1KRXA

Solution structure of beryllofluoride-activated ntrc receiver domain: model structures incorporating active site contacts
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Solution Structure of the Beryllofluoride-Activated NtrC Receiver Domain
pubmed doi rcsb
molecule keywords NITROGEN REGULATION PROTEIN NR(I)
molecule tags Signaling protein
source organism Salmonella typhimurium
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1krxA00
3HDVA 4JP1A 4S05A 2E4XA 1DRJA 3G85A 4JA2A 4Q6WA 4RK0A 2F8SA 1ZAYA 4XASA 1MVOA 1RZRD 4MR9A 1DZ3A 2O20A 4L85A 2B4AA 2E4UA 3OLVA 2GI4A 1FSPA 2ID9A 2LUOA 3D8UA 4MS1A 2A9OA 3T38A 4XARA 3LKVA 4YLEA 2PLNA 1PHRA 2QV0A 2RGYA 4D6XA 3M6MD 2MYNA 1DCKA 1MIHA 4MYRA 4RKQA 3CFYA 2GKGA 4WT7A 4IMJB 3O1HB 5T7BA 2PUBA 3H6HA 3QLTA 3DGEC 3DGFC 3QEKA 2RJOA 1QKKA 1A04A 4LDAA 5B3JA 3SG0A 3TD9A 4MAAA 1M2FA 3HVRA 1RPJA 3KLNA 3LUDA 2QVCA 1A0OA 3HUTA 3LUCA 4EVSA 4HYEA 1U2PA 2WY2D 3HM9A 1S8NA 3BRSA 5TPZD 2R25B 2PUEA 4TMYA 1BDJA 3HS3A 4KV7A 5HQJA 5CNMA 2QW1A 1GCGA 1NXPA 2CD7A 3JS5A 2FVYA 3QX9A 3RVMA 3GV0A 5KQPA 4IRXA 2P9HA 3I5AA 3OM0A 3NNDA 2V0NA 5KQLA 2QXYA 2FQYA 1URPA 2QZJA 1D2AA 3Q15C 5IUKC 2J48A 3DLHA 1D5WA 2FN9A 1QO0D 4Q6BA 5BQ3A 3RVJA 3GYBA 3KYJB 3LTEA 3EQZA 1NXTA 1Z2DA 3HUUA 4G0XA 5IBQA 1JDPA 1ZVVA 4RK7A 3QEMB 1VRVA 3MF4A 4NCBA 1EWVA 5BR1A 4M88A 1Y1LA 1ZDMA 3OMWA 2NT3A 3CTPA 3IDOA 4RK6A 5TPWA 2VK2A 1K66A 1JYEA 4RK5A 2JVJA 3F7NA 1USKA 4NCAA 1U0SY 3M9XA 2AYXA 3GBPA 3CHYA 4Z9AA 3SNKA 4QPJC 1P8AA 1K68A 1ZN2A 3HDGA 4KPYA 1SXIA 2JBAB 1MB3A 1JX6A 3GT7A 3I45A 5FWYA 1VLZA 1MB0A 3MIZA 3NHMA 3JY6A 1E6LA 2FQWA 4WXMA 1ZESA 2FSPA 3N0RA 4JOQA 4LDZA 4MR9B 2JRLA 1XHEA 2E4YA 2H0AA 5D2CA 4ETNA 2M98A 1EAYA 2R4QA 5JNRA 4O1HA 2NZVG 4O5AA 3Q7TA 3O1IC 4YO7A 5TQ0A 4MS1B 2JVKA 2MYPA 3OQNA 4RK4A 1SXHA 4OTZA 1GLGA 1KRWA 5KQGA 4EYOA 2FEWB 5C5CA 3HEBA 2LIVA 3C3KA 2VUIB 2IPAB 2QR3A 3O21A 1TM2A 3SAJA 1SRRA 2L17A 1D4ZA 3Q7SA 3RVOA 5JS2A 2AYZA 3RQIA 1C0EA 1ABFA 3A10A 3OLZA 3H5WA 4G0YA 2HPHA 3O2QB 4RDCA 5TQJA 3TMYA 4N03A 1NXVA 4MQEA 3GBVA 1NXXA 3URMA 3FFXA 4MS3A 1ABEA 4MGEA 5CNJA 3OQMA 1W25A 1ZGGA 5IUNC 1JBEA 1M5TA 2JK1A 3O2JA 2IPLA 2GBPA 4CBVA 2H3HA 2WWVD 1D1PA 4YRZA 4DN6A 3EGCA 2KYRA 3F6PA 2FEKA 4N0PA 2PUDA 2QSJA 4QYMA 1GUDA 4RXTA 3T95A 4EY3A 1XWWA 3DLBA 3DZDA 4XXHA 1RXEA 3E3MA 4HNQA 4KRFA 3LUFA 4IMIB 4KQCA 1KMIY 2HQOA 5E3JA 4LX8A 3EULA 4RU1A 4RY0A 3TO5A 5KQMA 1YS6A 3OO0A 3HZHA 4RKRA 1EWKA 2BGGA 3HJFA 4MQFA 4MR7A 4EUKA 3OQOA 4KNYA 9ABPA 4D74A 2PL1A 2IKSA 2MYTA 3QLVA 1QQBA 2I6FA 2X7XA 3LUGA 2P4UA 4JB0A 4EGSA 5TPWB 1Z17A 4RV5A 3DBIA 1SXGA 1ZY2A 3LUKA 2M1ZA 4W5TA 2A9PA 2OENG 4YV7A 4PEVA 4ZJPA 3KLOA 3GWGA 3H5IA 4G0OA 4XLTA 5IX8A 1EWTA 2A9QA 3LUAA 4OG2A 1U04A 2QU7A 5FBHA 5TPZA 3EDCA 2NUBA 4ZPJA 1TJYA 2JVIA 1OXKB 2R47A 3A0RB 4HNSA 1ISRA 4P98A 3K4HA 4RK1A 5FWYB 3UUGA 1J56A 3JVIA 2E4VA 4N47A 1PNTA 1Z12A 3KHTA 4LE0A 2L2QA 2F8TA 4RY8A 3O75A 3RH0A 1U8TA 1APBA 1PUXA 1LBIA 1DBPA 1QO0A 5TQ0B 4JB2A 3P9YA 1DBQA 3G1WA 5FWXA 5GOTA 3EQ2A 3N0XA 1NXWA 1T34A 4RWEA 1JFSA 2CWDA 4G0QA 3L49A 3C3MA 1CEYA 5HM6A 1QQAA 2DRIA 5IEBA 2IOYA 2IPNA 1GCAA 4TLMB 1TLFA 4MQEB 4ML3A 3CG4A 4W5NA 5CHYA 4MS3B 1IIBA 1YTUA 4G0MA 3HO1A 2IDMA 4KZKA 5EWJA 4FB4A 2FQXA 3H1EA 4G97A 1CHNA 4MR8A 2TMYA 1OXBB 5IULC 1H9CA 4H3KB 3H5LA 4ETIA 3LOPA 2WJAA 3N6VA 4Q7EA 4WZZA 3RVSA 3T6KA 1F4VA 2FMFA 3KS9A 1DJMA 1JL3A 1YIOA 4Z4GA 3NNNA 1JDNA 3RVKA 4G0PA 4P1ZA 4YS6A 3CS3A 1E6MA 3H5OA 4NV3A 2WMYA 2FXIA 2FN8A 2E4WA 4D6YA 2FEPA 1LJLA 3JVDA 2HQRA 3C3WA 1DC7A 1AB6A 1FFSA 1I3CA 2ZAYA 3NHZA 4QYWA 3TB6A 5IEJA 3RVRA 1CYEA 4MQFB 4OATA 5DLEA 3EJWA 3M9WA 2FW0A 4F11A 3HXMA 1YVUA 3KSMA 2PMCA 4UHJA 5T3YA 4JAVC 4UHKA 3BREA 4YP9A 1LJUA 1BDIA 2L18A 3GA5A 1ZHHA 3OM1A 4IGAA 4KQ9A 1QMPA 4OBBA 3ROTA 4RS3A 4F8JA 4Z9BA 2MYUA 2FMHA 1UDRA 1PNRA 1YMVA 3QK7A 3SY8A 4F3TA 5TQ2A 1FFGA 3HCWA 1Z16A 5CNIA 5ABPA 2FLKA 3FFWA 3HSYA 3BBLA 1Z26A 1DRKA 4WXEA 1HEYA 1JFTA 4RSMA 1PEAA 4MLCA 4ZMSA 2FKAA 3CZCA 3MA0A 5EWLA 3CNBA 4FE7A 2ID7A 1L5YA 3KTOA 3NNSA 3ILYA 2PUAA 5FWXB 3E61A 2PUFA 3LMKA 2CHFA 4W5OA 4PYRA 4ETMA 4RXUA 3VNAA 2MSWA 1JYFA 3MYYA 3MM4A 3KG2A 4B09A 2PUGA 1GUBA 1F51E 3IPAA 5DCLA 1ZGZA 2LPMA 3EODA 1WETA 4YGXB 1P6UA 3FFTA 3KJXA 1JF8A 3C97A 1YMUA 2YHAA 3QLUC 3N0WA 1DCMA 1AB5A 5FBKA 3FGZA 3S99A 2JB9A 4EYQA 3UKJA 3MQ4A 5EWJB 1YK1A 4FE4A 4KK3A 3JPYA 4Z4FA 2FTKE 3BRQA 1YS7A 3A0UA 2E4ZA 4W5QA 5JNVA 4MRMA 4MR8B 1QP7A 2PKXA 2HSGA 4H3HB 2GWRA 4N76A 1QNLA 5BRJA 1NTRA 3VNBA 3K9CA 4EVQA 5HKOA 5DKFA 1Z18A 4JASB 2JCGA 3LKBA 3GRCA 5B3JC 2JBAA 1BDHA 1ZH4A 3CRNA 1R8JA 2HQBA 3OLXA 2PAFA 5JNTA 1KRXA 3QELA 4NICA 3RVLA 5KI6A 3SM9A 3IP5A 3LUHA 4H60A 1QP0A 3HK2A 3O74A 1ZH2A 1B00A 4RXMA 2WRZA 1JHZA 4DQDA 1FQWA 2N9UA 5BRAA 3N53A 2PE5A 3MMNA 4KREA 5I4CA 4RZSA 4L4UA 1NATA 1ISSA 1DBWA 1QPZA 3IP6A 1P2FA 3H5TA 3H5VA 3OMXA 4DADA 4IF4A 1DP4A 3W9SA 5HSGA 3KYIB 1Z15A 5TQ2B 3A3KA 5EWMA 5JNSA 1JFVA 1RNLA 3IP9A 4KVFA 4YR7A 3T8YA 5GQSA 4G0ZA 4HNRA 4WWHA 1EFAA 3IP7A 2ZWMA 1Z2EA 5EWLB 4KMRA 1C4WA 4Z4CA 5PNTA 2RJNA 3CU5A 4Z99A 3UK0A 4EYKA 4YCSA 4N41A 1P6QA 2HJ9A 4GPAA 1M2EA 2FMKA 1TMYA 5IUJC 8ABPA 4NQRA 1LBHA 1TVMA 4MS4A 2YHBA 1M5UA 3CZ5A 3EAFA 4IILA 4LZLA 3NBMA 3LUJA 1RXIA 3H6GA 2QVGA 2FMIA 5F64A 2R48A 1KGSA 2VYCA 3JPWA 1NXOA 3ILHA 3QX8A 4PZ0A 2MSKA 4MR7B 5ED4A 4Z4EA 3OO1A 2PJUA 2LP4Y 4MPTA 4MRMB 3GL9A 3RVNA 4WUTA 3RVPA 1MAVA 2LBPA 4LRQA 3CKMA 1EHCA 3F6CA 3OLYA 3Q7RA 4LE2A 3N75A 2W42A 1E6KA 1XHFA 4PICA 2PUCA 1JWLA 1U2QA 1DCFA 4LE1A 5IC5A 1SD5A 1BAPA 2OQRA 5JNUA 2NZUG 3ROFA 1PEYA 4W5RA 4OLAA 2PL9A 3B2NA 3O1JC 4F06A 1DC8A 3QELB 4O1IA 1A2OA 4YWHA 3FDFA 5KWSA 4Z4IA 4RY9A 1W9HA 4F12A 4S04A 1NY5A 5KC9A 3RVQA 3I09A 4EVRA 1YK0A 3IPCA 5DGCA 3H1FA 4Y9TA 3JTEA 1Z25A 4Z0NA 1L5ZA 3R0JA 4KFCA 2NT4A 5JS1A 4E7PA 1JH9A 1NXSA 2CHEA 4E7OA 4Z4HA 3FMVA 3D02A 2VUHB 1FFWA 3I42A 1VPWA 4KK4A 3N8IA 1BVHA 4PE5B 3OLWA 1BA2A 3KKEA 3Q9SA 4QICA 1JLKA 3H75A 4N0QA 1VKRA 1DG9A 1Z13A 3H1GA 4XAQA 5EWMB 3F73A 1ZITA 4XFKA 5JNWA 3O2SB 3HV2A 2GX6A 3QEMA 3SQNA 5CNKA 3QLVC 1USIA 2WJWA 3C6QA 6ABPA 5KC8A 3BILA 2L19A 1LK0A 2IPMA 4TN5A 5TE9A 4EYGA 4ZYLA 2RDMA 2Q5CA 7ABPA 6CHYA 3KCNA 2A9RA 1RZRA 5DTEA 3L6UA 2B1JA 1USGA 2IYNA 3LFTA 5C5EA 1QP4A 4MS4B 4G86A 4MLDA 3Q41A 3TX6A 3CLKA 4ZMRA 2MSLA 1D1QA 4GNRA 2XDYA 2WB4A 3QLUA 1E2BA 3CG0A 4OLBA 4TLLB 2FLWA
chains in the Genus database with same CATH superfamily
2WIAA 4Y1EA 4EL5A 3WC4A 5AVZA 2P5TB 1V6AA 1C30B 2DHCA 5JWRA 1E0DA 1EE1A 3QITA 3GLIA 3FWNA 4RHFA 1SZPA 5U4XA 4O8ZA 4RAQA 4EUEA 1YJBA 3S1AB 5JJKA 1X7XB 4ME6A 3D7KA 3K4PA 5KYGA 4MI3A 5D7NA 4I55B 4PZZA 2OG1A 3VPHA 1PV4A 1QG4A 3AUAA 1GQOA 2XGMA 1YT5A 1X1SA 4FU0A 2YZNA 4MYRA 4MQMA 4HUTA 4TQ9A 2ODPA 1G59A 3QUCA 1MH1A 3O1HB 4IMJB 2X6QA 3RC3A 2EIHA 1QCYA 1Y1SA 4BV3A 4JELA 2YZKA 3K0SA 4JDUA 5ICEA 4ADSG 5JHGB 1GPUA 1JA0A 2RJOA 3F97A 3SF8B 1M2VB 5AI5A 3U4AA 1ZIXA 3MWDA 5JFGA 1L9KA 1JE0A 5AHWA 1XTIA 4EOGA 4BO1A 2RBGA 2PKQO 4HJXA 3K16A 4KTVE 3LWNA 2O3QA 3Q11A 4KLNA 4WL0A 4D99A 3H5AA 5B58T 3EB9A 4B3MB 2WYHA 3CLVA 5HKLA 5CFNA 5SV2A 6AT1A 3CH7A 4JLMA 4KV7A 2G5GX 5IN5A 5AFSA 1QJCA 1OU0A 3H2IA 2AEFA 4KR2A 2H06A 2PZJA 3HKBB 3I9FA 3PQDA 4BO5A 2NTVA 2P9HA 2FHPA 4V02A 3VU9A 1EFRA 3FJYA 5JH7A 2V0GA 2GETA 3ELDA 3H18A 4ZVMA 2PS0A 4P7KA 4E1BA 3I8SA 5MFZA 1F2TA 1PJTA 4NNPA 1J07A 3DLHA 3OTQA 3PP8A 4CL2A 4WN9A 4FDMA 2IYEA 1X0VA 1YU6A 1TT5A 4LOIA 3N74A 3GARA 3TI7A 4G89A 3LTEA 2WV7A 4KAFA 1XCBA 2HRCA 2NZ2A 2XECA 1P7WA 1K89A 4X6XA 5HHTA 2J9ZB 4C14A 4LJYA 1PR9A 4KQXA 1ZDMA 3GG9A 3X1YA 1JIJA 4YROA 4M0EA 2JD1A 5FUXA 1DMSA 3CTPA 1PSZA 1XDBA 2H3EA 1XQVA 4DSTA 3OX1A 2IH5A 3UC5A 1CS4C 1U28C 2OEPA 2Q4RA 4E2XA 3DCIA 1IEQA 1GPYA 3PK0A 3IR5A 1BZYA 1H0HA 1U0JA 4NCAA 2KLBA 3ZLJA 2JCBA 1FK8A 4LC9A 4WCFA 4RD1A 1H3EA 2VWGA 5I9LA 4CM4B 1DAHA 1P8AA 1H8HD 1MZVA 1BG6A 1BH6A 1ZH0A 2PGLA 3N2KB 3QYAA 4I7EA 5FA8A 4ZQFA 5FWYA 1VHJA 2OCPA 3Q5GA 2BELA 3U3JA 4EKDA 3FTDA 1XVAA 4LWQA 1UXHA 1YSCA 2R9VA 3VBCA 4B6GA 1XWIA 1Z8HA 2A9VA 1ZSYA 2ZRFA 4G5YA 4XOUA 3DD5A 4ZEWA 4X6LA 3N2NA 1CKEA 3LHSA 3O1IC 1G20A 2GLUA 1JAXA 5LBTA 3V8VA 1CVLA 1Z7YA 2PANA 1R8QA 1U7ZA 3HEBA 3R5HA 5FB3A 4DF3A 1NSFA 2V55B 4CKBB 3GUUA 3GIWA 4IP0A 2ZRDA 2IZ0A 4YGYA 5J2TF 2B21A 4JJAA 1NL3A 1ST2A 4P3NA 2FP4B 3Q1LA 4BRUA 3URMA 4WZBA 1Y63A 2ZYHA 3FFXA 1M6YA 2WUFA 1UOEA 3DLTA 3WYNA 2GEBA 4RTSA 5LUAA 4RDXA 2Q27A 1JKIA 4NI5A 3CB2A 1X1EA 3DB1A 1I1QB 2JK1A 4JXJA 3O2JA 4W7HA 3OJ0A 4V0RA 2H3HA 3OZFA 4UNSA 1U8YA 2XE4A 2J4DA 3OPQA 4NG4A 2VHXA 4OHCA 2DULA 3F47A 4CI9A 2F8SA 2FPSA 4AT1A 4XGNA 3E05A 3T95A 3W06A 1GZVA 1WW3A 2ZRQA 4EY3A 1N2CA 4BCBA 4XDYA 3N2ZB 1XJCA 1YE3A 4OKNA 3LCUA 5T64A 2QJWA 3BE8A 5D1NA 3IULA 4OIMA 5FULA 1CJSA 1JDVA 3EULA 3ROPA 3UB3A 4R83A 1WWKA 4NPAA 4ZQIA 1N8SA 4YPFA 1YS6A 1RPAA 3OO0A 4UVHA 3EZ7A 3RFVA 3WGZA 4QJ5A 1CF4A 3OQOA 3MS2A 1KP9A 1PG2A 4UZSA 3BMNA 2IS2A 3IIIA 2WJIA 4JLAA 2RHHA 3PNYA 4DV7B 3LU1A 5GTDA 4A91A 5DBEX 2VHUA 3Q6IA 3H11A 4B75A 4B7UA 4MRAA 3HGTA 4HLNA 1W44A 1GPKA 2VCYA 4W5TA 1DKRA 4PEVA 1BFUA 1Q77A 5GMOA 3SSOA 4I4TA 4AYTA 3ES9A 4JVNA 4C2AA 4LJ5A 3PUIA 4QQRA 5T67A 4DA6A 5TPZA 3KXIA 1R5JA 4WXYB 4ZT4A 4B3RB 4GOND 3MSXA 4IZOA 3WP1B 3ENKA 2AI3A 1BJKA 1SOMA 2W2QA 3FUXA 1EKXA 2JLCA 3NB0A 1NMXA 4M36A 4OHBA 5AK5A 4EHJA 2X2OA 3SIXA 4QO8A 4MV4A 4CIBA 2SKCA 1Z12A 3DFUA 4FJ1A 5KSPA 1D9ZA 1ODSA 4WOKA 2NZJA 2XT6A 3UBMA 2REQB 1KEZA 2WTBA 4ESEA 3HY6A 1NW7A 2BZGA 2PQ0A 2XF8A 9ATCA 1EEXB 4MTLA 1QJ4A 1T15A 4NJOA 1TE2A 1V7QA 1P17A 3JSAA 3V42A 3IAAA 4MUJA 2VNIA 3V7UA 1XJQA 1VB5A 2C42A 2GQ0A 5CDUA 3JAWB 3EOZA 3F5SA 3OETA 5H83A 5L51A 4A1FA 5BWNA 5IH7A 2PSJA 2SNIE 3NJ8A 2PH1A 2D0DA 4DNPA 1M1YE 3AI3A 1P61B 1TLFA 3HB7A 3PXUA 4KVAA 4EHDA 1PNQA 2VNAA 5BQ5A 4MVJA 3A9UA 2C9ZA 2VJBA 1EZ4A 1M0TA 5I9TA 4U7TB 1IN4A 3I9KA 1H5UA 1BVUA 5LYJF 2SKDA 1JAHA 5JVDA 4JWTA 1LNQA 5AKHA 2V1XA 5TDHA 4CI0B 4KR6A 1IM8A 5IMSA 1BDMA 5BSEA 1E0AA 4QEDA 3DAGA 2E5FA 3IT0A 3WL7A 2ETVA 1M33A 5ULLA 1CJCA 3W4IA 3PGMA 3B53X 4DV2B 4UUQA 1C3VA 3DBRB 4WJLA 5IAOA 1M2KA 1QM5A 3EHDA 2WMYA 3IQDB 2D0OB 4Q0MA 621PA 4QNMA 1LJLA 4UCXA 2DTEA 1CR0A 3KOZA 3TB6A 4FB5A 4QEZA 1EFKA 4EI7A 4I8IA 4FFBA 2I87A 1CEQA 4HWSA 1EGQA 1YOVB 2B34A 4CLXA 2ZBQA 1Y3DE 1Y33E 2C82A 1PEDA 2F3PA 2ZYAA 2OD2A 3LC0A 2P5UA 4IIDA 4M8LA 2B8WA 4JGIA 1U28A 1E6WA 3AJEA 3FPEA 3CH5A 3ROTA 3QWAA 6REQA 3DVRX 3EVTA 3FMPB 1GRCA 4GLOA 5HW0A 1N5DA 2F62A 2G3YA 1QGUB 2E48A 4A36A 1P2SA 4B17A 1HF3A 1W2GA 2BFNA 2OCIA 1YDFA 3EH1A 5HFNA 1I3LA 4MAMA 1KO5A 3CX3A 3RAGA 1NI3A 3GJ3A 1OFIA 1X80A 3ZV5A 5B1YA 1XRMA 2JZCA 3IMEA 1T2CA 2BEJA 4KQHA 2PUVA 5KYKA 2W8ZA 2D8MA 2C2HA 4BX9A 1AE1A 4N3CA 3RLFA 1GU1A 2PX5A 3D6AA 1MX1A 1LTQA 3I52A 3KTOA 3LVBA 4ND3A 5DXJA 2JC3A 3TD2A 2Y1CA 4FFLA 5KKNB 3RT1A 4CTKA 4AJNA 2W2KB 1A71A 5BV0A 3W9YA 1MNAA 1YJ5A 2RHBA 2QUZA 2ZUVA 2GZ1A 3KCQA 3GFQA 4JLWA 1E3QA 4AF8A 5AW9A 3NT2A 1YCFA 3ZXUB 5LQJA 3R7SA 2XTJA 4CCSA 3ETDA 1N5LA 2Z2ZA 3MJDA 4NE9A 4CQJA 5D84A 1J33A 2EKBA 4Q34A 3MG9A 3GUZA 4PANA 3ECAA 3RC2A 5FBKA 3RHTA 1H2RS 3WNVA 4YUXA 1U3VA 4PYNA 2PYZA 3GT3A 1DQRA 1F6DA 2ZBEA 4K26A 1OYOA 1IQ0A 1LBTA 4O4IB 4IZHA 2IHNA 2D5AA 4BS9A 1GGEA 2HSGA 3QH4A 3FX2A 5T8KA 3ZCTA 4MDYA 4YECA 3PRKE 4DLYA 1NYRA 2EHJA 2JJ2A 2VXCA 4L76A 5ALFA 3GLKA 4WOPA 3RARA 3ZVNA 2JFUA 4ZVUA 5A7HA 1N77A 3D7MA 3DS8A 1K7FB 3ICVA 4AW9A 3AX6A 4JS0A 3T7RA 2D3WA 2VQ6A 4C7MA 4D42A 1BDHA 2DAPA 4KYVA 4F3KA 3ZD6A 1BOOA 1TZJA 4LGVA 3FYUB 1N5KA 3TD6A 4NICA 2GBGA 5BQFA 3THYB 1KZHA 4RWZA 1YZLA 1OX4A 3A6FA 4I14A 3GJ8A 3KAKA 4FDAA 4NH0A 4BECA 2O2DA 4ND8A 5K8CA 1TCAA 3S8YA 1GNVA 4ZIRA 4QYSA 3K1TA 1CY0A 2V5UA 2Z56A 3FNQA 1PUJA 3MSCA 3QVGB 1W47A 2O0HA 5REQB 1RJEA 1W0CA 2HDNB 4DLAA 1GTG1 5HUJA 4XWTA 4P6VF 1RYMA 3ZNQA 3E5RA 1I4EB 1KJ8A 1W5AA 1YBMA 4HWGA 1KZ6A 2VEDA 4RVNA 2G5TA 1BE1A 2HBRA 2IHYA 3P9RA 4KQEA 4O59O 3V4LA 1TM4E 1FYEA 4M83A 4ILEA 2ORVA 2VSNA 1I3KA 1TUEA 5K4AA 2PXHA 1DC5A 3PD1A 5CFOA 1NHGA 3NATA 3F96A 1SQGA 1E4YA 1PNVA 4HNRA 2IELA 2Z2YA 4X84A 3D0RA 4N49A 2B5OA 4H0CA 4C3ZA 1GUYA 4DJ5X 1E5DA 1D09A 2VP2A 2HSJA 3ZE9A 1KKUA 4F91B 1I33A 1IAQA 4O29A 4EYKA 3C0KA 1YZ3A 3H4IA 3PKJA 3PX3A 1RLJA 1XFDA 2LR0A 2FDRA 1GNPA 5JAIA 2V58A 4RQBA 3HU1A 5EP1A 4EQZA 2R7AA 2BRUC 1QFXA 1T5TA 4IILA 4L28A 3KZOA 5F78A 3HJRA 1OLSB 1YRBA 2ZGVA 1XB2A 3DYVA 1CJBA 1G64A 2YN2A 4NBSA 2QVGA 3CW2A 2OK7A 4OD0A 2BEWA 4RLSA 1GU7A 2QN7A 4M21A 5TF4A 4IHAA 5EXTA 4PNZA 4B8YA 4D44A 2ZB7A 4HFRA 5FADA 3COWA 3HZRA 2MSKA 2QMUA 4P5EA 4C4PA 2ABWA 1M2OB 1IRIA 4A15A 3FHOA 4K6HA 1JV2B 4GKBA 4PYMA 3WFZA 2XY4A 3MHPA 4LOJA 4QWMA 1YB6A 3ASUA 4Y2TA 3U7QA 4AMYA 3LUPA 2GCOB 2ZT7A 3NP7A 1EWRA 5IBCA 5LN1A 3CNLA 1VE3A 2DPXA 2OCXA 4R9VA 1TVKB 1AK1A 2KS6A 4KWCA 3BXPA 4HNAA 4S1OA 3A9TA 1UK9A 1L7PA 2A0KA 2E49A 3OKCA 2QIOA 5ALMA 3R7LA 3OKPA 4CF4A 1HO3A 1C7RA 1X9HA 2RH5A 3NVDA 3O84A 1B16A 3RJZA 4EWLA 2RAUA 4F46A 1A95A 1Q5PA 1RKQA 2GCPA 1NLMA 2QL6A 4MHTA 2XNDD 1DE0A 4FKBA 4YWHA 5AOBA 3NG1A 1EFTA 1W9HA 3QUQA 2R0QC 4UE6A 3KKNA 3UUFA 3X3HA 4NMWA 1S2IA 2O7NA 4DDVA 3KQNA 2FYTA 2HMAA 2QMHA 3MWJA 4QDKA 1TKCA 1VKHA 1T1RA 3FCCA 5BYJA 3V5NA 5IT4A 2AOUB 5ALGA 3N07A 4FX2A 3I6YA 8GPBA 2ZSUA 2ZG6A 3VM6A 4G84A 3OZRA 5LPNA 1GG8A 3FNIA 1EDEA 4UCFA 2VZLA 4UBOA 4YWJA 1THZA 5JNLA 2QTWB 1VHLA 3H75A 3MWGA 4PYIA 1DV1A 5LOVB 4CMBA 5EWMB 1V4BA 2R4TA 1ORDA 1W2HA 2YHUA 1TD1A 1ZITA 3KOOA 1RWOA 1S1MA 4GRIA 2QX8A 1OT3A 3B1JA 2ET6A 4PLTA 4A5SA 4B2YA 2FP3A 4D5EA 4XRGA 3CIOA 3ZVMA 3FD8A 3HL4A 1OI2A 3GQVA 2WG2A 821PA 3VGJA 5F73A 2QTHA 1GPMA 4WN3A 1UXJA 2GEFA 4L5BA 4JFAA 5H1YA 3IUJA 1K8QA 1LWNA 4P4NA 1QIMA 3L4SO 3QU7A 4UTVA 4J94A 5KJFA 1Z7BA 2ZW9A 3M89A 3VXKA 1XQ9A 1WSBA 5D6NA 3STXA 5KNBD 4XUGB 2H7VA 2C83A 5ECYA 1ZI9A 4BFLA 2GZAA 4CLRB 5A62A 2FSGA 3L8ZA 2HCJB 1IXKA 3NHAA 3PHCA 4MLDA 3K70B 2X8WA 2MSLA 4PYJA 4QULA 4ALLA 4R98A 4IJMA 1LTHR 3D8TA 1J1ZA 4CFZA 5AESA 4S05A 3G85A 3BUSA 4M7PA 2PJDA 4V2UA 2GTIA 4EITA 5CH8A 2NTNA 1GTZA 1KO7A 4BZZA 3CRVA 1Y6FA 1FSPA 1FNNA 2XLCA 1QGDA 2XCLA 3LXMA 3SBEA 4XVUA 1E2UA 2K5UA 1ZRNA 4ZI5A 3QKUA 4KO4S 3RG2A 2AZXA 3DZCA 1M6WA 1G8PA 2IBTA 1IE3A 3MLBA 3RKSA 1A69A 3VHQA 3ZQUA 2FNAA 2YWBA 4INAA 4EFMA 5T7BA 1R6VA 3QLTA 3FDXA 4AG3A 1L8QA 2R3SA 3PNSA 3DGFC 3CRMA 1PQUA 3PUYA 4B2IA 4B73A 5IK2D 1UM9B 3EVZA 3KWLA 3L2OB 3W3AA 4BMZA 2PXXA 3JVUA 4JUAA 4WCVA 1G1MA 2FA9A 4NCHA 2CXRA 2ZT8A 2QAIA 1GGJA 2ENWA 4G56A 5EE0A 3VI3B 4N5MA 4UFPA 5A5VA 5FX2A 4ZYYA 2RH8A 4M38A 3ERCA 1IDOA 3PSHA 5BSUA 4B3TB 4HAIA 4CF5A 4MB6A 1P7PA 1CUFA 2RGCA 2X8JA 3KB6A 5CNMA 1UJNA 3HJTA 4ENUA 1H2EA 1C3OB 4DA4A 3KT0A 3RVMA 2Z6UA 2O0KA 4R8VA 2JA2A 4MXDA 4E12A 3NNDA 1G8KA 2XBLA 4LHWA 4TXLA 2OHIA 2RHOA 2PX4A 2XLBA 2RJ3A 3KTAB 2WB2A 1TIPA 1YH3A 4UNIA 4DPKA 3THSA 3HMKA 2XMQA 3FRHA 1E4OA 1LLUA 4Q6BA 3V3TA 1PDWA 3NHRA 4MWGA 4UQPA 1UCFA 1F6WA 3OCWA 3F7TA 4MV0A 1HSZA 2PGAA 2W2TA 2QD2A 3TLMA 4GYJA 3W2HA 1H4QA 1FZTA 1NXTA 1Z2DA 2MOKA 1ZVVA 4MWDA 4DJDC 3V4PB 1RLMA 3PGJA 4NCBA 2VT7A 3BSSA 2SICE 1Y1LA 4X24A 5KU1A 2J9GA 4XB2A 3AUTA 3EFEA 3PF9A 1S2MA 2QD1A 3F4BA 2E2WA 5FYQA 3E58A 2R68A 1GQRA 2ZIUB 4XUEA 1GZ5A 1ID1A 1FDUA 2ZPTX 2P78A 1JLMA 1USKA 4CKCA 4RMGA 4F9TA 1G4UR 1NASA 4O02B 4RE6A 4TVOA 2J3IA 2VDUE 5GY7A 3I1IA 4AF7A 3F6RA 2BRUA 2WSYB 3CHYA 5ITWA 1IBRA 1U6IA 2JBHA 2VFAA 3N5KA 2YV2A 5EL0A 4LI0A 4KPYA 1LRLA 2PCJA 1OWPA 4R3WA 4EZIA 1CSEE 2HK7A 1NQAO 1TVCA 1MXHA 5EVJA 4P4UA 1KOLA 5DFAA 3IR7A 4Q4JA 3AHJA 4GNKA 2GDZA 4LDZA 2B37A 1YC2A 4HWPA 1EAYA 4YJ3A 4O1HA 4R2KA 4JB8A 2EWWA 1OFVA 5AM4A 1IAVA 1P0QA 3HCAA 1JQ3A 3Q3EA 3SQDA 4ZN6A 1XZCA 2JBWA 3IV6A 5IDWA 2A30A 4R1QA 1PBNA 1OBCA 1RKBA 2YH2A 4RH3A 1EVIA 3MWFA 4Y9UA 1ZVQA 2BZ0A 1MKYA 3AY7A 4MZDA 4Y9SA 3A9VA 5G0UA 5MF6A 3IHTA 2BZSA 2QR3A 1Q7RA 2VDKB 3ZUGA 4CQLB 4DBVO 3ADDA 1HT1E 4GWLA 3B3QA 3FPGA 1B3RA 2IS1A 4OHOA 1EVZA 1GV1A 1VI5A 2QX4A 3OLZA 1V5EA 3TMYA 3MCVA 1JDSA 1EX9A 2PH7A 1PFGA 3B1VA 3GNSA 4N03A 1GAWA 3W05A 2HU2A 2WJGA 3ETNA 3LH5A 4M1OA 5L4NA 1XD2A 2CB0A 4UEOA 1JR3A 3ZDFA 1Z28A 2N46A 4IIEA 4GRDA 4IXDA 1ND5A 3FI0A 4MARA 4NCJA 3REQA 2I7CA 3QTBA 4CBVA 5K4GA 1YD7A 3QXSA 3RYHB 2YRWA 4Q1DA 4EX6A 4B87A 3TBKA 5GOZA 4H27A 5K0SA 1ZM2A 2EV9A 1OOEA 3G8DA 1N6PA 1XWWA 5TXGA 3D2LA 3E35A 1E3SA 2ZSAA 3VH4A 4UAGA 2XUPA 2OLEA 2H8KA 1XHLA 1IPFA 2XAAA 2YMPA 1ODJA 1ECLA 1HETA 3KKKA 2O07A 3O95A 4P84A 5FOUA 4XCVA 4G5QA 5CLQA 2QLBA 1EDBA 2EAUA 4WCDA 3TO5A 4DE5A 4I9HA 1ORIA 2AWOA 2FW9A 2P7IA 3DMTC 3P0HA 3QJGA 1ZX1A 3QXJA 5EE1A 5K09A 3RADC 2XXAB 5AM0A 1W52X 3KDSE 5DYNA 3TQHA 3M4JA 2JGFA 2P9CA 2YHSA 3V1MA 4BC0A 2C4WA 3R6DA 4N4AA 2FGKA 2ORIA 4FR0A 3O9MA 2QTVB 4GOXA 1ZEJA 2DFLA 3AR2A 2AG0A 4EGSA 4EUFA 5GPBA 2Z1DA 3C24A 2WIFA 3GLSA 4AWBA 2PGJA 2NU6B 3LVRE 1TI7A 5CFRA 4ZU3A 4MW7A 3LUAA 4WBNA 1E60A 4H1HA 4X3PA 1Z5UA 1UBLS 2ZRGA 4LMAA 1FYFA 2FX2A 2NUBA 1PFVA 2FUKA 2I9PA 3FDJA 4MUYA 4OU4A 4CMKA 1HDZA 1JSRA 2BN4A 2FFAA 2PEYA 2Z3ZA 3AK4A 3D8SA 3OJXA 3R0XA 1CD5A 4NYMQ 4RK1A 3TAXA 1O0CA 2VHJA 3HHPA 4I9UA 1EP3B 3RS0A 1QVZA 2IYUA 1PZMA 3EYWA 1SCUB 3D8RA 1DTWB 3ZX4A 4X7MA 4I1SA 1VJRA 4PHFA 1KDYA 3TW4A 1A7JA 2XT0A 3HO8A 3O8OA 4YMIA 2W70A 1JZSA 1FMJA 5HKKA 1A9RA 4ZK6A 2VQ3A 5BORA 4JYAB 1T34A 3HGQA 1LJ8A 3VKWA 1FC0A 2COKA 2RHCA 3DE6X 4WADA 2ACWA 4KFTA 4AZVA 4C1BA 1DQYA 2AQHA 2XUDA 3ZCQA 5LWHA 2NP7A 4WEOA 5BW4A 1QQAA 4ZZIA 2J41A 1WUIS 4JI6B 1E4EB 4TTJA 3TM4A 4PSKA 5DT9A 1S2DA 1NFRA 4CIVA 3FIUA 3K09C 2AUMA 3W5SA 5JQGA 3GD5A 1YTUA 4W5NA 1GCOA 1RJFA 4DSZA 2C03A 4LVNA 3VYTB 3AWIA 4D3YA 5A0VA 1Z0AA 1XXHA 1U7TA 2IYSA 3LDAA 3DEHA 3CF2A 1UQRA 2VSFA 3OZWA 3RU9A 3UFBA 2V7GA 1E2HA 1RQ7A 4OSPA 3PX2A 5HMLA 3UKDA 3PCRB 5IULC 4MCIA 5EG5A 3R23A 5AJTA 5DGTA 1KK1A 4AU1A 4BB0A 1DX4A 4RCYA 5FJJA 2AGVA 4LBYA 2CYAA 4MJ3A 4FOOA 3A4IA 4FOSA 2JHCA 4ZARA 4WXRA 1MD9A 2O7VA 1PZFA 5ERYA 4Z4GA 1ISHA 2YOFA 5B6PA 3KVVA 3C8UA 3UTDA 2BD0A 3C4QA 1SD1A 1O03A 1JEJA 5DXFA 4M9RA 3FTFA 1T5OA 4RIFA 3VHRA 1ZOLA 5JR3A 2W6QA 4MQFB 2JAPA 4TKUA 1Q1NA 1PR5A 4XCXA 1LEHA 1NULA 1QQ5A 2PKQP 3QVXA 1SBHA 2WDPA 1BEEA 4Y9RA 5JATA 1VSVA 1DU4A 3GA5A 4KQ9A 2YQZA 3O93A 4W8GA 2WIDA 3ORQA 3WA6A 1ABBA 2JI9A 5KCMA 2UU9B 1Y6RA 3WYFA 1MC5A 2IEDA 3EXHB 4IGFA 2J85A 4IXWA 4Y7CA 2Y1DA 3WADA 2QN9A 3N6RA 4F6CA 3OHMA 1QV6A 1OIVA 2NUAA 1FTGA 3F5QA 4L75A 4ZU1X 3T52A 3I2JA 1REQB 1PL8A 4WNIA 1QMGA 4P2GA 3SHOA 3VMFA 3BA1A 4B47A 4JYZA 4WXEA 3LZDA 3FPHA 3AR8A 1UC9A 2P75A 4XUDA 4JQSA 4RSMA 5C8YF 4X1KB 1HNZB 1BCSA 2PPVA 1Q0RA 1RYHA 3OCUA 1E99A 1LDNA 1H1LB 4X90A 3BICA 2BHRA 3DONA 3EZLA 3NC0C 2WP8J 3TSOA 3DMRA 1TQ8A 2QRVA 3AEKA 5C37A 3GRZA 4L5CA 4X60A 4P7BA 2QAGC 2BCEA 3E23A 2NAFA 3I6QA 1CTQA 4LHEA 5BW8A 4UM9B 2I4TA 2PUGA 2I3ZA 4GOOD 4CGYA 2QM8A 3AR5A 4XH9B 4BGVA 4OUDB 1I4DD 4EMTA 3QLUC 4FHFA 1L6IA 1T5DX 1LK7A 1F38A 1ZCZA 3EGWA 3MJCA 3V4FA 3BWCA 4AX4A 2BFAA 4ETWA 3VKVA 3KHUA 4LRXA 1UC8A 4GUDA 4XUCA 3ZGLA 2HK9A 1XXHE 4B4KA 2WTEA 3LWZA 1IH8A 3DZHA 4TL7A 4OK3A 1WXWA 1WX1A 2PSFA 5EWJB 4Y2JA 3F5FA 4F7DA 2WQZA 2EBHX 4LCJA 4WLUA 1HZJA 2HXGA 1Z6XA 2YHIB 4KN9S 4LZAA 1GAJA 3ZHBA 4KWTA 1AKTA 2LW7A 2ZXUA 1QRDA 1NTOA 4P3YA 1ULHA 1HR0B 3AUJB 1RLIA 1TGYA 1CQJB 4YV1A 1ZVMA 1W34A 1CB0A 3FYTA 4DIOA 2Y6VA 5EUMA 1UKVY 2B94A 4N3GA 4NX2A 1E8MA 2OC4A 2J67A 4FYWA 4F0JA 3QPCA 2FXVA 1T2FA 1KS9A 3WYDA 1GUFA 1WLYA 4BP1A 2I4LA 2FU5C 2PGIA 4ZHSA 7MDHA 1J70A 1EVKA 4PX3A 3ZVRA 3TSWA 4OJNA 3L43A 4DXDA 4IIJB 3TGPA 4F9FA 1J8DA 4A6EA 1W4RA 5KSZA 2ISQA 4O4LB 3D7SA 4YLGA 2DHRA 1XQ6A 1LSSA 4RPHA 5SY9A 4V03A 1QE5A 4KREA 2WVHA 3IVCA 3QNMA 1QONA 1TYCA 1GILA 2Q5IA 2Q9UA 1NATA 1T91A 1ISSA 1RWWA 2QNIA 3IP6A 1KJ9A 3JZFA 4HLUC 4P2BA 4B46A 5ES3A 2AFHE 2GZDA 4F85A 1PLJA 4KQKA 2HNKA 2P3LA 5GM1A 4BKPA 5BVHB 4HDSA 3L4JA 4G0VA 2WT8A 2XWBF 4EEZA 2A0FA 3PEEA 1CP2A 4P8RA 4PFQA 4TV8A 5B1IA 2AG1A 1SVKA 2OBFA 4H6WA 1ZK2A 4BOYA 5EMJA 5BR7A 4O2BA 1TIBA 2YS6A 2XEDA 2Q1SA 1XZJA 2XE6A 1Z4NA 4G0ZA 4WKOA 4MGIR 1UFRA 3IP7A 4L9SA 3UF0A 1XEXA 5IJAA 5AIBA 1N9GA 1G8JA 1WDLA 5DEIA 3UK0A 4ND6A 1W8IA 5IXYA 4NFYA 3DL4A 4RV9A 1JDUA 2Y0EA 3JW8A 1UPCA 2FMKA 3GZNB 3QFHA 1G0OA 1T2EA 3BE4A 4J2OA 4KXWA 1TUBB 3OZBA 1L1QA 1ZRSA 2YDXA 4MRSA 2BDTA 1KEPA 4EG8A 1J8YF 1SVSA 2P90A 4X8HA 1P2BA 5TGZA 3BHNA 1XZFA 3K1AA 3WGHA 421PA 3ZU3A 1IZ0A 2VDQB 3I04A 2ZWIA 4RFLA 2ZROA 2BGTA 5DOZA 2YY7A 1ACMA 4ZDWA 2J33A 3K09A 1N9ZA 3BEDA 4C30A 4HB0A 4AXBA 4ZCIA 2B2CA 2JFGA 3R7NA 1ZMBA 2D0IA 2MSNA 4UJ3A 3PC2A 5H7XA 4MWSA 3LIIA 3RIGA 4OFXA 2YQ5A 3GFRA 4L57A 4BZWA 3K70D 4K6OA 4UMEA 4JZKA 4JGGA 3SYNA 1J5EB 2GHIA 2VJYA 3RVNA 4RVGA 4A3SA 3PQ7A 1B4DA 1H6DA 3FIJA 4W5WA 2HA4A 3V8MA 3IBFA 5IHXA 1RRCA 1Z8FA 4F6LA 1DJLA 5ALVA 1MFZA 4JKIA 1IFXA 2CDRA 3KQQA 4HQLA 4N8DA 5KJ6A 1NNSA 4LGMA 4NDAA 2DY1A 2P0YA 5KBYA 4TYNA 4AMZA 1LX7A 2BLLA 3VJLA 4B79A 5BN4B 5CYOA 5LQRA 4LYJA 5GVSA 2BBTA 3E3AA 3O1JC 3PFKA 4RD2A 4UFNA 1Y5LA 3TLGB 1DC8A 5H16A 4EA7A 3A32A 3H2JA 4K9DA 2VP4A 5KWSA 2JFPA 3S2ZA 3C87A 3A4TA 3FWKA 5J2UF 3O3MB 1NY5A 3A36A 3AKCA 3BKWA 3SGLA 3IMKA 3I23A 1SBCA 3V8BA 2OBMA 3WK6A 3OQ6A 1T2VA 1G21E 1NQUA 3SKYA 5DM60 1HQCA 3ZNOA 2CHEA 2AUTA 4MVYA 1V8ZA 2JAOA 1WSAA 3AFOA 3CA8A 3LQQA 4E2WA 1R2QA 2FB9A 3K5HA 3KRTA 2Q3CA 1F7UA 3EWAA 3CX4A 2ID4A 1LKZA 4M1TA 3TTUA 4AZ3A 1Q0LA 6GPBA 3EFBA 1JLKA 4QICA 1A72A 1X8KA 4TLCA 3INGA 3WX0A 2ZPUA 1RPNA 3KB2A 4DIFA 3LSTA 2I6QA 1V1RA 2ZETA 3QVJA 4FKMA 4MX8A 5JD6A 5ALYA 1E2IA 2EU8A 3BZUA 4KH1A 3OEYA 3HV2A 3B9BA 1NT2A 1XLTC 2IW1A 2WF9A 4IGIA 3EIOA 3FOFC 9MHTA 3WOVA 3N2GB 5BMVF 4BPBA 4KXUA 1D2HA 1EMDA 4U4AA 3SICE 1GO2A 1UKCA 3FWHA 3UT0A 5AOVA 1AIPA 4I4NA 3FUCA 1QRRA 3PQ3A 3A27A 4ZVSA 1RACA 3G5LA 3W7AA 6CHYA 1PR1A 2Q1TA 1BMTA 1QU2A 4FW9A 2QAGA 5A3VA 4BNDB 2LDBA 4BJ1A 4DV1B 4H59A 2J8ZA 4IINA 3DC2A 3PUXA 2BGNA 3WZMA 1H2WA 4RX1A 2HBYA 1XU7A 1NBMA 3EGDB 3L7LA 1VSQA 2IY9A 2Q6KA 3IJRA 3MTJA 3QLUA 3KPWA 1DOHA 3AYXB 3UUEA 4FFPA 4AI6A 3WHIA 1OU4A 3ESYA 4J4TA 4RK0A 3VO2A 3K31A 1T0IA 2E4UA 4LYEA 1ZHFA 3OLVA 1IXSB 1VZ2A 4BATA 2PBZA 4LF5B 3DE1X 3JSXA 3T38A 3X2FA 5BVGB 1E64A 3Q88A 4YQYA 1O0SA 3GEPA 4YAKA 5FLEX 1LK5A 4UXIA 3Q7QA 2CD9A 1DCKA 4PPNA 4ZEVA 3D59A 3IO3A 3QE9Y 2E18A 1BHO1 3H7AA 4F60A 5L3ZA 3ELYA 1U5AA 1FJHA 1XWFA 2R65A 4M0MA 3EFOA 4R40A 1U1FA 3OTWA 5GZ6A 4CKWB 3FFAA 1RWVA 1EJBA 3BK1A 4Q9LA 4KR0A 4LSMA 1SBQA 2C2WA 3A06A 4D02A 5JW6A 1Y3BE 1GG9A 4OQYA 5H81A 3DW3X 4PO9A 1O89A 2W5UA 4IJKA 4K88A 4LHSA 4U2CA 3IDSA 1VP9A 3AB8A 3ZCPA 4EVSA 2GHQA 1N1EA 3E15A 4HB3A 4Z7JA 5IAGA 3UMBA 1BDJA 5GINE 4IOKA 1TM7E 1I13A 3T7DA 4BX3A 2G17A 4TUYF 1ZJZA 2J0EA 3OEEA 1GLVA 4MLZA 3E9EA 2QT1A 3QEAZ 1NNUA 3SDSA 3U7JA 1GSOA 2O2JA 2IV2X 4HLQB 3QX3A 4HLUA 1ODIA 2HUNA 2QXYA 3P2JA 2OY0A 1URPA 5CPBA 2QZJA 5IUKC 4GAEA 1N8TA 3NX4A 4JJIA 1QO0D 5HDQA 3WZLA 5BQ3A 3A3NA 3GYBA 1AMNA 1ZIYA 3IOBA 3J7TA 3OH8A 4M49A 4OLFA 5DIZA 3BRWD 4P4GA 3VC2A 4EJ6A 1IPHA 4CHGA 1C9NA 1QANA 1PR4A 5FCDA 5EFOA 3QXGA 1R8XA 3FZEA 4OBEA 3RU7A 5TARA 2WM2A 3M3HA 1G38A 1KRHA 2OBLA 1G8FA 1NC3A 4Q7QA 4HYTA 3DHYA 4XD7A 4UQLA 4PLZA 5JAMA 2BEVA 2IZ5A 3IP3A 1MDFA 2GN2A 4RVCA 10MHA 2FF7A 3M1IA 3P0RA 4B35A 3ER8A 1HDEA 4AJKA 3PI6A 3AOGA 1OWOA 3ZBPA 4J7UA 1YR7A 1IQUA 3ZOZA 4BJHB 4XIYA 1P2TA 1SWWA 4CMCA 2GS9A 2Q4EA 2AHOA 4F2PA 4HD8A 4BNWA 1MRNA 2R00C 3FR7A 4DPMA 1QYXA 4PHGA 1X1QA 4F5EA 1P1IA 1DVRA 3ZKWA 1H2HA 2EHDA 4X1IA 5BWMA 1K63A 2FDXA 4MR9B 5I7VA 2RD2A 1BEZA 2R4QA 1PYOA 4YJGA 5IWAB 1TCCA 3GYGA 3DDOA 4HDQB 3X1DA 4RIIA 4QA9A 3ZUPA 4N39A 2BKEA 4ECEA 1KQNA 5CB0A 1K8RA 3RG8A 5KQGA 3PC3A 2DUUA 4YAUA 2X1HA 4IBOA 3C3KA 2WU1A 5EHNA 3A6EA 3TWOA 1A9OA 1WRBA 1RYDA 3BA6A 4HEQA 4J6FA 1P1KA 4MYUA 3SAJA 2DQKA 3R8XA 5AW7A 2L17A 2O2ZA 5HTKA 3RQIA 4B8ZA 2JGRA 1L5GB 5BWBA 2PAAA 3FOBA 2ZULA 4RVSA 1XCPA 3PFGA 3UH1A 3LHDA 3OFNA 2WG1A 4CPDA 3PWZA 3DFZA 1F8XA 2Q28A 1JG7A 4H7HA 4CV1A 2JJ1D 3UWPA 2I9KA 1PF7E 2ZIXA 2BFFB 4FHGA 4I4LA 3C7CB 1CG6A 4QGAA 1FCJA 4YH1A 1FVXA 1UZNA 2VF5X 3G7UA 3ORHA 4G81A 1VMDA 4LISA 5JE8A 5A6SB 5A6SA 5AVSA 1IIRA 2Z83A 4MI1A 2W43A 4G9GA 2E89A 3BEOA 4J6EA 2IH4A 1SWVA 5HBGA 3VR3A 4D4JA 5CA1A 2A67A 2IZ6A 3T5BA 3OZSA 1WZ2A 4OOFA 3AFMA 1H2ZA 1JSXA 1VBKA 2CXSA 3TSYA 2WE8A 5K0GA 2WWHA 4BTEA 1V8FA 2FWIA 1Z7EA 2G4CA 2HIAA 3T9EA 2RHMA 1Z07A 2J3KA 4PAOA 2AN3A 5KOJB 2FCAA 1TZMA 3NRCA 1HNNA 4ZVTA 4Y2UA 3TVYA 1E2PA 1DJNA 1EHYA 4Y6OA 3U56A 3HL0A 5JZSA 2BGGA 2YV1A 1B2RA 1J7KA 4XQ0A 4MR7A 1KFJB 4ZT7A 4EUKA 4NNOA 5C32A 2WWYA 2PL1A 3ETJA 2HIHA 3I37X 3FUTA 4TMKA 2NP6A 4Q7KA 3K96A 2HJVA 2ONKA 1OV4A 3CSDA 1I36A 3MGAA 4MGYR 1WQ3A 2VPZA 3CEJA 1VIMA 1IZZA 2M1ZA 4YV7A 1AHHA 4Y2RA 2ZAGA 4XLTA 1UMBA 1NI4A 5CA0A 1K92A 2JH9A 2HF7A 4CV0A 2CLMB 2V98A 2YV5A 1EQUA 1NZJA 1V16A 1YACA 2JCSA 2R751 4WW0A 2WWTA 3EDCA 4G1EB 1Z68A 3DFMA 4G5HA 1I2BA 1XR3A 1FXWF 4MRNA 5JXJA 4FJ2A 3RUDA 3TJMA 4ZHQB 2OZLA 5IS2A 4TM7A 4D0SA 2VATA 2OP1A 3CE9A 3VC1A 4YRDA 4PZPA 2LNDA 1RHQA 1C1HA 4UOZA 5M7EA 1MVLA 2DC1A 2BFEB 3RBVA 3WSTA 3D4BA 3KXLA 3EZGA 1Y1PA 3NHUA 1U1IA 2Q41A 4RVFA 2FEXA 5GVRA 1C7FA 2DUWA 2IPOA 2JI4A 1N3YA 3OUTA 3T9CA 4EBBA 4DA0A 4ZCTA 5I9MA 1R6XA 3V2IA 5FWXA 1GPNA 4FYHA 4LWPA 2V96A 4F3YA 1E5QA 2IYWA 3GG2A 1GL7A 2PRIA 5CT8A 5G1OA 4BMOB 3WGGA 4ZYXA 4KXNA 2KW5A 1ZGJA 1W4ZA 2ROQA 3AOEA 2G5PA 3ICPA 3NHBA 4IGEA 4PSVA 3PFCA 5KHAA 3RIHA 1I4WA 3WWPA 1L0BA 2VRBA 3MTQA 1XDZA 2AMVA 2HF9A 3PWSA 4R2JA 3IR6A 4JP8A 1JG2A 4QG7A 4KSCA 5KS2A 3QIAA 5JCXA 3VV2A 1ZHOA 2HA6A 5KNBH 1V9CA 4HMPA 4JUDX 4RF5A 4X8MA 2WAYA 3NLLA 3OZXA 1L1EA 4UM9D 4KITB 1JRLA 3LLMA 1PVOA 4NYMR 4BTLA 4CMAA 2MHCA 2FG7C 2J6CA 2E1PA 1SHLA 4D43A 2TMYA 5KDOA 3L1VA 5G0SA 4LJ6A 5J4KA 2HMWA 2X0EA 3N6VA 4P3KA 5F52A 2ZU6A 3DE3X 3MUNA 2ORED 3T5TA 2HSEA 3EEIA 5BNWA 2QM3A 3NNNA 1BD3A 3ZVKA 2I5PO 2NNLD 2A2ZA 1L4UA 2XUZA 3HKDA 1T1GA 1LFAA 1ZGAA 4H0NA 4M98A 4EG4A 1N0UA 1ZD3A 2CLHB 1E6MA 2X6TA 2VUUA 3WLAA 2O06A 2PZFA 4OQ4A 3H5OA 5G41A 1C29B 4NWIA 5KWJA 2E4WA 1GVNB 1EFLA 3QUSA 3M6WA 2JPDA 3TRJA 2V59A 3AUKA 1E1CB 3C3WA 5AHXA 1J0AA 5LQSA 1U8EA 1E3IA 4M1YA 2R6R1 4FGWA 4JL8A 4DS3A 4DW8A 2RHWA 3DVAA 1W1UA 1N2XA 3EZ2A 3HYCA 7REQB 4JXXA 1WXGA 3EOAI 2J7PA 1CE8B 1ZCJA 2FPOA 1ADCA 2FW0A 2XMBA 3UYKA 4EYSA 3DJFA 3HRHA 5AUOB 1WKBA 4UHJA 4K6MA 2HBQA 4LY9A 1T2NA 3UOGA 2XZOA 2FWNA 2HZBA 1NP6A 3QTTA 4DLRA 2WF5A 3OCYA 5KYUB 2FSHA 4B7AA 2QN3A 5GONA 2YZ2A 4ZO7A 2ZJZA 3HMQA 3VVMA 4P86A 2M6KA 5L3RA 4R0MA 1J0BA 3NEPX 4O4JA 3LYLA 4NEHB 3QK7A 4WKBA 3T7TA 1W581 2HK8A 4RJJA 4FMBB 4C22A 2HHLA 2AFIA 3RK4A 2Q9AA 5IHPA 4KIUA 4QFDA 2OCLA 3GCDA 3RSLA 1Q3TA 1SEPA 3AR3A 1VHWA 4MP8A 2JGAA 3AP2A 4JI1B 2R00A 2UVQA 4IV8A 5IPFA 2DWCA 4Q48A 4ZV7A 5ICGA 4BXOA 4CMHA 1G9SA 4A9AA 3PC7A 3MRVA 4TTPA 1PR0A 1V9LA 2UZAA 1ONOA 2O3SA 4JUBA 3B3GA 4BLVA 2GM5A 1BOFA 3QIVA 3FDZA 2DT8A 4RZUA 2PUAA 3CINA 5TB5A 4IYRA 4RF4A 3ZWBA 5KHLB 5FNVB 3B7GA 2RIRA 3B60A 1JYFA 4FEAA 4NABA 1OXSC 3ESBA 4ZV9A 5KNLA 3IQXA 3U40A 4BV9A 4EGAA 1XPRA 1PUIA 2H6EA 3E8SA 4ZQEA 3U48A 4AWAA 1KO4A 1BJTA 2AMFA 5F1PA 3OWXA 2GASA 1NN0A 2H2GA 4H4EA 4KX3A 3G0BA 5CAEA 4CIYA 1XN1A 1SOUA 5CU7A 3M81A 4Z4FA 2QRHA 1X2EA 1DFHA 2VF4X 3JU3A 1KH3A 3A0UA 2RGAA 1QTNA 4CLOA 3WWDA 1DCTA 2D2EA 3ACDA 3D4NA 2BR3A 2H00A 1PD1A 3EIWA 3HR4A 4ROSA 1KL7A 3KB8A 5ARDA 1QH1A 3RFTA 5KTNA 4H3HB 4OQDA 2ZBGA 4HXFB 1BRMA 5IJ0A 2R6CA 1DUVG 1PJLA 1E5LA 3HADA 4YJ2B 5TV2A 1BXGB 1VLJA 3IS3A 3U09A 4AUNA 4QHYA 2HMUA 1I6LA 2ZTLA 1M1UA 1OMOA 2H0RA 1B76A 4PLPA 2DWUA 3CR8A 2D5LA 2CVPA 2FJ0A 1OQAA 2I6SA 2O1EA 3GUCA 3IBTA 3LKBA 2O5RA 1E3JA 4P82A 3V7FA 3WB2A 5KO2A 2FUG6 1D8AA 1C0PA 2O8EB 1A3CA 1TKBA 1VG1A 3A7DA 4MEJA 4MV5A 2QQFA 1EX1A 3RWMB 3SM9A 3A37A 3WMFA 1V35A 5DVZA 1AQ6A 4PBRA 1TZCA 4Y1RB 3U62A 4DTIA 4G5RA 1VZ3A 3GU3A 4EG0A 1ZD9A 2HR1A 3GLFE 3D0KA 4OI4A 3SLGA 3RSHA 1E7WA 2YWHA 2C00A 3PTLA 1SHZA 5FHQA 3X0DA 5FUYA 4Q3AA 3N87A 3R5TA 1ZUWA 1WIWA 3GJ6A 2ADOA 4NU0A 2VT6A 1AGYA 1SQ5A 2OB2A 1DP4A 2PUJA 5HE9A 2FH5B 4E46A 2ALJA 3RODA 3FKSD 4ERNA 2M32A 5KJ1A 521PA 1KSFX 1DFIA 5HA5A 5JNSA 5AVXA 3FOAA 1MAWA 2QXUA 3CPHA 3HXLA 4X00A 3ZXSA 3DMDA 3JWIA 4U1RA 4JIMA 1KI6A 3HBAA 3U4QA 3HC7A 1WS6A 4MRPA 4QLAA 2TMDA 2F1IA 1U02A 2FPIB 3M2TA 3ZHOA 1XL1A 3DOIA 2HGSA 3G2KA 2OK8A 4Z53A 5DCWA 5EJ5A 3U1BA 4H6VA 4QC2A 3QVLA 1ZIDA 4Z99A 3D6JA 1UBSB 3F8SA 3GOQA 5PNTA 5LVAA 2XRZA 1Z2CA 1G8YA 1TMYA 1GPWB 5DM2A 1ZK0A 3V4OA 4AS2A 1M34E 2AD5A 5J3JA 4FZVA 4DSUA 3VKHA 4AQ7A 1KP3A 1H9BA 2OORC 4E70A 3HA2A 1QR2A 2Q7XA 2WPNA 3UPDA 5AXCA 3U4GA 2ZUEA 3GIDA 2XZDA 4KIGA 4Q9JA 5H0IA 1HEIA 2E7ZA 2V9ZA 2OA0A 2Z6QA 3OTHA 3ZOKA 3JQCA 2A4KA 5AXAA 5DI9A 4JR0A 4MHSA 2QGFA 4QD3A 3N8KA 3L84A 4TPKA 4ZQBA 3KFLA 4BC1A 3B7WA 4HTFB 4Y2QA 3MVEA 2NVUB 2CXQA 3DE2X 3E6AA 3GFFA 4L02A 1CUCA 1RWBA 1WB9A 2XNKA 3JATA 2V7EA 2JIQA 4X66B 3LO8A 3C85A 1IU9A 3PHLA 2WKWA 4RPIA 4M99A 1BJRE 4OLHA 1AXRA 2UVDA 1RI3A 4D9FA 1WY7A 2FUG1 2W42A 4AKTA 4F86A 5CXXA 3V33A 4B2PA 1VKJA 5B1EA 3I2IA 1E0KA 1V26A 1ZU5A 2FCRA 5L3VA 1X15A 3QOXA 1NOJA 5E9AA 1NNEA 2Y1FA 3B6KA 5FPPA 4YR9A 1WCWA 1ZZEA 2I99A 2ZT5A 1RBMA 1T0UA 1O95D 3BXOA 3LZCA 5FOSA 4LYYA 1LDBA 3VOTA 3ZY3A 5EUCA 5KMGA 3C6MA 3FNHA 2OV1A 1XVLA 4UARA 3T3NA 3JR3A 3WV4A 3BPSA 4NMMA 1GGNA 5CB4B 2EERA 1JEQA 2O7QA 3LAWA 1YASA 2XZPA 4RKFA 4LXIA 4LNAA 1XQYA 4LVOA 4RL6A 1UP7A 4UZFA 1NN3A 1QDLB 4F72A 2C61A 3IEMA 3OOJA 4FKZA 1OXUA 1ZN9A 2C77A 3IXQA 2FQQA 4I1RA 4URZR 3VDMA 1HKHA 1BVHA 1RI5A 1YVDA 3FPSA 3A70A 3OLWA 4NNJA 4B3FX 1I7SB 2Q0XA 5A5GA 3JQ6A 4XWKA 3DOUA 1DDOA 2V6BA 3T9FA 3F46A 2OYRA 2JIOA 5IU6A 4O6VA 1YAHA 2P6MA 2VDRB 4B6SA 5E95A 3ZY2A 1E66A 3QEMA 4YT4A 1VA4A 3E70C 3QVWA 3VC3A 1QR6A 4G0UA 2QJFA 3PDCA 4YMLA 1E0JA 1UJ5A 1T36A 1GQYA 2C95A 4PLYA 1KI3A 1VJ0A 4ZYLA 4A6DA 1N75A 1AHNA 1Z0ZA 4LPKA 2XWPA 5D01A 1KVUA 5KYWB 4I1VA 1MQSA 1BHJA 3HJHA 2WWWA 1VHTA 2RGBA 1N2EA 1N8KA 3LT1A 1X87A 4WJZA 4EPXA 5ADWA 3FH0A 5HVNA 2P2ZA 1QP4A 3KOYA 2NU7B 2DGDA 2YV4A 1XROA 2QLMA 3HYLA 5L6MB 5FR2A 2YNMC 3G8AA 5JWHA 5D5PA 4MWZA 3BJMA 3CG0A 3DEFA 3ZW8A 3ZDRA 4C0AC 1X9IA 2W83A 4POOA 3RUHA 1GLNA 3DT8A 2I55A 3G8BA 2PZGA 3LKDA 3NI2A 4G2NA 1RC0A 3ED5A 3RFUA 2O20A 1XP8A 4ESOA 5IXSA 2WVJA 3KPUA 3AFHA 4FWIB 3AHFA 2XW6A 2O05A 4TKVA 5GV8A 3BL6A 4LKOA 4BVJA 3GLGE 1MHPA 5FEUA 1AO3A 1D4FA 3WKAA 5LMCA 4DWWA 4GVPA 4DCCA 2QRZA 3T1OA 3UCXA 4CM9D 1MIHA 2D0PB 3ZD9A 5DK4A 3KAJA 4QAJA 4DV3B 4HK4A 2C7RA 1PAUA 1V5IA 1JMVA 1IHYA 2RGNC 3GHHA 4WI1A 5C1IA 1O6FA 2LGJA 4IRMA 2FPRA 3DGEC 4F3CA 3W1VA 5AD1A 1KVTA 3OICA 2HK6A 4TRNA 3JRXA 4Q3CA 1FP6A 4IWXA 1UADA 1QP8A 1KXJA 2FX3A 1KMQA 1CUZA 1DEKA 2I65A 4MAAA 5CH5A 3TD9A 3W1EA 4QU8A 1C7QA 3H2BA 4P22A 3VA7A 1IBKB 1HSOA 2QE6A 3C43A 2VYFA 3FYHA 4QPNA 1JJ7A 2OD9A 2LE0A 2UDPA 3AVQA 2HV9A 4UE2A 5K01A 5KREA 4UHBA 1GHTA 3WR5A 2O5CA 4ALKA 5K0LA 3QVUA 1EFCA 3JS5A 5SZIA 4D9EA 4P35A 3BGOS 4YMUA 1YQXA 5E2BA 4AMUA 1GL6A 2PQ2A 1M8KA 1Z62A 2C9OA 1HLFA 3MFQA 3P5SA 4HDKB 2VDOB 4J29A 4D9MA 1THMA 3DV9A 4UUAA 3SIWA 2FR8C 3VDRA 3LQ4A 3ZGZA 3W2GA 4RYDA 1UM8A 4TLEA 4X20A 2WU0A 4QQNA 1TC1A 2PKWA 2WUWE 3I58A 2OQVA 3K0KA 4WNAB 1M1YB 4ENQA 3Q6NA 3RS5A 5LZ4A 4HGNA 3DEAA 3QFFA 4LUCA 2AN9A 1CIPA 3UFXB 1CNEA 2EFCB 3VDNB 1LLFA 1X9GA 1RXVA 3GY0A 4HVAA 4OB8A 3COZA 2EOAA 4M88A 3IE1A 1E4VA 4JJ7A 4QFCA 2ZSHA 3SJAA 4PWYA 4YQEA 4DT1B 1Z7GA 1Z9BA 4IVQA 4ER0A 3OT1A 4I4CA 1E3TA 4IDOA 1EH5A 4BZXA 4IHJA 3WLSA 1TJ3A 1U3WA 2WJHA 1C8LA 2B82A 3K0AB 5EYPA 3F49S 2XOXA 3HN7A 4CCYB 4M0PA 4PV7A 3BGWA 1Y4SA 3AYZB 5IKEA 5LR6A 1YR9A 1TAGA 2OORA 3NP9A 4WZAA 1D6MA 3GBPA 4FLEA 4FZ3A 1ONBA 4Q3OA 1N3LA 3DXXA 3WHKA 4C9BA 1SQSA 1KERA 1SXIA 1YS4A 3BQ9A 3IE2A 3L79A 3OZTA 5EZQA 1QKJA 3NHMA 4G4JA 4KJXA 2Z09A 3TIXB 4OHRA 1ODTC 1MV8A 4PX9A 4IDHA 3N8HA 5FBVB 4Q3BA 2W90A 2DP4E 3KQSA 4OHUA 2X19A 2XVYA 1MR3F 2JVKA 2MYPA 1QXSA 1D5CA 3SSMA 3WO0A 4BMCA 1ULTA 2VDMB 3T9BA 1WSWA 2XMDA 1EVYA 2P77A 3KYCB 4WKPA 1AA6A 1UBOS 3AW8A 3Q7SA 4YT2A 1XCOA 2AYZA 1C0EA 1PFKA 2BHNA 2HPHA 4KFRA 1YU9A 3IDFA 2NUPA 4RDCA 5TQJA 2KPOA 2ZYTX 5A5FA 2QXTA 1RQGA 3B3JA 2JH3A 3JQ7A 3K5IA 3SHVA 1XKXA 4MGEA 4TTTS 4A27A 1JTVA 3OIGA 1W59A 3B52X 1K0UA 3JZDA 5H02A 5LLDA 3JQ9C 2ACVA 1J99A 2CLIB 1SUCA 2CKDA 4QUHA 3V8NA 2NU9A 1S2GA 3IEKA 3WFJA 1VI6A 2AB0A 3LI2A 3QOFA 1L8OA 3QQ5A 2AEJA 4DQLA 2IDKA 2AG6A 2G0AA 3HFRA 2IOHA 3I2FA 2P4HX 5BOSB 1A96A 4RTMA 1VG9B 1BYUA 1KMIY 2QL9A 4XJXA 2IEGA 3TRHA 3U7IA 3RO7A 2W0MA 1YIDA 4GSLA 1IL0A 4XWOA 1FSZA 4LCEA 4HEJA 1CY4A 3LDFA 5F9MA 3DDWA 3ITKA 3TRDA 5KDDA 1XTUA 2Q0HA 4GX0A 3GRPA 4UUOA 5G2OA 4Q3EA 4WFQA 1O8BA 2PFKA 1HDXA 1QB7A 5I7AA 2FE4A 2B1GA 4MWOA 4KIJA 2TMKA 1L2TA 2HIGA 3AI1A 4J91A 1MW9X 3T3PB 4ZHQF 2QQEA 1FP4B 2I6FA 2BFPA 5KWEA 2ZVPX 3ZQ6A 2QTZA 3LX5A 5IW8A 1FA9A 1E3WB 1QO9A 1FBTA 1G0NA 1XO1A 3C8ZA 1OYVA 2REXB 4TMFA 2HQSA 4B45A 4MK4A 5IX8A 4BCDA 1IHUA 1P7YA 3ZH2A 3GJ7A 3HSSA 4FQ7A 2WIBA 5FBHA 1U0OC 3BDVA 3NEJA 4X63A 3DQPA 4HS4A 4YRRA 4AECA 3UGQA 4LMPA 3H1TA 3BD8A 4G0NA 2YNMA 3AILA 1ISRA 5JUWA 5KTRA 3Q0TA 5C8XA 1B14A 4X95A 3T5MA 3N70A 1P4SA 3GJZA 4NIMA 2HLPA 5CRIA 1U7PA 3T4PA 1R64A 3D7NA 4XYMA 5DSXA 1EFVA 4G3XA 4M8NE 4L74A 4ARBA 3C6ZA 5B30A 5JISA 5L7WA 3MC1A 4QGFA 5TQ0B 5KTMA 2ZVQX 3P9NA 1K7YA 4Q9AA 1I4OA 4D92A 1KI1A 1ONSA 2QL5A 3RE1A 3B2QA 2BE7A 1WXXA 4IUDS 4Q00A 1ATIA 4IFIA 3O4IA 4GKKB 4KQ6A 2RGNA 4B3GA 4M87A 2VPXA 3C3MA 5CXQA 5HUHA 3HEAA 5EFZA 2IOYA 3X1JA 3EGVA 5CDYA 1DAEA 2AOWA 3VZSA 5JDIA 2W2LA 1W96A 2VQSA 1LRKA 4G0MA 1WW8A 4K81B 4YJHA 3K2EA 3NIFB 5JO9A 3P2EA 4DMUB 1WBJB 5C4GB 2XE7A 3NT4A 2WP0A 4KO8A 1O0BA 2NQTA 1PT7A 1EINA 2ZJ4A 5AJYA 2IYRA 2IWRA 4C0SA 1DOAA 1V4NA 2C58A 4H3KB 3OQBA 4HUQB 2I33A 4J8PA 2MMCA 5EIHA 3UWOA 2IU3A 2WJAA 2YVAA 1E94E 5FV7A 2A0WA 2GTHA 2WWRA 4B7XA 4I50A 3D4LA 1UH5A 3OSZA 5CTJA 3FYSA 5BW5A 2HY7A 4UMFA 1KQGA 2FR8A 4XB6B 1XLVA 1S4MA 5K20A 4BWGA 4R41A 3NHPA 1IB6A 1M3SA 2K2WA 3TFOA 5EIXA 3E9DA 2CEKA 4H17A 3K73O 1M9NA 1O6GA 3C3AA 3E48A 3KK0A 3LE8A 4TQAA 4F4DA 4BIMA 2CMGA 3M9WA 1JKJB 1W5FA 4BN4A 4C5AA 4KXQA 4ESHA 2BJHA 1B23P 3C6YA 2O4UX 3QHAA 4A2PA 4KPGA 3DTVA 1H6AA 5AVUA 1XZQA 3BGVA 1YBAA 4BNKA 1R12A 3ORYA 8LDHA 3VZPA 3L1KA 5EKDA 2HEIA 1AGXA 1UXGA 4F8JA 4WXPA 2QVBA 4I2NA 3K2BA 1YMVA 2IGBA 4GP6A 2OCAA 3HWX1 1RABA 1M2NA 4IS2A 2FR1A 4RIGA 1XK7A 2IEIA 4EB6A 3AZPA 4CU5A 5IG2A 1KU6A 1ZD8A 2A78A 5LZ7A 3H2SA 1HDGO 3FJOA 3NKFA 3X2EA 3QMVA 5BQOA 4DZTA 4OH7A 4IQFA 4LG1A 2OSBA 2GVDC 2PT5A 3GGSA 1M54A 3MGBA 4MLCA 3GNQA 4HC4A 1B15A 4AUEA 2XYVA 3F2IA 5KVCA 4HPJB 2VDPB 3ROEA 1JFLA 3B1ZA 4Y6PA 2GK6A 3AR6A 3DC7A 1MOPA 4XW2A 5J59A 5AW0A 3ZC3A 3Q85A 1ZK4A 1M73E 4RJ2A 1OA1A 1WHTA 3OOYA 4TWRA 2VLBA 1G19A 3DNFA 1TTTA 3V8QA 2VNJA 4RFVA 1PYDA 1AG9A 1F51E 1J39A 3IPYA 4G25A 1B1AA 2LXNA 2WU4A 2HI0A 3M6XA 3N0WA 1NGSA 4B83A 4LS3A 4ZJZA 3NRBA 2H2IA 5CYPA 1KJIA 3G7NA 4QARA 4MJLA 4RQUA 3V6LA 4EYQA 2JB9A 1R6AA 1NF3A 4MB0A 4QT4A 1WTAA 4R1TA 2OCKA 4IS3A 3OESA 4HXGA 2ZRAA 1ARZA 1U9IC 3JQ9A 3NHKA 4JC8A 3DAYA 4GXTA 5FUVA 5THQA 5T41A 3D7LA 4MRMA 4OI2A 3DD1A 3D4IA 3TLXA 3KXPA 1WDWB 4QPDA 5BUQA 1IEVA 5IFLA 1AUQA 3H16A 4N76A 3DG9A 1JAIA 3KD2A 3B36A 4IXNA 2NNWB 1J9GA 3ZD7A 1MQAA 3AFGA 1QHYA 3HVJA 1FDVA 1GFZA 4NHEA 5K3AA 1J42A 3K9CA 2NN3C 1C1XA 4MYDA 2V6IA 4JLOA 4ITRC 2F64A 4PINA 3ROQA 3A4VA 1QE0A 1E2EA 1G8MA 4JI0B 5BSVA 4I1UA 4RYLA 3EA0A 3DFFA 3PFBA 3R3HA 4NLLA 2IXEA 4HTAA 1IJEA 4B7ZA 4CT4B 5IXJA 1HG0A 5DMHA 3ZQ4A 2ZK7A 5KI6A 2P9ZA 4LJSA 2BBSA 3X1WA 3E1KA 4S24A 2OC9A 2QNBA 3O7MA 1BX0A 1J90A 1Z6QA 4XVQA 2X3UA 1RFLA 2W6PA 3DEJA 4H60A 3ROMA 3HK2A 1DAIA 1H93A 1W29A 3LSYA 4WA7A 4EI9A 5ETJA 3CF0A 3U13A 3HVHA 2Y1WA 2GF9A 4KLAA 1YL6A 2XVAA 1B6RA 1KEWA 2J09A 5JADA 1Y81A 3LS2A 2Q9BA 5IM5A 1COWA 4L4UA 1P9LA 4BLWA 4J49A 4R7GA 5ESRA 5DYGA 2W4IA 3H5NA 1ZW6A 2GKOA 3DTTA 1SCIA 2OHHA 1FSFA 2ONJA 1LPPA 2QTTA 4DA7A 1EIWA 1LPMA 3QUAA 2PD3A 4R8RA 4GXNA 3TW8B 1C9KA 5KOYA 1UDXA 3ZWPA 2PZAA 5B37A 1SVNA 3NWBA 4BO8A 3OIYA 1LF0A 1X14A 3BFVA 5E6UB 1EFAA 5H4HA 3E7DA 1U2DC 4B33A 3QJYA 3VR5D 4TVBA 4TMZA 5EWLB 3SQMA 4MW4A 1NE7A 1SHJA 3F74A 2CUKA 5A9SB 1W36C 4KMSA 4N5LA 2PO7A 5AYVA 1ADYA 3CNQS 3BZWA 3DH0A 4PRKA 3EGOA 3R5SA 2CLLB 4EPRA 5K0FA 4Y2VA 1SKBA 3GFSA 3DE5X 2VI5A 3ZXIA 5JYDA 4P5DA 4IAOA 1NQXA 1O08A 3D0QA 4P0TA 4U9HS 2EVWX 1HOXA 2J7KA 3TFQA 3LUJA 2WM3A 3ICWA 3K9HA 3FZQA 4LPSA 1C30A 1V11B 4UAVA 1Z4PX 5EQFA 3M70A 3IIJA 4RE5A 2DQZA 1ZN8A 1U9CA 3KXDA 3QV2A 2E9SA 3S1AA 2OLJA 4WK2B 1X7XA 1XA3A 4M9CA 5EIBC 3MCZA 3HB0A 4Z4EA 2C7GA 4I55A 3FPCA 1BMQA 3G1TA 3I83A 4BNGA 3HQ4O 1DTEA 1N2HA 1NZFA 3GL9A 3RVPA 1MDBA 3I6ZA 3GDHA 2XNDA 1PZXA 3CKMA 5EMMA 2FPUA 1XDUA 4YCSA 1HRKA 2CMHA 2CNNA 4DBLE 2MJLA 1ZD2P 2XTNA 3JQPA 4BVFA 4CDNA 1L5WA 2XUJA 2IIVA 2WJVA 4AN4A 3SF8A 3D3NA 4RADA 1M2VA 5CGQB 3AFIA 4S0ZA 3MS7A 5ENDA 3ZJVA 1H1TA 1A2BA 2ZCUA 1IEXA 2A33A 1QFSA 2ZBPA 3O7WA 4F06A 3COSA 4MV3A 2OO5C 1SXJC 2PT6A 2QRLA 2RCYA 3DO8A 2QYSA 3OLCX 4XA8A 2BPOA 3LBHA 5AI8A 4AJ4A 2PLFA 2XADA 3D81A 4D3XA 3D1JA 3SQOA 1H85A 4OJKA 4DV6B 3PUJA 3TFWA 1FUEA 3DO6A 2X58A 1W46A 3DZBA 4P32A 1E7QA 2G9ZA 3A9WA 5DGCA 3BFXA 3WSVA 1L5HB 2IUSA 3HKBA 1PFYA 3MIIA 1ELOA 2BISA 3MOIA 1RCFA 4XPIB 3T5GA 4W9RA 4OHYA 1VMEA 2Y0PA 2PKYX 4U7JA 3R41A 1RZ3A 4YUAA 3CVJA 4JL5A 4ZVPA 4BJ3A 5KTOA 1XYVA 3M3DA 2WJZB 2J5QA 3EVAA 3VPXA 4TWZA 4C7OB 2XQFA 3AQIA 4HFNA 3HKEB 4K2AA 3H87A 4LK2A 3I72A 3ESAA 1AQNA 4M1KA 1N36B 2VSOA 1R0XA 4ENTA 3CZRA 2GX6A 3TEFA 3EZNA 3K8YA 3OUUA 2AK2A 4BNMA 4PHCA 1EESA 1S6YA 1VPDA 2QG6A 3RRFA 2GERA 1CNFA 3BILA 3AF3A 5AW6A 2IY8A 2WSBA 1W0KA 2I22A 2XD4A 3EXFB 4N8EA 3TPCA 3LF2A 2ZRJA 1ZXBA 1CW2B 4PRZA 2XUQA 4MKHA 4AG5A 1USGA 2EDCA 1FDIA 3AR4A 3BDAA 1ORVA 3SKVA 4C3VA 3I4FA 3EK2A 4IIHA 3TDMA 2ECFA 4BFTA 3FLMA 3N2KA 1AUXA 2GN6A 3AEUB 4JBWA 3OURA 1IPEA 3QBDA 3IQGX 4L4XA 1Z5GA 4DIBA 1L8AA 5ECDA 3ZCXA 3JQQA 2ZI3A 4PU0A 1DEXA 1MMFB 2QZZA 1RRPA 1YULA 3A1NA 5KYTA 3W90A 1U9IA 3WL4A 3EYAA 1RVV1 1B8UA 1SCKA 1WB4A 4JOCA 1BWSA 3KC2A 3L06A 3N2YA 3CSUA 5HIMA 5JEDA 4OREX 2WZQA 5DASA 4RVDA 5J2TB 2FMXA 1NVFA 2M1XA 4CKBA 3ODPA 2EIXA 2DU8A 3VUEA 4HR7A 1ISGA 3HDJA 4PSDA 4YMGA 1M1ZA 5CDSA 4IG9A 4NG5A 1Q0PA 2FFJA 1ZMRA 2FP4A 3W4KA 2J5RA 1RD4A 5KTPA 3TYXA 2AE1A 3ZE0B 2BSQA 3PRHA 3QPWA 2ZRMA 2AE2A 3N8GA 2OV2A 2Q6TA 5GJCA 5DYTA 1A0OA 3EWSA 3T0GA 1GADO 4FMCF 1W8DA 2XZLA 4EO4A 2P1DA 5TPZD 5BMOA 5JV5A 4ZCQA 2P9EA 3C1AA 3HS3A 1POXA 1OLUB 1T8PA 4XEHA 5ALUA 1CDDA 3KU4A 1QK4A 2D1SA 2NWQA 5BV1A 4FX5A 5KQPA 1EIZA 1GTRA 1BROA 3S6JA 5EP2A 3VSBA 3EWIA 2WQ6A 3IAS1 4HAXA 1I6KA 1I0ZA 2PFGA 4G9EA 5E2IA 4JVMA 1C0KA 1L5VA 5AM2A 3WBKA 3GI1A 4QUDA 3AJ8A 2P0AA 1MJNA 3FRIA 3KQWA 4R3NA 5L6LB 4DR4B 2HD4A 2J3LA 3FYUC 4UCQA 3ZJYA 3TOZA 2Z98A 4LJ7A 3VAYA 4W82A 3RJTA 3BHJA 4QDOA 5IBQA 3RJ5A 2EJCA 4IKEA 5FI3A 3CYFA 5FPTA 1KKLA 1I51A 1U2DA 2F48A 2NT3A 1QF6A 1WMFA 2JAUA 5AI9A 4Q4CA 1LW7A 4AVYA 3V2HA 2Z1NA 4J03A 1NF9A 4MVJD 3MT7A 3OF5A 4YDSA 2Q4OA 1GZHB 4GWGA 3G0IA 4JB3A 1LPSA 4CL0A 4OQMA 3WWEA 4ZYZA 1DWPA 2Q5QA 2NUTB 1FU7A 1XEWX 2PEZA 4FFMA 1MVNA 1ISIA 3SNKA 4R9NA 2OV8A 4LTNA 1GZ3A 1OFTA 2OMEA 1W49A 1Z4MA 1JX6A 4RJLA 1N2SA 4I4IA 3RSZA 1CT9A 2O2CA 5EEHA 4C06A 4Z7QB 1VL8A 3R6TA 5BNZA 1XQ1A 4C4OA 3VH3A 3N0RA 4BO7A 2AN4A 4V0MA 2REQA 1GPJA 4NHOA 3KD3A 3C5WP 4PVCA 5JMPA 2NZVG 4O5AA 5DM0A 1CJTC 2HRQA 1E5XA 4MS1B 1DIBA 1GRVA 1DEHA 5DK6A 4CF6A 3NBKA 4G65A 2QN1A 2F8MA 1IVNA 4MQBA 4RY2A 2N0SA 1XEWY 2FEWB 2JEZA 4PS0A 2LCQA 3LT2A 3SIRA 1EA7A 3ZR4B 5K0JA 2AOXA 5IT9A 1CP3A 1XCGB 1KMCA 4J1SA 2GA8A 4L6CA 2EP5A 4NH4A 4P9NA 1GARA 1SRRA 3JAWA 2BTEA 3ECSA 4OVKA 4J0GA 5IF9A 3W6UA 4AJ2A 1Q14A 2XSZA 1V41E 5JXGA 1NXVA 3BGDA 3H3JA 3E3LA 4E5VA 3KSDO 4QUJA 2D54A 3NH6A 4L08A 4YV0A 2R7MA 1EA5A 4JKOA 4OQNA 5LYJB 5CVJA 3A2NA 2OO5A 5IUNC 1QF7A 5CT6A 2IYXA 4Q18A 3RC1A 3WWOA 2IPLA 1ILWA 1B8OA 1IHPA 2LWIA 1C41A 3IX7A 2OZEA 1D1PA 3V1UA 5ALDA 1A8IA 3MK31 4JVSB 3AVWA 3BL8A 4GKJB 3G2IA 1UBJS 2DYKA 1JR6A 1V1JA 2O3TA 4NOLA 1J8VA 5L4SA 5CGZA 4PX5A 1UR5A 1W85B 2I7VA 1DRUA 1RXEA 3WKCA 3IMCA 2PTHA 3UCEA 1OXMA 2I62A 3DBRA 3OE7D 3QFTA 4CNQA 1DELA 3U3XA 5CEJA 2Q6VA 1KZ1A 2XCTB 1F7VA 1FX1A 3L82B 4FNAA 2HHJA 1DX6A 2IEZA 2NZXA 3F7OA 4RU1A 4RY0A 4XQ9A 3BS4A 5HEKA 4CYMA 4DLPA 1QHXA 3DOEA 3FZYA 4PZDA 2VZEA 2HCRA 3C7AA 4LBVA 4ARVA 4D8TA 4KNYA 5AJUA 4PCVA 4PAGA 1YOVA 4JXKA 2ZIWB 5EXDA 2G0TA 1ECFA 5ALTA 3LXXA 3W8RA 1FIUA 1QQBA 1BN7A 1QLHA 1N4DA 1POWA 3L8YA 5ENVA 9GPBA 3RWBA 2QBYB 4M60A 4ZJPA 1BS9A 4EG3A 1XOIA 5AKEA 1AUOA 1QGUA 2POQX 3PEVA 3QKIA 3E9ZA 1U04A 4QHTA 1R9JA 4F2WA 3SZOA 5FTKA 3V8EA 3A3OA 4HWTA 4ES6A 1TYDE 2QR2A 1IB0A 2ZSKA 3DV0B 3TX2A 3BK7A 3SYMA 4YPVA 5ES4B 4OU5A 4NBNA 4NYIQ 4X7BA 5CT9A 3A0RB 5K8TA 3QU2A 4AX8A 1AHPA 1U3TA 1WKCA 2JJ2D 1EGHA 2JF0A 3V4VB 3W5DA 5KTKA 5DF1A 4PSAA 2ENUA 4AICA 1GRRA 1YV9A 3I8XA 2Z4SA 4FGLA 3O75A 2UYCA 5FI5A 4EI8A 3KKLA 2NO0A 4J0CA 1T9KA 1IMOA 5ADHA 3MB5A 3O0DA 4YFVA 4E32A 2FUEA 2C7BA 1PO7A 5GOTA 4GHWA 2W2KA 3PQ2A 4PIPA 3CMMA 4EGCB 1HEUA 4AP6A 2QD4A 2QM0A 1FDOA 5K0NA 4EHNA 5BT9A 3L49A 4O0MA 3ESDA 1PGJA 2AFHB 4CUJA 5HM6A 1GPH1 5ELMA 3VNSA 2VAMA 1OVMA 5IEBA 5JO0A 2IPNA 2X5JO 4RHEA 1PR2A 1VJCA 4PBTA 1CJVC 1WCXA 2GUGA 5CLGA 1JQDA 4LHXA 4F4CA 1SXJE 2HMVA 5K3SA 13PKA 3E7WA 1FLNA 4JQYA 5F3DA 1YDEA 3M34A 3LY9A 3OBIA 2IYZA 2R86A 2VJNA 3WK8A 1CDEA 1Q0UA 1T9GS 3RYTC 4FB4A 2WHQA 4O4IA 3O8QB 1R0RE 3NHJA 3IH5A 4YRSA 3P0IA 3L7OA 3HJCA 4K40A 4ZVVA 3U4MA 5KYYB 4CMIB 2J46A 2PMDA 5DN6D 1FFBA 2EATA 2HMSA