 1BXRA 1PIWA 2R6ZA 4Q7EA 2HBQA 4LNUA 2RHBA 5FULA 1HE5A 4LUCA 5HJ2A 4AJJA 3LYAA 2WMOB 4BZWA 1T3SA 2R4TA 5J47A 1NVKA 2I4OA 4UTPA 1PG2A 4YPVA 2QX8A 3J7TA 2PPVA 4WERA 3FAKA 1EUQA 3RBZA 2ZTUA 3H1PA 3RREA 1A82A 3B9QA 1Y42X 3T5TA 2HSWA 5KTMA 2UZ4A 4Z9BA 1SH7A 1KSGA 1WZEA 2WVHA 1QIFA 4PYKA 4B0PA 2BZ1A 4RIHA 3S55A 3ZE8A 2XADA 4G9GA 4N5MA 2DAPA 3RUIA 1HMYA 3CW2A 3OQ6A 1SMKA 5ICCA 5JOQA 2NV2B 3R3WA 3ICOA 4QVKA 1YQUA 1Z18A 5F4ZA 3KAKA 3QIVA 4NECA 3OZTA 4AMYA 2BI4A 3ROFA 3GT7A 2P40A 5GJVC 2HXGA 2WUDA 3AUUA 1BKSB 4MV6A 2E89A 5DTEA 5TPWB 2LKCA 3H8SA 4F5EA 1H2AS 1OZGA 3G82C 3TE6A 3L4BA 2ZGVA 3EH2A 2ZPTX 3U7JA 3L9XA 3V9PA 3E5RA 1VQ1A 2V7PA 1N0UA 4IVPA 1F8GA 4D6PA 4ZVRA 1GPNA 1OXMA 2HPAA 2CHGA 3MB8A 1UBNA 4L0CA 4CKWB 1B3BA 5JS2A 1Q95A 3FFBA 3G2OA 4MS4A 4G4IA 2YQZA 2BFBA 3ZDXB 4DDWA 1FW6A 4JL6A 2FN8A 5MHTA 2J7KA 1KAQA 3TLXA 3QV1A 3K92A 1QGUB 1T5TA 1B23P 2HDOA 1XEXA 3UGTA 4CLEA 2FN7A 4N8EA 4LCEA 1P2TA 4RJLA 3V4OA 1PJCA 5EIAA 2D0IA 4FJ0A 5LYYA 4Q7MB 5JSQA 3ZHOA 4OYYA 5I7WA 5JCJA 3LY5A 1Y89A 1C1DA 1DKLA 2DUMA 3Q3JB 3DZIA 1AGYA 4NYJR 4PSCA 3UPDA 3EXHA 3G6WA 4BEJA 3E9QA 4KR9A 2PWYA 4UTXA 3VO2A 1R8QA 3VHLB 2W6IA 2FXIA 4RXUA 1KE1A 4MWZA 1TQ8A 1JJAA 3FYUC 2JGAA 3LVRE 3NG1A 4HTFA 2JK1A 1N5RA 2NUTB 3Q3VA 4K9RA 2X6QA 4V0NA 4MAMA 1KH3A 1QIHA 1J5PA 4FYYA 4EA8A 5K8CA 3SBEA 4CCWA 1DADA 1E9FA 4ENPA 3IXMA 5JYBA 1UXHA 1NI4A 2V03A 1V4VA 4QGAA 1RCFA 4K8OA 1R4MA 1IJFA 1V3UA 1ACMA 1PJ2A 1WOYA 4FYWA 4B35A 2W42A 2C5EA 1ADJA 3V6MA 4IIEA 3AIKA 4RHYA 1G8MA 2GM5A 4MGIR 4OQFA 3ABSB 4FDVA 4IUDS 5SY6A 4TZ6A 1NQVA 2PX6A 5ALGA 2UZIR 1S02A 2C5GA 2L42A 1DMRA 1RHMA 1RM4A 2GN0A 3FBWA 3P97A 3W2EA 1M7BA 4JU9A 2JFPA 2ETXA 3NUGA 4BWYA 1A2OA 4C6RA 1G0NA 1T1JA 3GZJA 5BP7A 2VK8A 2WJVA 3R0QA 1YAHA 2XCRB 1T9GR 3CC8A 1EDBA 5K0LA 1DIRA 1BFUA 2NVUB 4DEVA 2BEWB 2NSYA 3NBAA 4NSNA 3V8QA 4AB1A 4UDNA 4UEKA 1QB8A 5HF8A 3QXCA 3L04A 3HTXA 4C0KA 2EQAA 3URMA 5H0IA 3AERB 4GMXA 5D1NA 2XRMA 2DERA 3LUDA 1QQBA 3Q1KA 1WZ2A 5EPUA 2IWHA 1YKFA 3RVQA 3WWOA 4J4HA 4CIYA 4J7XA 3V2IA 5I7VA 1H3FA 3OQVA 4IHJB 3D6NB 1L4YA 4CVNA 4E0BA 3AB7A 1T36B 3NHRA 3Q7TA 5HW0A 4Y2QA 2GKSA 3HP7A 1PZXA 1WD5A 4YRKA 3LUBA 2WUWE 3EXAA 3VA7A 5KOJB 1PGQA 1S3SA 1UBUS 1Z83A 1TM1E 2RHMA 2EZ8A 3N8KA 3PDUA 4GXTA 3BQNB 2L69A 3H65A 2YIVX 3X2EA 3ZLUA 1Q0LA 3IOEA 3OPXA 4KV9A 1I1NA 3PT9A 4NEHB 2WJ4A 5BQPA 1N2GA 5DTIA 4YT8A 2JLUA 3FWHA 1PFQA 3JYNA 4WNIA 5JXIA 3COVA 4S1OA 3TKLA 4JLBA 4DR5B 2PBRA 3OE4A 4PPQA 4F3YA 1E5LA 2O3RA 1N6IA 1DQPA 3HB1A 4B3MB 1ODFA 5GIOE 1SPBS 2EG5A 4Z0HO 3WK6A 1B42A 3EXEA 3QLUA 4IGIA 5CW2A 4D3XA 3MWGA 4DEYA 1ZIDA 3JWJA 2EHJA 3CRMA 2I6TA 2A33A 3KP1A 3SCZA 3OZCA 2G8NA 2UVQA 2BKLA 2Z5GA 2EDAA 4U5QA 2KPOA 3CUWA 3WB9A 3C24A 4Q1EA 1QG0A 4MUHA 5CLHA 5MF6A 1R18A 4A0HA 3KLPX 3SGLA 2YOGA 4E5DA 3I45A 2YCBA 2O5CA 1WXQA 4FNOA 4UATA 1QQTA 4RMHA 4HB4A 1R7RA 2F1IA 1IK6A 3W04A 4A92A 2VJYA 3H5NA 1XJQA 2W2MA 1PKXA 4Q37A 4D8UA 4QZVA 1FQOA 3CWQA 4K40A 4B4WA 1HFKA 3IMCA 3TLAA 1DO0A 1G6Q1 1M6WA 4IKOA 3OOWA 3F46A 3GDFA 4PAQA 2WIJA 2W22A 3EPLA 3UM9A 4WNAB 1DINA 2C7OA 3CJQA 2PRJA 3LKDA 3OM8A 5IM5A 2GKOA 1E2EA 1XG5A 2R5NA 3EQ8A 3KAJA 3EGCA 3W7AA 3B6IA 2BFDB 3UMJA 3Q15C 4BX3A 3FOZA 5EKUA 1GTG1 4FB5A 1A9QA 3CLTD 2NYAA 1U0RA 4CEHB 4G56A 3D81A 1MB2A 5CK4A 3ZN2A 4PG7A 4KXNA 3UJHA 2DTXA 1UQRA 1V0JA 4ZDJA 4ZZ1A 3SC3A 5BSGA 5FBVB 2C5FA 3A9CA 3CR8A 1US8A 3PG5A 3UCFA 1QPBA 1TM3E 3OZDA 2BBOA 1MO3A 2IYNA 2WYOA 1FRNA 2JCVA 1WD7A 2WWIA 4XD7A 1S2IA 5TARA 4A8JA 4HL6A 5BWOA 1D1SA 3K0CA 3GDHA 3GGOA 1LTKA 4HWPA 2FWNA 3CKLA 4A6PA 3TLYA 3CLHA 2E49A 2F6RA 4M4SA 3ZE6A 4B44A 1JKFA 3HK2A 4H16A 5KKCA 3UJPA 1NW3A 4FM9A 2RI6A 1CLEA 2AQHA 3R3UA 4QRDA 1YZTA 2YWXA 4BUZA 1FYEA 1UXIA 1M73E 3NDBB 2ZDHA 1GY8A 3U3RA 3VYTB 4F72A 2OKCA 3ANSA 3HVKA 4LYJA 3ZNQA 1UBJS 3LLMA 4TTAA 3QGMA 2HBZA 1EJ2A 3OTHA 1DC7A 3RWMB 4BL5A 3OP4A 4KDFA 4AAYA 2ZE5A 1C1XB 3MJRA 5CVUA 1R4AA 5DMXA 3V55A 5A0FA 4A16A 2WZDA 3G9UA 4KKXB 3FCCA 3R09A 1WXWA 3ELUA 1JFFB 3DE0X 5ALSA 5TQ2A 5I7UA 3FI9A 2W6MA 2J32A 2IIVA 5CA1F 3JQRA 3SHOA 2D00A 5B3JA 4YBRA 3KPWA 1PR4A 3SQLA 3FDFA 2QG6A 3OZSA 4HFNA 4WL0A 3I04A 2J09A 3V2GA 5AVQA 1WCXA 2J3MA 2J0EA 1ZUHA 2V4MA 4FK8A 4DCMA 1S4MA 2BGIA 2WHQA 3DDSA 5LQNA 5ALPA 1OASA 1IUOA 1B8VA 1GTMA 1OFIA 2FEWB 3WLFA 1Q0HA 2Y1XA 4XTCS 4HV4A 5AW1A 1P9LA 1GPAA 3U7QA 2RI0A 4AFNA 5F3DA 3K8QA 4JL5A 3JQAB 5JO0A 2X2PA 4N6OA </