1SBTA

Atomic coordinates for subtilisin bpn (or novo)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine proteinase)
molecule keywords SUBTILISIN BPN'
publication title Atomic coordinates for subtilisin BPN' (or Novo).
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 81
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1972-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sbtA00
4CG0A 3ZXYA 4CFZA 1AU9A 2SBTA 3F7MA 3WIVA 1PEKE 1Y3DE 2Z2ZA 1MEEA 3CO0S 1Y1KE 1Y9ZA 2V8BA 1WMDA 2IXTA 3BGOS 1T1GA 3ZXXA 1AK9A 4NMXB 5ARDA 1GNVA 2X8JB 1TM7E 4OMDA 1LW6E 4AKTA 2G4VA 3TECE 2ID4A 1BE6A 1PTKA 3I30X 1C9JA 4KG7A 1TK2A 4GI3A 4HVLA 1YJAA 3DE3X 1IC6A 1NDUA 3DVQX 1SUDA 1V5IA 3GCXA 5CW1A 5I9SA 3DW3X 3DE5X 1SIBE 1ST3A 1GA1A 1SCAA 4Z2AA 2QTWB 4FONA 1Q5PA 5FFNA 1NLUA 4NE9A 1SUBA 2ID8A 2ZWPA 1UBNA 1SUEA 1TECE 1TM1E 2Z2YA 1Y48E 2WV7A 5JMOA 1EGQA 1P7VA 2W2MA 4M1ZA 1GT91 1SCJA 1SH7A 1P7WA 1YJBA 1TM4E 3VV3A 3D43A 1GA6A 2Z56A 5SICE 1BFKA 3SQOA 2W2QA 5JXIA 4KB5A 3BPSA 3VSBA 1BFUA 1SBCA 3LPDA 3DE4X 1SBHA 2B6NA 1TM3E 3LXUX 1C3LA 2PKCA 1SVNA 1TM5E 3DYBA 1XF1A 4I0WB 3QMPA 5K7SA 4HX2A 3AFGA 4J94A 3DE2X 5JXGA 2W2OA 3I34X 4RYDA 3EIFA 3EDYA 1JEAA 1OT5A 3DW1X 1S01A 2W2PA 4YN3A 1OYOA 1SBTA 2GKOA 1GCIA 1T1EA 1V6CA 1IAVA 4C3VA 1P8JA 1GTG1 2Z2XA 1GTJ1 1BH6A 3DE7X 3GT4A 1EA7A 3AJ9A 1KDZA 3I2YX 3SICE 3CNQS 4WOCA 1BE8A 5B1EA 4H6VA 3VTAA 2WUVA 1SELA 1YJCA 1SUAA 5AVKA 4LVOA 1ST2A 3EE6A 3L1KA 2TECE 3GCWA 4H6WA 1YU6A 3AJ8A 2PYZA 1SUPA 1Y3BE 2PRKA 2Z57A 1HT3A 3DE6X 3DVRX 1Y33E 2DUJA 3VHQA 5AVJA 3PTLA 4ZOQI 3DE1X 1C9NA 4DJ5X 1NDQA 3A3OA 3T41A 2ZRQA 4K8RB 3TI7A 1SCNE 2PWAA 3DE0X 2P4EA 3LPCA 4WOBA 1SBIA 1ZVKA 3WHIA 1KDYA 4JP8A 5ARCA 4H6XA 1Y4AE 2HPZA 3D9QX 3LPAA 2SECE 2WWTA 1R64A 3QFHA 3QTLA 2X8JA 1KE2A 1PJ8A 1Y34E 2PWBA 2PMWB 5FBZA 1SN7A 4LVNA 1DBIA 3OSZA 2ST1A 4OV6B 1AH2A 3F7OA 1MPTA 3DVSX 4CFYA 1Y3FE 2E1PA 2PQ2A 1S2NA 4OMCA 1VSBA 3TI9A 1GA4A 1TO2E 1Y4DE 2XTJA 3WIUA 3H42B 1DUIA 2HD4A 2W2NA 1KDVA 1ZVJA 1WVMA 1Y3CE 1WMEA 1S02A 2IY9A 1SCBA 4AKSA 2SICE 1SUCA 4KPGA 5ARBA 4ZARA 3WQBA 1TMGE 1GNSA 1AVTA 1SCDA 3F49S 3VYVA 1A2QA 4B5LA 4DWWA 2ZWOA 1SBNE 4NE7A 4DZTA 3A3PA 3I37X 1WMFA 3A3NA 1SIUA 5JXHA 1PFGA 1R6VA 2DP4E 1WSDA 5JXJA 3HJRA 1KE1A 1SPBS 3PRKE 3BX1A 2SNIE 1AF4A 4BWGA 1AQNA 1THMA 1BJRE 2Z58A 3P5BA 3VV2A 4C3UA 2DQKA 1R0RE 5AQEA 1T1IA 3Q5GA 2WUWE 2Z30A 3DDZX 1SIOA 1AV7A 1CNMA 2XRMA 1GTL1 1OYVA 3UNXA 3GT3A 5AMXA 3DWEX 1CSEE 1TO1E 5FAXA 3Q40A 1C9MA 4MZDA 5B1DA
chains in the Genus database with same CATH superfamily
1T9CA 3WL4A 2XMSA 1H2EA 3QEOA 3C98A 2CZCA 1BVUA 3IMKA 3VDQA 5L6LB 4BFYA 3OZSA 1XA3A 2JKZA 1U3UA 3RANA 1DWUA 4N65A 2QMYA 2QX9A 2BMFA 3TPFA 4I66A 3AF4A 3VVCA 1TCUA 4ALKA 4WN9A 1GCUA 4UZEA 1Z6PA 1K2WA 3CO0S 2PT5A 4Q3KA 4OQXA 1FLNA 5AYVA 5HDBB 3GVCA 4LJ6A 3AU9A 1KMHB 3WMXA 4NXMB 2GAIA 1N36B 4RVGA 3FFWA 1NBIA 4E0BA 2V6MA 3IEVA 2VSYA 1AUQA 2GD2A 1OTHA 1RCFA 3KWLA 4KXMA 2A0XA 4ZU6X 3U3KA 3TFQA 3JYQA 2CK3D 2HCTA 2X5NA 3GEBA 4NJMB 5ALUA 2P9ZA 1N6OA 3RRNA 1H8HA 4EP1A 2BELA 5EXXA 1N2JA 1XTRA 2N3ZA 2IW3A 4F46A 5JBNA 2IUFA 4OQFA 2FXIA 3EA5A 4IX9A 2P2LA 4GC9A 3A28A 4GOXA 4UE3S 5FA5A 5I9BA 3RGGA 4GECA 2V5AA 1VKHA 1KEZA 3L18A 3FNGA 4GOJA 1N5MA 3V8RA 3DLTA 1UOEA 2AOUA 5IEBA 3IR7A 4LYJA 4O8ZA 2P8JA 3S8EA 5KNCD 4M2LA 2FR8A 1JPVA 2R8BA 1TVCA 5FA6A 5J4KA 1QWSA 2DHEA 1NG1A 3A0UA 2LDXA 2PH7A 4UQOA 5EJ9A 3Q6NA 1WB5A 2YYSA 5FJJA 4CKBB 2LIVA 1RS0A 1VPEA 2PX2A 3TSZA 1XNHA 5CA0B 2NX2A 2CFRA 4I8DA 3LTEA 3Q2KA 5A71A 1TRHA 4YYEA 5LD2B 2XKJE 2YVQA 5KCZA 4Q05A 1BGXT 2GAOA 4BS9A 1PZMA 3ZGOA 4CDGA 2GYWA 2GXSA 1Q3TA 1YR8A 2AC2A 4KUGA 4PSCA 5LIRA 4LOKA 2O3UA 1KZ4A 1XZ8A 2PR2A 4MV4A 1LQUA 3I04M 3K9NA 2QI9C 1KU6A 3N8GA 4FBGA 1SO8A 2ETXA 4OIMA 1PK9A 3OKAA 2RHHA 2C4VA 3Q98A 4CIWA 1E7QA 1YI1A 4K9SA 4D4IA 3V55A 3ANTA 2VUIB 4AMBA 1W36C 2XF2A 4CFSA 4JSTA 4LXYA 1VC2A 2PNJA 4X7MA 1KMMA 4Z3OA 1TU4A 1AKWA 1XE3A 3MWKA 4MJ7A 1PV2A 1Y4SA 5KOIA 1KEEA 1A4RA 1KQFA 3U4MA 5AUPB 2R1TB 1T9KA 3WGJA 4C88A 1YRYE 5F2NA 2OQVA 1VGQA 3V9PA 1AHHA 2CXUA 4QZVA 1YRAA 2QRGA 1E3IA 2VQ6A 3E3AA 4L8WB 5L7WA 4M37A 2HRRA 2REOA 1JHPA 2Y4NA 3ITEA 3QVGB 5D8DA 1IBCA 5FLYA 4RXMA 3EX7C 2BAGA 4JI6B 3IVGA 2ATCA 2NLOA 2X23A 4TS1A 3TG2A 3RAFC 4KREA 3Q5DA 2ZR7A 3Q8WA 3A1FA 4BNFA 1PHRA 2P5UA 2EKZA 3RHZA 1HTTA 1L5LA 1L4MA 2Z2YA 2H2DA 4H0FA 2W8BB 4NP6A 4EG6A 3CUKA 1JECA 1SZDA 1W96A 4E5DA 2EW1A 1M5TA 1PR0A 3ND9A 4RKYA 4X3PA 3SYKA 2WUEA 3CXUA 3ZY2A 1NXQA 2AC4A 3RUHA 5DNDA 3WLNA 4QYSA 5LQJA 4U1RA 3W7VA 5IWAB 4TKUB 4BCDA 1RMYA 2QN7A 4YP5A 1VPTA 2IYFA 3W6PA 4KE6A 3WDKA 4F9FA 5I48A 1OWMA 4F5DA 4GKAA 2RHCA 2WY2D 1Q1GA 5HKKA 4L4ZA 2HHJA 1VE5A 1ZGHA 2JGFA 4XVCA 5TPZA 4CE6A 2HSWA 2Z2IA 2B4YA 5FL7D 1KK1A 1VI5A 4KN8A 1KDPA 3VOTA 4EMUA 1EK5A 2VPPA 2W2QA 3CLTD 2WQ6A 5JDCA 2HU8A 5ALTA 5HK8A 3UHAA 1PWXA 4DBLC 4WFJA 2P1DA 4N6GA 3QWBA 2ZSBA 2G28A 3ZLTA 1IVYA 4DRYA 1WQ3A 5JDIA 5ADWA 5ALQA 2HA6A 5HM6A 3DE4X 2Y8EA 3L82B 1KYIA 1FOEB 3PK0A 4OI2A 4UASA 1SKAA 2R7KA 4ZVLA 5B3JA 3S68A 5GADl 2V0GA 4JJZA 3V1UA 5K03A 3OUTA 2F2TA 4K3VA 4TKZA 5YASA 4M8LA 4DSOA 3KJIA 2F1KA 2QTCA 4O4IB 5LWHA 2QTRA 1CUSA 4CM9A 4JLWA 4FFDA 1W8IA 1BXGA 1SVNA 1AY0A 3EZNA 5EZYA 1ABFA 4FZ3A 4MIKA 4DMKA 2D3TA 2O8NA 1JEYB 5L40A 1E2GA 2FPLA 2FYTA 4Q0MA 4YA6A 1AGRA 4II3A 5FQOA 3LCVB 1JFFB 3VPGA 3T3OA 4LBWA 4KZPA 4BRWA 2CNOA 2QWXA 4OP3A 3UJ7A 1NUUA 1U0TA 4BKMA 1EX1A 3VGPA 3RABA 4QSHA 3HUUA 1CVIA 2B8NA 2P4HX 3TNFA 3IX7A 1U4SA 3A4YA 2Q8QA 4JBLA 3VNAA 1FUEA 1GLNA 3PQ3A 2KLHA 4QO7A 4L0DA 4RLQA 3DYVA 4MQEB 3E2IA 4RMHA 5IDVA 4W9NC 1Y63A 1XTVA 5DZSA 4EX7A 2VPYA 1F8UA 3ESXA 1BGVA 4B3GA 2EKDA 5C1PA 3LYLA 4C3VA 4IHAA 1Z33A 3ICQB 5EQDA 3KDPA 4BE7B 1GTJ1 3PSHA 3WYEA 1WRBA 1Q1EA 1XTSA 5KMGA 1UFQA 3GQBA 4GPTA 1FYDA 1KDZA 2WJAA 4LTNA 1RWWA 3TQQA 3B6MA 1I7LA 4U6NA 4RK4A 1CG6A 4ZCSA 1DI0A 3EFHA 4XUEA 4LSZA 3V3TA 3L2OB 4MEJA 1VMAA 2Z2JA 3MGBA 4MUGA 1PL7A 2YMLA 5IKEA 2NZ8A 3LL7A 3B6JA 3AXTA 3TTYA 3FRIA 4MRVA 3NHUA 2I29A 1IWPB 4MINA 1FMTA 2BFDB 3UT6A 4TKMA 3NCTA 4N1AA 3TAXA 5B2FA 4NG5A 3EUAA 1ZN8A 3DHVA 3TNYA 3KPWA 3VJMA 5EJ6A 2R48A 3VH4A 1YHZA 2W6JD 3F8SA 3SQDA 3GAFA 3UKDA 3UWPA 1F2TB 4AMGA 2HIGA 1GZSA 2PYZA 3NV7A 5FD8A 4DNOA 1JMYA 2NSYA 5DBOA 5BN4A 5F1KA 3U7QB 4RW0A 3K70D 2QXYA 5AK6A 3ACBA 5D00A 5E2AA 4F6RB 1B43A 4C7OB 3GLRA 2P6UA 2CLKB 4AJ2A 1T26A 3L7LA 4C5CA 4BEJA 1LLFA 3IJRA 4NLLA 3X44A 4U7JA 5EFZA 1PDWA 1ZRMA 1M10A 3GLTA 3LYUA 4ZFNA 4LY0A 3D4NA 3PC7A 1HNNA 2CNWA 4L8YA 4FU0A 3R4VA 4H4EA 5KJFA 1TF5A 1BNCA 1AQJA 1DFHA 2LDBA 4LDPA 1NW5A 2IYRA 1CDDA 1X3SA 1KQ3A 2UDPA 3DOIA 4ON9A 3EFOA 4FR2A 5A2QA 4V1CA 1RC1A 1DO2A 4BBAA 3BGIA 3KQLA 1U1GA 1ECCA 4TWJA 2WKQA 2DLNA 3T5MA 3I1JA 2XXAB 4YAOA 3WNCA 2W58A 5JCXA 2P0AA 4KSBA 5JHHB 2J4DA 1BS9A 1GLVA 2GMWA 1JU9A 3BKWA 4RIHA 5TR9A 3SX4A 1DCTA 1C7IA 2BSQA 3V9AA 1KQOA 1QE5A 5DLPA 2WJVA 3T35A 4EKGA 5AVXA 2YRWA 2M32A 2XMZA 4RK5A 1DV1A 1RLTA 5LQRA 1ZW1A 4W1RA 3FYUB 4JGIA 4MR7A 2VRWA 2GB4A 4PZLA 2Q1TA 3NEJA 4FX5A 5JTUA 4DT1B 5DHQA 4GR4A 3ZVLA 3HEMA 3OECA 4X8LA 3PIRA 4LC1A 3FCXA 1PK8A 4MIEA 4G8BA 5DGTA 1I2AA 4GQIA 2VPXA 4FFRA 2PS3A 4BNHA 3PNMA 2OOSA 1KJIA 3EZ2A 1MC8A 1QFYA 1Z4LA 2AHRA 3TLGB 4EJ0A 2CXHA 4PPNA 5IG2A 1YS1X 3DFZA 3BXXA 4W5NA 2OFXA 1Y34E 1LRKA 2EG9A 3GJRA 3KE9A 1UEJA 4N3CA 1FNNA 1IDN1 2BFFB 4KV9A 1QPBA 4TXLA 2GLUA 5AJZA 5LB4A 4Z1MD 1B8VA 1BU5A 2YCBA 1J1UA 1NVGA 5DW0A 1Q44A 5JVDA 4YLEA 1SFRA 2VDOB 2MTBA 1LZLA 1P0MA 3U4DA 3ZCPA 4WMLA 1Q0TA 2W48A 5TDHA 5KHOC 4BB0A 5JCOC 1Y1LA 5KYUB 1CUBA 1U0HC 1EHYA 2AOTB 3KOOA 3PFHA 1U31A 4FFWA 4NESA 5JISA 1IEVA 4PM4A 2CVHA 5LYJA 2ZATA 4Q3AA 5DHFA 4B47A 3SEZA 1J6UA 1SOAA 5IZCC 2ZSAA 2EJWA 3FGPA 1Z0JA 3WE7A 4U7TB 4D9FA 4PYKA 4KQFA 1J06A 4RL4A 5GM2A 1KK3A 5DGCA 4YRMA 5HQ3A 2CV1A 3WZLA 1YHNA 2E89A 5LIPA 2UZ3A 3K53A 2W22A 5JI2E 2VT6A 3JY6A 2CYAA 4KQXA 4DMHA 1JU3A 1DKLA 4HAWA 4RY9A 5GGYA 1TYAE 1WZIA 3FTDA 2ZVJA 1FB5A 1TADA 1VKZA 4NBVA 4ZO9A 1NHWA 2P5SA 1HYHA 1RRVA 2BZSA 2I62A 1EG7A 3AONB 2RAVA 5MN6A 3B1XA 4IY1A 4MSUA 1O95C 1YDFA 4Q7KA 5H70A 3WGLA 3ADPA 1MGOA 1AQIA 2ZBPA 2ZRIA 4J7CA 4LEIA 4AWXA 2ZZMA 1QTRA 4QYMA 4C20A 4DWOA 5FR2A 2DBRA 2JI7A 3IHWA 4HHEA 3JZIA 4PQRA 5AW4A 4G0PA 4L6CA 1CE8A 2RHLA 2W2KB 1NTRA 4CIYA 1PJRA 2BONA 5G0UA 3QFFA 3O83A 3VKUA 5DF1A 1B6SA 2GSDA 5HFAA 1CK4A 4L4UA 2JIPA 4HZIA 1YHYA 5EIOA 3R76A 3WA6A 2PFKA 3JWPA 3L02A 1MB0A 3E9DA 4TLLB 1OC2A 2EZ9A 2XT6A 3K8ZA 3LBNA 5IUNC 3D5QA 4M8IA 3FVWA 3QKSB 1HT2E 3DLCA 3HMKA 2P65A 2C4NA 1LV7A 2QDKA 1TQ4A 3KUCA 3AG5A 2VWHA 4U2CA 4M87A 3PA8A 1Z9BA 4EGFA 2GAFA 1TMGE 1UOPA 4GXTA 3MMXA 3EULA 3HK2A 5FNVA 5IHXA 1CF2O 2Z5VA 2BN4A 3AM5A 1TU0A 1FUKA 2H1CA 3HNOA 3IQHX 2B82A 5DM60 1AUXA 4MV5A 1ETHA 1FU7A 1T35A 4MJLA 4DL9A 3PICA 2B30A 5AW0A 1H6DA 1XMIA 3UMGA 3ZDZB 1E1LA 2HPAA 4CQJA 2F7SA 4DV4B 2JASA 3JD0A 2ZPTX 3DKRA 5JD6A 4EUFA 1DXHA 3C15C 3GLIE 1DDOA 3FJ1A 4QJ5A 2W2XA 1U02A 4X3CA 3A3PA 2ZM6B 5JS2A 1VP9A 2F9MA 2IXFA 3AF0A 5M2QA 2JCBA 1JSXA 1Y4ZA 3DEZA 3U37A 1KPIA 4CKXA 2ZXUA 2CVQA 5KOHB 1VRWA 1TK9A 2XUOA 2XODA 4A6PA 2QVGA 4QDKA 1UC5B 2EV9A 2R8PA 2PUHA 4Q47A 4YJKA 3RC1A 2IH2A 3VYUB 3NBZC 3CUSA 1XCPA 4TTVA 1T36B 3AUAA 2B8EA 2D1YA 3QELA 1N4AA 3TLJA 4LMBA 4G5GA 4RK7A 2PGLA 2OILA 3DHNA 2IC5A 4KYVA 3QWHA 3UT5A 4RUKA 4X7PA 2FSVC 2NU9A 4EHJA 5JZSA 4C7VA 1B76A 1YT5A 3W34A 5BW8A 5JSZB 4LJRA 4ZRMA 3DXXA 4BV9A 1ONPA 1EWYA 4EELA 1AF4A 2EARA 2FQ1A 4URUR 3RVJA 1FUIA 1OAAA 4NBRA 3T8YA 3UGKA 3GZNA 4DSAA 3FA2A 1F9EA 4L5YA 1FXWA 4PW0A 4DVGA 1L3BA 3RC7A 3VHXB 1NU6A 4DCOA 5BT8A 1XKQA 3TBFA 3EDOA 4RIIA 3QHAA 4B80A 1B0AA 4CYMA 4YJ3F 3OZIA 4BUCA 4ER0A 5JU6A 2NV2B 3FMPB 5CLQA 1EM8B 3K8YA 2OPBA 1Y6QA 3GMIA 5BUSA 1O58A 2FUG6 4CIDA 1Z75A 2BR4A 2A5LA 4G8CA 1GU1A 2YJ3A 1KEWA 4OQLA 3T61A 4TWZA 4UHKA 1X2EA 1OH6A 4PIPA 4MA5A 1QANA 1J0DA 1FTQA 2PGDA 2QD5A 4IAOA 3QWIA 1ICEA 5FLEX 3EC7A 2ZS7A 2C5FA 1K7YA 1DIGA 2EJBA 4FE7A 1E9SA 1SG0A 4YJGB 3FI0A 5LZ4A 3MWLA 1CNMA 1X80A 1ZPDA 3GU3A 3WJ1A 5JAUA 1P2GA 3KV1A 1P72A 2GHTA 2QENA 1JLLB 4QEKA 2FW0A 4LS3A 3GT3A 1NXWA 1XROA 4HAIA 3MWEA 1TYEB 2ZBGA 1BJKA 5GAJA 1KI3A 4YQFA 2XMBA 3V7FA 4XQCA 3U31A 1KPGA 2ZIVB 3GI1A 4PICA 3IV7A 1WCYA 2H07A 3EXG2 2P3LA 2PT9A 3PFGA 4AXXA 1HNZB 3NGMA 3PQ2A 2NW6A 1N2XA 3PZBA 4ZOCA 3KKEA 1P7YA 2NO0A 1W9HA 4QOEA 1P7CA 2B4KA 4WJLA 4B87A 1WD7A 1H2AS 3JQRA 4D99A 2WT9A 4LG1A 4PC6A 1I3MA 2WWFA 4UBIA 3BRWA 4XX0B 5HE9A 2QTNA 4C3OB 2IITA 3IUQA 5JSHA 3L5KA 3NS7A 1Y3HA 1ADJA 1TKAA 4MUEA 4Z0NA 4HPXB 3VR1A 3OQ1A 4GYKA 3PVCA 5B2EA 5JJLA 5JQGB 1IEXA 2ONYA 3R3WA 5SY9A 3DA8A 5FORA 3GNTA 1ZOIA 3W5VA 4AU1A 5A3JA 2OZLA 1HDYA 3QVWA 1GTVA 3OX2A 1IPFA 3QBDA 4OUDB 1YFJA 4OFZA 3GFRA 4BQFA 2GWRA 1X9GA 3E7FA 3COVA 4N03A 4PEVA 4UM5A 1P2DA 4B45A 2W7TA 3IDZA 3SU8A 4CLRA 3O9VA 4FC7A 4DQDA 2J0VA 3K1AB 4F92B 5JNVA 3MTQA 1LLDA 1RXCA 2M9MA 1FFEA 3THXA 4Z9XA 2X6QA 2TMDA 1R50A 2R9VA 3O7WA 2CNLA 3OJ0A 1TRKA 5AM5A 4E07A 2XCOA 2K2QB 1WCIB 4MVJF 2YN0A 4UBJA 4WXHA 3B12A 1M0TA 2N75A 4PWYA 4U7HA 2Y66A 2ODBA 1UJ2A 4G1MB 4MAFA 5FA8A 2R84A 3ETHA 5IC5A 1TU3A 3VYTB 4BB9A 1EFAA 1EHIA 3BSYA 1H2HA 3R7BA 2YWHA 1MJ5A 2R44A 4MTCA 1QK5A 1KYVA 1BE1A 3ESCA 2FPXA 5DYYA 3PWZA 4D44A 1H4SA 4G25A 1AO0A 4YRFA 5DM70 5JNUA 4CU2A 1GUZA 4FZJA 4YNBA 2YWXA 1E2QA 2W4MA 3DMHA 4AFNA 3M3HA 4UTRA 4V0QA 1SVLA 5AHXA 1HNWB 2WG0A 2Q7DA 5D51S 1Q77A 1AXGA 3HB7A 3I28A 3VU8A 3RTCA 1TQ2A 3D2CA 3ZU4A 1ORHA 1CT9A 3UV6A 3KQNA 2MYPA 1H6BA 1XL1A 2XAAA 2QXTA 4R8KA 3UFXA 4DCNA 4EPWA 3DLBA 5IULC 1WD5A 2RH4A 5FIUA 5A5VA 3KKOA 3N70A 4TRNA 1K6XA 4WBNA 3O8RA 3H18A 1CNFA 1UBHS 4CMBA 3HYRA 3S6JA 4RTMA 1V9SA 2BEWA 4AD8A 1XLTA 1ZUIA 4C6TB 1PS9A 1T5LA 4IDPA 1ESDA 1QH1B 1UXGA 3AF5A 4KQ2A 4NYMR 4RSRA 1QHHA 5D5QA 5AUOB 1I2ZA 1W48A 1LZKA 1J90A 1JLLA 1MABB 3C3YA 1MZPA 1WOYA 3GH1A 1JZTA 1QDUA 4MKXA 3E3MA 4IS2A 2H5IA 1KETA 4JYCA 1M72A 3OPNA 4MV8A 5BVHB 1PZHA 2QL6A 1S1CA 5L7YA 1ST3A 1GCOA 3W8NA 3U26A 1SCAA 1LJ8A 4CMEC 3JYHA 1T4CB 5HKLA 2WMYA 3GBVA 3CVVA 5JJIA 4OAPA 4DIOA 2ZGVA 2GTIA 4V24A 2ZRGA 5DEIA 2VSOA 4WI1A 4UUNA 3F71A 5BN3A 3DVAA 3L77A 1CLUA 1PTJA 2AFHE 4KR7A 2I8CA 2WU4A 2Q46A 2OHJA 1U1IA 3DR5A 3PC6A 2CJPA 2FJPA 3E0QA 5JWRA 5DI9A 2I22A 1U9IC 4R9NA 4S12A 4AI6A 3Q2IA 1TJYA 1P3Y1 1XALA 2CDAA 4G9GA 1V16B 1WY5A 4X9XA 3KELA 3VC3A 5AW7A 1ZJ6A 1H66A 1KVTA 1SCKA 4LYAA 2NM0A 1MB4A 1W52X 4QQ8A 3WISA 1EK2A 2WEKA 1BVHA 1ZQ9A 4IDCA 1FNCA 1KOJA 2RGAA 3EGWA 3BC1A 2YY6A 5FV4A 1MIOA 2BEUA 2ZRFA 3PRJA 4L2IB 3B6KA 2F3QA 4J91A 2AF3C 3V42A 5K4GA 3R6LA 4DDUA 7MDHA 2TYSB 3QBEA 4UCFA 2CWWA 4IJKA 5DHPA 4UNQA 5BURA 2B4QA 3EGXA 2A33A 1YZHA 4YACA 5BT9A 3L7JA 4I55B 4RIGA 4DCJA 3KIPA 3RTGA 3IPXA 4LDZA 2Z98A 3AM1A 2JS7A 4GNKA 2ZBFA 1SBHA 3NHPA 4JOBA 5A1TA 1KYYA 1W4RA 2JBHA 2VPWA 5CH3A 2QIOA 3G9UA 3TLZA 4D9NA 5KYWB 1MQ9A 1NPYA 3MYYA 4ZJUA 3L0IB 4RKRA 4UCQA 5AP9A 1SCUA 5DP2A 1VRCA 1RM3A 3C39A 4MVCA 4R68A 5I7AA 1CQJB 1QYRA 1P2VA 3BBLA 5D3MB 4MVJM 5HNKA 2JJ2D 4RIEA 1XXHB 1OD6A 1EDBA 1WQ4A 4I0WB 4KSCA 2B34A 4WKCA 2RKBA 3HR4A 1RAEA 3OZRA 3A1UA 4EX6A 4ZT2A 3QF7A 4QVIA 4EYEA 2PVSA 3ESRA 5DWVA 2Q2QA 2ZJ2A 2H52A 4DLYA 1WB4A 5BSUA 1RNLA 1YK0A 3VR2A 4XARA 3NHLA 1U2GC 2AUMA 2R97A 2QK4A 1A8PA 1L7NA 1FNBA 4LBYA 3WGGA 1VJCA 4BVKA 4UU0A 1I8TA 2WP0A 4WKPA 4RKEA 4EJSA 1OI3A 3TBHA 3QBVA 2FCAA 4X1KB 4AX8A 4U2DA 4ZD6A 4C2AA 4B09A 1GTG1 1A97A 1L8AA 1MIHA 1O1YA 3EWIA 2V7GA 4KL8S 4CCSA 3W0LB 4M0PA 3WBJA 4MB2A 3KR9A 1EUCB 4RZ2A 3AF6A 4HATA 2CLHB 2QR2A 3AJ9A 1VYUA 3I9FA 4LI3X 4TM7A 1L7MA 4KCGA 5ECGC 5T67A 3CBQA 3CNQS 2XI4A 4PHGA 3R9KA 3ZGYA 1ZM7A 5FYDA 4D45A 1FE8A 3PEVA 3WK5A 1UPFA 2IYVA 2E87A 2IX9A 2R751 3BMNB 1VIAA 3OWHA 2XVZA 3T4PA 3EUFA 1LWOA 1H6CA 2I03A 4W9RA 4D57A 3UK6A 1U2RA 5EP4A 2OWEA 4DCMA 1IY8A 1J2RA 1JDBB 2GF2A 4BLUA 3IXQA 2X77A 2DPYA 3E9CA 1ZHOA 5LJLA 1DIHA 2QPLA 1Z39A 3SGLA 4RLHA 2P77A 2VDKB 1T1RA 1ZHHA 5TX7A 1RZ3A 3WSVA 5EP1A 4G5XA 4LI0A 4N39A 3CLRC 3FUUA 2ZVPX 3MERA 2FP4A 3P96A 4Y1RB 2Z57A 5CB0A 1BX0A 1X7WA 4DQXA 1SD5A 4K81B 3M1IA 3NU1A 4QOJA 1GAXA 2P9CA 1H0SA 1KP9A 1ADCA 2WUFA 4Q4HB 2P91A 1OWLA 4EOGA 1RIIA 2AFIA 1J42A 2X2EA 3NIGB 4BX8A 3HN7A 1F7VA 1W2GA 1I7SB 2LXNA 3N75A 3HZOA 3BYZA 5BW5A 5JUWA 3R77A 1W75A 1NVEA 1F2UB 1YOBA 2Q9BA 1H3EA 4D8WA 1R4MB 1TMKA 1JAYA 3CNOA 3PU6A 4AF6A 2BWJA 3AYXB 3B48A 3SF8A 2FPGA 4I5GA 3ZIUA 3AH8A 5EQFA 1Q83A 1H2FA 1JSRA 5KB3A 3UHJA 3DOHA 2BGUA 2VLBA 4U9IS 4WNAA 2ZRQA 4CKCB 2PCLA 3RC3A 2Q7OE 3FPJA 1GPUA 1NE2A 1J21A 4QM7A 3T3HA 3PT5A 3VR3A 2Q1SA 1ZD2P 3SXPA 5EWJB 3DE0X 3B70A 2PY6A 3KVRA 4IJMA 4P3NA 2OY0A 3LPCA 1Q6YA 2JI4A 2I2CA 3K6KA 3TL3A 1GPAA 1U0OC 4IVQA 5CRIA 3F1KA 2N1MA 1P0FA 1W4ZA 3E9RA 3ZVMA 2VJDA 2WD8A 4TMKA 4EEZA 3RSLA 4E03A 4JIGA 2B8JA 3ZD9A 2AXEA 3LLSA 4C0SA 2QGNA 4QBTA 5T5QA 2K87A 3CH5A 3NNSA 5CVUA 4UBNA 5D7NA 2FUKA 4HQKA 1V0JA 3M5DA 1D7OA 1Y1PA 2E85A 1DFGA 1XKLA 4C4ZA 1G6Q1 2O23A 3D8HA 3PB3A 3TS1A 2F67A 3RSCA 1QCYA 3BAFA 3NHZA 4MPJA 3GPBA 4C0WA 3FYSA 1R66A 1RBYA 1D2AA 3GXOA 1GGMA 1U2DA 3OIYA 3QFHA 2FN8A 3EF0A 2J9YB 4DLTA 4W5TA 2P27A 1V11A 5HPYB 3O95A 5LP6A 2I6FA 1Z29A 5EHXA 3MHTA 2BDEA 3COJA 1Z0UA 5EZ5A 5CD9A 5I3ZA 3TXXA 2ST1A 3BIOA 4QYIA 1XCLA 4MGEA 1HFKA 4LOIA 3VO8A 3C7KA 3CWCA 3NB0A 1ZN2A 1JQ5A 4JJEA 3VDNB 1FY2A 2FFAA 1DJQA 2HRCA 1EFPA 2GERA 4IOJA 1RHKA 3N28A 5HSGA 1ZMBA 1HQKA 3R41A 1YZLA 2YS7A 3HN2A 3ENWA 3KKNA 4HQLA 1YCDA 3M6WA 2DAPA 5A4FS 5HIJA 1S0UA 1GILA 3FLBA 1VSBA 4CKYA 4PXYA 4DWVA 4RHTA 2ZUWA 5DKFA 3DB1A 3FNBA 3RS0A 2FZWA 3H9EO 4CI0B 4KWHA 1RLIA 2WINI 5E9WA 1WP9A 3WYNA 4YGYA 1V96A 3CNBA 1QTQA 4BNIA 3EVFA 3BXEA 2IYTA 1UJNA 2YFYA 2D1FA 4QPPA 2EBHX 1F0KA 3SC2B 2O2XA 4A0QA 5KX5B 1VGVA 3PXXA 4GOMD 2W2NA 1S2IA 4GXQA 3AOEC 4P82A 5IS2A 1B16A 3B1JA 4JV5B 5ADUS 3FPAA 3N8DA 2ZJ6A 4CF4A 3DS8A 1OXBB 3JYPA 4QTYA 5KNBA 1E89A 1ZW6A 3PFFA 4R1TA 3IAHA 3QYAA 1UCFA 2XTNA 5COQA 2XQIA 4DMCA 4Q00A 2GJAA 3L1JA 2Y3IA 5JALA 3IRVA 5JQWA 1UBRS 4OB7A 2GEKA 1WPXA 3FRHA 2F1RA 2Q5HA 3L8DA 3EWNA 3T5DA 1GPDG 2NYUA 2QRNA 1WCXA 7REQB 3GELA 4JUIA 2BKVA 2C2HA 2XB2A 2BMDA 3G2IA 4KH0A 4UBKA 4M0KA 2FWJA 3T7EA 4LAFA 2G8LA 2G9RA 1YR7A 3BWDD 4NBNA 4F2PA 1EA5A 4YR9A 1EDDA 5DISB 5AM1A 4DV1B 4OD0A 3DC7A 1VMEA 5A4JA 1W4BA 4B3BA 1ORWA 4ISBA 4PINA 5HKAA 3M9XA 1RHUA 2ON6A 3AESB 3Q8MA 1M8GA 4JEMA 1GDDA 3P1JA 3ACCA 3JSAA 3IQFA 2G3YA 1UMDB 3JR3A 4IDEA 4PFKA 4AZWA 1QF9A 3GEMA 3OZXA 1M73E 4G9BA 3ZS9A 4RZUA 5BV7A 5JZ9A 3OTOB 1UAAA 2IEGA 4JT9A 4NFSA 3GRCA 4ZWNA 3HDTA 1G8JA 3U62A 1CUIA 1XEWY 2ODNA 2G82A 4ZYYA 3QXJA 1UT8A 2HMYB 3IO3A 1Q2XA 1RW4A 4TSFA 1TYCA 2XWBF 2WKWA 1VE9A 3I58A 1NJSA 1WHSA 5DFAA 3PFWO 2QMZA 3E4CA 3I83A 3JD1A 2I80A 3PTZA 4G09A 3TB4A 1SKYE 2BHSA 3CG4A 3LP5A 4YS6A 3KSMA 1OKKA 4F91B 5KNDH 5ED0A 2O8EA 3N07A 2ZIGA 1EFTA 2QM8A 3QPWA 4LJAA 2R8YA 4MDYA 1NP7A 4CL2A 1L5ZA 1XMJA 2A1UA 2G77B 2Y1CA 2XNDD 3WTBA 1A69A 1JHUA 5BSTA 1KVRA 2IOHA 4AECA 3QV1A 1FFBA 3STWA 3FNIA 2YZMA 2C92A 2FWMX 2YBEA 2JG3A 2VZEA 1M8FA 1RQ7A 1NBMA 1FFGA 3M34A 3RF6A 5IJ9A 2UUAB 2IX3A 1JHYA 3AFHA 2YV2A 2JJ8A 2X7HA 1ULHA 4LNUA 4S0ZA 5CIWA 3ACDA 2Q3MA 4E33A 3IE1A 4ARCA 1P17A 1ZN7A 3CIFA 4Q34A 4R4JA 3RE1A 2RCNA 3HXPA 1THMA 4PF1A 1M1XB 3T95A 3WBKA 3UWSA 2RGNC 3CX7A 1MXHA 4I50A 5EAIA 2IXDA 1E9AA 3G13A 2YRXA 1NPTO 3CZ5A 1USGA 5KZMB 5CMLA 3B5JA 3NTQA 1C7ZA 2CLEB 5AIAA 2IWHA 3L8FA 1MG5A 4MV0A 3A9SA 1T1IA 2ZQZA 3IQDB 1E79A 1P0IA 3PEEA 5KINB 2QLLA 1E99A 3VC2A 2PRSA 4KWEA 2QYSA 3LDFA 4FFNA 3PQCA 4J07A 3I9KA 3QKUA 3MUEA 3BSFA 4MRPA 5C8VA 1NVWQ 3RSSA 3QYJA 1FTWA 3W2HA 2HSGA 1MLDA 1QHIA 1J7JA 3OZCA 3Q8LA 1MO4A 1ZEMA 2WFLA 4AW9A 3MC1A 3OZ7A 2QEQA 3QVLA 4OGFA 1X0VA 2WHEA 3ITDA 1XZKA 3EEBA 4OQMA 4ZCLA 1E1RD 3H4IA 2RSLA 3ZHVA 1TXGA 1LF5A 2ORVA 4BFUA 4DQ0A 3HPQA 4UFPA 2LCQA 4FC6A 4K7JA 3X2SA 2PL9A 4D56A 1PD1A 4HX5A 1IY9A 3I4LA 3F47A 3ZZ1A 4BQNA 4E11A 4Z51A 2XNKA 3KKKA 4L4RA 3GQVA 2DSNA 3HKEA 3B2EA 4HDMB 4QD3A 4BUZA 4G97A 5CA1F 1G17A 4QODA 1P1IA 1ELOA 3M9LA 3PRYA 4J1TC 4CCAA 2V6FA 4FMCF 3VNQA 1V39A 5FYQA 1G2OA 4Y6QA 2O2YA 3O7MA 4Y6LA 3U0BA 4XSVA 4C0KA 3ENNA 1SHUX 1P19A 1SQ6A 3AHGA 4U02A 4QFDA 2UZ4A 2UYOA 1W44A 2J7PA 4MYHA 2CMHA 3RO7A 3DCIA 1DQNA 3MRVA 2DCMA 2XSZD 2M1XA 2OO5C 1HL3A 1T0PA 3CR8A 1N77A 3B53X 4Y8VA 5HFJA 4EW6A 4YV2A 1G41A 1C0IA 1XL0A 3ZDAA 1KKLA 1BWPA 1T8WA 2QT9A 2ASVA 1AK1A 3C4VA 1L9KA 3KL4A 3MRTA 2VXOA 2AE1A 5JROA 4FFBA 3OLYA 2FZCA 4H1HA 3DMTC 3IKLA 3RS9A 1RWOA 3OEEA 3ZN2A 3BK1A 1E2FA 1KSJA 2H18A 2D1RA 1ZSYA 1VPVA 1XZMA 2EW8A 5AVUA 4JUAA 4EFKA 1V7PC 5GWXA 3SJUA 3BMOA 4C3ZA 5BN5A 3IPLA 4NU5A 4M0DA 2IS2A 5GJBA 1NUPA 2WM8A 1SVKA 2WOJA 4FEYA 4BMSA 4DW8A 2H4YA 3WJ2A 2KMLA 2XGJA 2IVZA 4ND7A 5EYPA 5IVDA 1RYBA 2VYCA 3B36A 5GM1A 1DWPA 3SBXA 5AVSA 4AN1A 3QW2A 2VHVA 1T1JA 3L46A 1UKAA 1WF6A 3TECE 2KWIA 3RIHA 1O4WA 3NQ41 4UM9B 1EWVA 2FJ0A 1UDAA 4BAZA 4TMYA 3UAGA 3BWXA 4IIJA 4A6EA 3LWZA 2JAXA 4H77A 4C43A 5EZSA 4D79A 4E21A 1HYGA 4GKVA 4H4DA 1T4MA 1EFVB 1T8SA 3K9QO 3QVTA 4MWOA 2WSBA 2D8MA 2JJ1D 1T2EA 3FSJX 2V65A 4HNHA 1SQ0A 1KQNA 3S2YA 1CUGA 1WSBA 3I01M 1YJAA 4EGSA 1V4BA 2QE7A 4PLGA 4QL3A 2PSFA 4XQ9A 3VZRA 3COZA 2QAGC 1I5RA 2MSCB 2C5LA 3EG9A 4A2WA 2RHJA 2CMGA 4BQIA 1PLKA 3Q8XB 2BFNA 3OM1A 1NAHA 1RYEA 3KVVA 1ZIDA 4G3XA 4Z2YA 1YQ9A 3WGVA 2NAPA 3EAQA 5DN6A 3ZOZA 2QZPA 3I9V6 4U3JB 1HI9A 1V5IA 2XCUA 3LVQE 3C43A 1BXZA 4MA4A 5K8CA 1EUYA 1NUQA 1H1TA 3MCUA 3GDOA 4OLHA 4OXRA 4JVLA 4XEHA 2ZEJA 5HW0A 3SQLA 3JWGA 1Y5MA 1OJ7A 2NNLD 5C81A 3MGCA 2G1PA 1KI7A 3Q7TA 1R18A 1IUNA 1SIBE 4FMCB 3RFUA 1K98A 1B41A 4D26A 2IS1A 3IIKA 3M1YA 4FONA 5K9ZA 1NFRA 1NLUA 3MT0A 3O8CA 2MINA 1DZIA 1Q84A 2BGIA 2Y0PA 3S8YA 4UAGA 3ETGA 4R81A 4MWTA 3AY6A 4WXMA 3U4CA 5EHGA 3NNDA 1N5LA 3ZIAA 3QFRA 3HWRA 4DDWA 1ZNYA 3JYOA 2F90A 1SU7A 2WJPA 4CPDA 4D4GA 1XHEA 4ZZIA 3LW8A 4CM3A 3ICPA 3MD9A 2XYHA 3H65A 1NW3A 1PHPA 4LMPA 1M2HA 4JJGA 3OFVA 1ORIA 1WV0A 2FCRA 2XIJA 1PR4A 2Q4TA 4JLJA 1G98A 2NAFA 1PJTA 2QUJA 5J4YA 1NJ6A 4D7AA 3T5PA 3VYSB 1WUJS 2VF4X 3K20A 4LNHA 3OPVA 3H8SA 3BE5A 3GCDA 3K31A 4QQFA 3SEAA 4BWFB 3T0FA 2ERXA 4DV2B 1BCRA 5E0KB 4OBBA 4I81A 5KWEA 4R2WA 2NXJA 3KQSA 4UULA 3TX2A 3F78A 1E6KA 1YB4A 1EAYA 1LUAA 4YMUA 1SXPA 2C2MA 1X1BA 1TVEA 1QHNA 3KDAA 4DR3B 1QHXA 2JBAB 1RAFA 1O2DA 1XKTA 3LPDA 1KFEB 2WU0A 4L78A 3W5UA 2HHLA 3I6IA 1XZPA 1RE0A 3QX3A 2JD1A 2QUKA 1JW9B 1PGPA 4CMHA 4Q6BA 2AC7A 2HKIA 2JFXA 2QD1A 1XQ9A 2X40A 4HDAA 1ND6A 2RHMA 3RVNA 3TOXA 3V8EA 3BTVA 4NZPA 4BZPA 2QDXA 4ZI7A 4LZJA 2WFZA 5KVSA 5L95A 3ZLUA 1NX6A 1S8NA 4O5OA 3FCAA 3TOVA 2J5QA 3VI3B 2V6JA 3KYDB 2EKBA 2ACEA 2IHUA 4J2HA 2G8NA 2X3FA 1Z15A 4XIGS 1ENOA 1OREA 3G9TA 5JXGA 1R0XA 5ISMA 2CXSA 3MRSA 4C0BA 5B7NA 1T9AA 5LNK1 5IKPA 4BX3A 1YVPA 1N7HA 2O20A 3FYCA 5D84A 4CCYB 4EHHA 3HCRA 2H2HA 2W90A 1U3GA 4YI5A 1MOSA 4FDMA 1V6CA 3DMGA 2QN6A 4KIWA 3FRJA 3FDZB 4G89A 4XFDA 1RP1A 3ZVNA 4NXNB 2VYVA 3G5LA 1UK9A 2QRVB 2HK6A 2YOHA 3E1SA 4UMDA 4HVCA 2QU7A 4YRIA 2VS1A 5AI4A 3TPCA 3DP7A 3OU2A 1P9OA 3GVPA 2DBVO 5D6NA 4P7FA 3CB2A 3L7IA 1NG9A 1TUGA 3OHMA 3WNQA 5I9IA 4MRMA 4OP1A 1CD5A 2A5YB 3B7PA 4P4GA 3HEBA 2Z43A 5JAMA 4FHZA 1NT4A 4WOCA 3U19A 1NQUA 4B81A 4DC0A 2GZAA 4HQ6A 3ORYA 1VSVA 4CM4B 1VMDA 3GD5A 2ACVA 5JBIA 2C2KA 1KI6A 1H42A 1ZHFA 3HB5X 1P5HA 1TTTA 1SNYA 2R1VA 1UJBA 2O0JA 4QDJA 1G5IA 4WZ6A 4F2WA 3ME5A 4BMNA 2PX0A 3V4OA 5C3UA 5HKKD 4TVOA 2IS6A 1BMFD 1FNMA 1XZAA 4NCKA 1WB9A 3EEFA 2E0IA 5TPZD 2AI1A 4YCMA 2WF6A 4LV8B 4N82A 4EYGA 1YUNA 1TO6A 3FGZA 4M1WA 3VOBA 3ZXSA 3AM4A 3VNBA 1PQYA 2FSGA 3DKKA 3WLSA 5AW6A 3NIBA 3FLAA 2OYCA 1ODIA 3RS3A 5EL0A 3IP1A 4F86A 1YZVA 1YVEI 1MFZA 3MLBA 2B25A 4TYQA 4ES6A 5ILOA 4PC7A 1QZZA 1IFXA 2DUJA 4IX1A 3AIKA 2IEDA 2IRWA 3GJSA 5CDFA 3TW8B 5FUYA 3R9XA 1ZFNA 1TK3A 4K9DA 4P81A 1C4XA 3RK0A 4F4JA 4WK2B 4PLYA 3PTLA 5K8UA 4O2AB 3H97A 2QZ9A 4P83A 1NYTA 1YULA 3SBOA 2G6TA 4GEGA 4W9NA 1JYFA 3CJRA 4BYMA 5EJAA 3I72A 4LY9A 3ZU6A 2XX3A 2O2EA 2Q8PA 2ZYSA 1F5SA 4I1PA 2A4KA 5EP3A 1Z6AA 4DR7B 5I9TA 2W11A 2D59A 1W19A 3OLZA 4IHJF 2KX7A 1E2MA 4O4JA 2QNIA 3NOQA 2OBLA 3CPHA 3HXKA 4IVNA 1RRFA 1Y81A 1KGDA 2R4UA 3CH7A 4KQGA 4WSOA 2BEJA 3KSUA 3OD5A 2BP7B 4YCNA 4FM9A 1FVXA 1YB6A 1YTUA 1Z0KA 2PKQP 2C3UA 2FX2A 2WM9B 1EXMA 1LX7A 3K5IA 3O90A 2UYYA 1GXSA 4PG4A 2RG1A 3VPBA 4YAIA 1L4KA 2IPNA 4MYSA 5CIYA 2HJGA 3FOCA 1CY7A 1TCAA 2FMXA 3JWHA 5CLGA 2ZCUA 2R8XA 2B8TA 2JFUA 1JG6A 3IKVA 5HQJA 3TRJA 1PWYE 1EE9A 1I01A 5CK4A 1LC3A 1FZQA 1LPBB 3GJQA 3VR4A 4BECA 5B3KA 5L51A 1DARA 5AVTA 3K6SB 2Y2UA 3LKDA 3THYB 121PA 1J09A 3BERA 3WVNA 3IBCA 1BX1A 2AMLA 2ZYDA 4OHRA 1B8PA 3DF7A 4EG7A 5JZOA 4GR9A 3SQMA 1R64A 4RD6A 3JQPA 4HNGA 4LK3A 4XIYA 1G16A 4BN4A 1PQUA 2FKNA 1JI3A 3DH0A 3QTLA 1VDZA 4RH1A 3U7GA 1ZX1A 1PJ8A 2V7QA 1JDNA 3I2KA 3NLLA 3RU2A 4BWVA 3DQZA 2C5SA 4B3HA 3SZLA 1P4RA 5TVKA 1VHQA 1XEXA 1DBIA 2ECKA 5IVHA 1VBFA 3F3KA 1BU8A 4HJRA 2WSMA 4P08A 4OV6B 4FS3A 5AKEA 1HA3A 1YOVB 4A1OA 1KK0A 3EVZA 1D4ZA 1H8EA 4E1BA 1OBHA 1RJDA 2BJVA 2IP1A 4BRSA 1J56A 1KAGA 2J07A 1L5RA 3MWGA 3CLTC 4PR0A 4IYJA 2R6HA 2WTNA 1VLVA 5EWLB 4ZIRB 3ECCA 4QUDA 2JFVA 2NU6B 4S0XA 2ZYAA 3OIGA 4BO7A 2YHIB 3TR0A 1XDZA 3EK2A 1MZVA 4H7JA 3CJQA 4DA6A 1YVRA 3IBGA 4F4HA 1WKCA 4DLRA 3R0XA 2Q5FA 2XDQA 4F4FA 1SXQA 2CNWD 3JARB 4TGLA 3WB9A 1T2FA 1DPGA 1RLJA 4HLUA 3H42B 1CY2A 3EVDA 3ZCQA 4NBLA 3AKYA 1T8TA 4E22A 3PDUA 1R5OA 3NAMA 4LYFA 2HT6A 2CE7A 4ZCPA 3C16C 3QENA 3GLSA 1KOFA 1NIJA 3A27A 4IV5A 4J75A 1I6KA 1MTZA 1QK3A 1YRWA 2Z3VA 4WFQA 4YDRA 3D3WB 3FWPA 3SE7A 1QYWA 2R1ZA 3IPRA 4GX1A 1ISSA 1D1PA 4GZLA 4QNNA 1AKVA 2WOOA 3QE9Y 4EZEA 3HKDA 1L3IA 1W581 3Q3CA 5LB2A 1Z7BA 4Z1OA 1OIVA 2VVTA 3M4YA 1LPPA 5FTMA 5IFKA 4IDAA 4DCVA 2EYUA 2RK4A 4L51A 1E2KA 4L0MA 1IXKA 2MR5A 4NNJA 2EQBA 4O63O 4BZZA 2O8DA 1OTYA 4N5NA 2IU4A 2RMKA 4C1NA 4H1TA 2LWIA 3TTUA 1QU2A 1N3BA 1C8KA 4GW3A 2JIMA 3IOBA 4MQFB 2QLFA 2WJZB 1NQTA 1JQEA 4Z9FA 3F49S 5DCWA 1DSSG 3IV9A 3MZ0A 1U65A 4M1KA 1A2QA 4EHIA 2O06A 4PZPA 3M8KA 1G2PA 4FFMA 5J1TB 4BNGA 3SHVA 3HDGA 2N0SA 5DK6A 5IZCA 3S2FA 3K73O 4QC2A 1L7EA 2Q6KA 3BXHA 3FVTA 4ZDIA 3WA7A 4E3ZA 1C80A 3TJMA 3D8RA 2HI0A 4RNCA 3N2EA 2E18A 3PVSA 2P3QA 4IIEA 4ZZ3A 1T9HA 1TPYA 2IIPA 5H02A 1UJ6A 4CTNA 3C8ZA 4V0ME 2X4LA 2CHGA 1RKVA 2OPHA 1RXSA 2FPSA 3BRQA 5HKBA 1D0VA 1UPXA 2VBCA 4A23A 2AJDA 3OUZA 1K66A 4JN6B 5CHYA 1FFDA 1M6HA 4ERNA 1CRPA 1C7RA 4DDVA 4O4LB 1XAIA 3DL7A 3IT1A 1B2LA 1R6VA 2OD2A 4IDOA 3HM9A 5FUVA 4IV0A 4JU8A 3W77A 4WUTA 1D5WA 4PZZA 2ANCA 3CGGA 4QXPA 5E6UB 2Y1LA 2CMFA 3GLQA 3CUEF 1N1EA 3PWSA 5K8IA 5ADHA 4FMBB 3PPYA 4P4UA 1PT5A 4L6AA 2V9CA 4D5GA 2GO1A 1ZOSA 3DM9B 3UG7A 4L9AA 2M98A 2RD2A 5E2IA 4U6SA 3OM0A 3FB1A 3KUKA 3NOXA 2Y27A 4BQQA 3OT1A 1YBVA 2OFWA 9MHTA 1FYXA 1V4NA 4R1PA 2BGNA 1RC0A 1UZAA 2XUAA 2HM7A 2ISSD 2B1RA 5IKOA 3RASA 3CT6A 3FMGA 3UAVA 1AKTA 2O7NA 4QQKA 2YTZA 1Y6FA 1IQUA 4J0EA 2OWDA 3GEPA 1C29B 5CXSA 5JAIA 4G0QA 4ZVSA 2O2CA 4CUZA 1I2MA 3RAGA 3E82A 1DDIA 1CC1S 1J5XA 2Z30A 3FPHA 3KOXA 4EKYA 3BT7A 3DWFA 4NBWA 1NW8A 4FNAA 4ZKEA 3GLVA 3DDCA 2ZDGA 1RJEA 1MC5A 5BQOA 1GPYA 4XR4A 1JIUA 1JH8A 1L1RA 3EIOA 3CXRA 1ZA1A 5E6SB 1TVKA 2NQ2C 2ZJ0A 3GRYA 2D7DA 2DLCX 5F33A 1W9MA 5A0FA 5LOVA 2AE2A 3BE8A 5IAEA 3UNXA 5JYEA 1Z34A 2QLJA 3AUUA 3M5CA 4I9UA 5AMXA 4JY7A 3FUTA 4AM8A 3ZS8A 4B4KA 5C4MA 3L7YA 3C6YA 5BUQA 2O7SA 4G0ZA 2R11A 3C70A 4KDEA 5DCUA 4TT3A 2IP4A 4MEAA 3KLOA 3CLVA 1F2VA 4CG0A 1KOLA 4Y1FA 1KK2A 4KQHA 3MQ2A 2VIIA 1L5HA 5K0JA 5E4TA 4W5OA 1HDXA 2CDRA 2XQKA 5IU6A 1IN4A 3W8EA 4D0SA 1L2TA 3GJYA 2BKEA 1TF2A 2CXOA 2ZRCA 1BQ3A 1KBOA 3ONFA 3ZQ6A 4RULA 3LT5A 1ZJYA 4B4WA 5FPQA 4LF6B 1LTKA 1Y80A 4R71A 3MOIA 3MJEA 5HCIA 1PUXA 1T2CA 2FRVA 3KTFA 3NETA 4CQMA 4D1YA 1ZAYA 1QVAA 2GJ9A 3CVJA 1Y1KE 4CIBA 3OLVA 5CT6A 3T06B 2ORED 1M5UA 2WJHA 3ZCUA 1IHPA 5LQKA 5KU1A 2UU9B 3AEKB 3MQFA 2IIBA 1E2PA 3OTQA 5IH3A 4BEWA 4RELA 1NI4A 2V55B 2XTMA 3LGXA 1ES9A 1YZFA 4KPFC 3VFDA 4K05A 4AJEA 2BHNA 4OL9A 2I3AA 1KJQA 3HE3A 4JGGA 4RIFA 3ZXXA 3J81k 2WZBA 1PFKA 4CODB 1VJGA 2FB9A 2WJWA 5CNJA 5C31A 4HK4A 4BHTA 3K0AA 3B1FA 3T1HB 4OY3A 2Y77A 1LSUA 1JT2A 4LHZA 5DM4A 1QRUA 2GVNA 1TZCA 2J4FA 3RFXA 5I51A 1Q74A 3ILHA 1B4DA 4URVR 3LY9A 1GUFA 5EHQA 3WXMA 3BA6A 3TF5A 5JEDA 2ZSEA 4IRMA 1T10A 4M1TA 4WCDA 5B7QA 1V9CA 3TTSA 3G0BA 1QRDA 3KKZA 1H9CA 2J9XB 1ZISA 3H2YA 2VDWB 3OZBA 2HHAA 4XVQA 4HDCA 2A0UA 4I5DA 4MRSA 3RAPR 1EPUA 3RBAA 3ZHXA 3UH0A 1N7GA 1T8PA 2ABWA 2JAHA 2PPLA 3BAZA 1KVQA 2WYVA 4DKXA 4TPKA 2GBLC 4HV4A 1MT3A 4ZHQF 2IKSA 4L5CA 3CE9A 1ADGA 1EEHA 2VRNA 2ZE7A 2A0KA 4Q1VA 5FRDA 2PH3A 2JLCA 4BN0A 4ZMRA 2BMJA 3AL0C 2AVNA 2ZWAA 2OQIA 5EIWA 1Z6YA 3ZW7A 3ND8A 4E5MA 3GLFB 1TYBE 5FULA 3UXEA 1KI9A 4HRYA 3RYHB 1FSSA 1T8RA 3REFA 1UQUA 1U0LA 1TLFA 2BKUA 2YC4C 3TJRA 1TAQA 1MRNA 3D6JA 4BFXA 4OJYA 2OCKA 1IM5A 2QRLA 3D6MA 1U7ZA 4UCWA 4P1ZA 4XLZA 1FLVA 1RAAA 3W2EA 4ZYXA 3B85A 3LFUA 3VKFA 5MFPA 1QRTA 2AOWA 1YO6A 1VLHA 4AX4A 5I9SA 2VJOA 5F2KA 3OBBA 1FLAA 4UHDA 4NNPA 3HL0A 3OQIB 3OKFA 5IXYA 3BFJA 4EYKA 1J20A 3BRWD 1W4AA 3BB3A 3I04A 4Q15A 4QBFA 4BVBA 2ZULA 4RFSA 3G2PA 1X8LA 2DR0A 4JIMA 5KYTA 5DLDA 1RZUA 4Z4FA 1FPMA 1ESMA 3LF2A 2HF7A 1HO3A 1B6GA 2IYOA 4BLOA 4RK6A 5I8WA 2AVDA 1H93A 1ZL0A 3A4IA 3KWMA 1U0RA 4G0UA 1SUEA 4FS8A 4R7ZA 4B6RA 4QPDA 1Q17A 4OHUA 5EMKA 3RUDA 1AHNA 4FGJA 3WK7A 1PS0A 1Z28A 3IIJA 1OVGA 1WBBA 4I4TB 1UAGA 4LQCA 1MX5A 1YB2A 2I1QA 1E6UA 1EGQA 1VBMA 2BKXA 3AERB 3TZKA 1HEIA 4U2GA 3C6XA 1RIFA 3R1IA 4G0NA 3FLMA 1WZEA 1XZCA 2B6HA 2V0CA 4QU0A 1CEXA 3LUJA 3PWKA 4QAJA 4XTCS 4B73A 1QZ3A 4XJXA 1T5OA 2FPPA 2BFCA 3D8SA 1Q7RA 2VHYA 5ESRA 1U1EA 3VO1A 3ER9A 1BYUA 3NXSA 1F06A 1FP7A 4C9BA 1P7ZA 1C50A 2VPTA 3HUFA 3LUFA 2NSJA 2DRIA 1UMBB 3PFNA 4WA8A 4WZBE 2DSTA 4KVAA 1QS0B 2QPTA 3BJRA 4BY9E 1I6LA 1SVUA 2QP3A 2A35A 4JX9A 4BJ3A 2I1WA 4R9UC 1G4AE 4DY6A 4WCFB 5EVJA 1O03A 2EW2A 4TV9B 5AR1A 2TMKA 5DX1A 1RPNA 2WE7A 2CBGA 4Q9KA 5CYGA 3H4VA 4KI0A 1OFVA 5AOAA 2C9ZA 3D7KA 5DX8A 3DAFA 1YZYA 4X1YA 2FMTA 3A37A 1A9RA 2XWSA 3GRKA 1V3UA 2DWCA 3GP8A 2UYCA 1O5OA 1DTSA 3L41A 3MMZA 5H8WA 3OT4A 4S2UA 1PGJA 4K03A 2FLWA 2A2ZA 3I1IA 4N18A 2CV0A 1OC4A 5A0TA 3V48A 5K0BA 4QXRA 2JGDB 4CMEA 1H2WA 1A9ZA 2EP7A 4XWTA 5DHUA 1C1DA 3DYBA 3DBVO 3A31A 4HUQB 4XYEA 4YWHA 1G9SA 5K7SA 3OCJA 4UM8B 3SR3A 4BVEA 3Q7PA 2Q2VA 1JIXA 2IZ1A 2VAPA 1E92A 3KQWA 1XZFA 4CN8A 2H9IA 1SR8A 2JLBA 1AQYA 2L17A 1P6UA 5EKDA 3E53A 1EYZA 1YZGA 4HZUA 2W6MA 3DDHA 3P9RA 4PLHA 4RAQA 3VR5D 4GKKB 3CUTA 5JS1A 1U9IA 3CSUA 3IEMA 3N74A 3LGAA 2R6CA 2RJ3A 4DS3A 3QPVA 1LVGA 4RU1A 2H00A 2FWPA 1P4GA 4A5SA 2CJWA 2CBZA 5A03A 3ABOB 1CY0A 3W5AA 1NXSA 4Y6GB 2PL3A 3NJ8A 3RK1A 5JNRA 4LE1A 3I2IA 4IQ8A 4ZQEA 3N5KA 4DPLA 4BIIA 4ZK2A 3S28A 3A58B 2Y4OA 2H1HA 1EINA 1XZDA 4MITA 5AKKA 3RSQA 4DQUA 3KKPA 1L5GB 3IUJA 4V0KA 2QR5A 2H9AA 2JCYA 2I4NA 3MS4A 4Q4CA 1KSHA 1SBZA 4IF4A 4PNPA 3GN1A 1UIRA 1VBKA 1NATA 2H4WA 2QRPA 1YJCA 2CXQA 4ARVA 1T24A 4YMIA 5B1IA 2H59A 2XVYA 2C9OA 4JXJA 1Z47A 2RHRA 1GAQA 3AF3A 3AL2A 4Z3DA 1ST2A 1CKEA 1KI4A 5L6MB 1B7GO 1IXZA 3VU9A 1K7EB 3BDAA 2D5BA 2AYXA 3H0CA 2M2IA 4YH1A 1E1QA 1U28C 4UPDA 3JQBC 1QYXA 3CISA 5L8VA 3MPUA 5EERA 4YP6A 2FU5C 3FZQA 3GEDA 1NIPA 1QHEA 2IGBA 1RWVA 2WDZA 3OQMA 4A73A 2BFPA 1IU9A 3LXXA 4MR8A 2F1HA 2XA1A 5AW8A 3H2SA 1G59A 1QKKA 3D6FA 4Z49A 1BW9A 3K3PA 3QITA 5BWMA 1T0HB 5C1IA 4URZR 1ZH4A 2G9QA 1YBAA 1IHXA 1YRHA 3UTDA 4EVIA 2F59A 4BNUA 3WP0A 1GG9A 4B74A 1U2GA 5AVJA 2CJFA 3CCFA 5CBKA 2CDBA 1D2EA 1X38A 1DT5A 1FK8A 4A92A 4TYYA 1X1EA 2P2DA 3VA7A 1JFVA 4ZTBA 4R2IA 4IH1A 3NHWA 4JFAA 4RPLA 1G5FA 1F3LA 4IJVA 1CYEA 3CW8X 3H5LA 3IXLA 3T3DA 2XRZA 2QUIA 1RHQA 3CZQA 2UVQA 1NSFA 3I4FA 2Y1WA 3HNRA 2EL9A 2Q3LA 2D4HA 5GGXA 4MDFA 521PA 1DHTA 2IQ5A 4P0TA 4F4DA 4FGSA 1R6UA 3KHTA 3NDPA 4NDNE 3E9NA 3RYIB 2BUAA 3V6LA 2Y1EA 4YJHB 5EPUA 4QO8A 3T5GA 4CR6A 1MO5A 1WMAA 3DGFC 3WK4A 4MH0R 1AS0A 1ZM9A 1JQ3A 4OMUA 3BKXA 1YRBA 4PONA 3Q7EA 1I3CA 5DOZA 4LCJA 5HUQA 1QVZA 4EO7A 1GIAA 1RXUA 3D9QX 4GPAA 4J7XA 3T9BA 4YT4A 4OGGA 1K6MA 4TMZA 3RIMA 1WETA 3TVTA 5CCEA 2HDNB 5F3DA 4YXWA 1L1QA 2Z3WA 1TIBA 2XGGA 4KQ6A 3U13A 4Z7QB 4QT4A 1WXGA 4R05A 3L7KA 4R54A 4D43A 4J0KA 1L3CA 5DSZA 4X90A 2FTKE 2ZIXA 3A6ZA 2VQFB 5C8XA 4D9MA 4P6VF 5DGIA 4G63A 4PNHA 1DG9A 1GG5A 2VFAA 2XVXA 3MTIA 1JSCA 5BXQC 5KO2A 1ENZA 3TZHA 3BFKA 2Y05A 4MWDA 4RVFA 4UAUA 3RSZA 2IHZA 3UMJA 5H82A 1CJTC 2D1TA 2WJ3A 5ALMA 1E5LA 2EFGA 4OU5A 5BN1A 2H51A 5A2GA 2NACA 3PC2A 1XEFA 5JPCA 3I6BA 2VDVE 3NC1C 1OH7A 3UUEA 1MPTA 3DVSX 3JW8A 1HFEL 4W5QA 2CXXA 1NVUQ 1ISPA 3DWGA 1WMBA 3H9JA 3H9QA 2G04A 3ZYZA 2X4DA 1W0JA 3NBFA 2YHSA 3HADA 3HUTA 4P98A 1Z18A 2FUG1 4OMCA 2FWRA 1E66A 1M34B 3KU1A 4O2BB 3P9PA 3STXA 2WMOB 4KRGA 4NOJA 3TLMA 1WAMA 1U3CA 1XLWA 2OL4A 3EVCA 3U4QA 4BVFA 1HOXA 1KAOA 3INYA 2CC2A 1BXRA 1H1LB 1PQ4A 1O9BA 2JAUA 4G1EB 3ZZ0A 1MW9X 4CT0A 3D6NB 3Q15C 4KGDA 4NENA 5DNYB 2APJA 1K3FA 1D0IA 2P0YA 1XJ0A 1XV5A 4KVZA 4WZAB 3KKQA 2B36A 2HD4A 5L45A 2OENG 5EZYF 5ULLA 3KJGA 1ZQ1A 1FSGA 3GEHA 4HAOA 1WVMA 1EJ6A 1QH8A 1A5ZA 1HXHA 1IJFA 2GLTA 4P5DA 2YXDA 4UTOA 1RXYA 4FKMA 3BILA 3K0FB 4PYIA 2QBYB 4B43A 2VYFA 3A1SA 2VHUA 3GAMA 1W5BA 3K4QA 1CUVA 4RS3A 1G3UA 4UUPA 2LBPA 3VHLB 1QVVA 4G84A 1SCIA 2GM9A 4E5NA 1VJ5A 1G60A 821PA 4Y2VA 5T41A 3ROTA 4GMKA 3S4YA 2X0KA 1AO3A 4FVTA 1U5BB 4JB3A 1C1HA 4OX9B 3BCSA 2HN9A 1JALA 1EB9A 4DYVA 3H2GA 4LJKA 4NWIA 1PRYA 1NURA 1ONOA 1YGPA 4XPIB 1Q1BA 2FF7A 3P9NA 2OGSA 3IB3A 1AKYA 4EFLA 4E70A 3VQTA 4TXHA 4M8SA 3WRWA 4A4DA 2EERA 3EB9A 5DOVA 3RD5A 3NUQA 4ENVA 1XWIA 5JD5A 5CEJA 4NRDA 1W5AA 2FOLA 3T9FA 1W88A 3O91A 4AMYA 4QGSA 4IDDA 5AT1A 4EW3A 2O1EA 4WD3A 1WSAA 4TL6A 5I7WA 3WSTA 3BWCA 5KYYB 3EEOA 2H06A 4FYXA 4XSGA 4DZTA 4KR2A 3THWB 2IPOA 4MRRA 2Q3BA 2N47A 4R01A 1RJGA 2PN1A 4I7EA 4AN0A 2I0FA 1RXEA 1U8UA 5AM2A 4ENRA 2FOIA 2GKGA 2G67A 1VYHA 2XQJA 3LA8A 1ZUNA 4P5PA 5HIIA 2ZDQA 3LSTA 5TQ0A 4EPYA 2WTEA 5LZ2A 3MJHA 3KL2A 3UMYA 4UW9A 4O3MA 2QAJA 2V6GA 4XUCA 4FYVA 1KYWA 3AEQB 4FUTA 3VPCA 4QPJC 3EGDA 2PBLA 1DTWA 4UPVA 1ECGA 1COWD 1ZNXA 3TNLA 2BDTA 4YCJA 3L40A 4JLBA 5E9JA 3MCVA 5AW5A 2EJUA 1Z8HA 3GLIB 3ELDA 2ZAMA 2VJLA 4M1YA 1XMOB 3BX1A 4PC3A 5A5DA 4NEHB 4DR5B 3PLNA 4KMRA 3MFQA 1DAPA 1ZA2A 2R7MA 2YNMA 3QE0A 3M6LA 1JR3A 1NYQA 3M89A 3UUGA 1FW6A 3F0TA 3ZGNA 3SJAA 4P9NA 1PE0A 1WMSA 1Z8FA 2OMKA 4IOLA 1BN6A 1REQA 1DAMA 1QV6A 3O3CA 4ZVNA 2FZGA 3U7FB 4UUMA 3P9XA 4X54A 3VV2A 3MEQA 1IBMB 2XIQA 1AA6A 3GNQA 1Q1QA 2ZAGA 3BMCA 3ZHOA 1G21A 2C2BA 4LX8A 3W5SA 4C3UA 1ZJZA 4CLXA 2X5OA 2BFMA 3N7AA 2GVDC 2XJ4A 3IMEA 2CVOA 4MVJP 3O3NB 4DYDA 5AQEA 1U2PA 5GOTA 2JVJA 5FOWA 3ZEIA 1V6AA 2F3PA 2WVHA 4BO1A 1QP4A 1PFQA 5FBLB 5HYVA 5FUBA 3GGDA 1CIPA 5CBPB 3QEJA 4D98A 4NABA 5IVKA 2P6RA 1P1CA 3WYDA 2F43A 5I3CA 2V7PA 5JRDS 1BS1A 1ZNWA 2VP0A 3I9JA 2HQOA 3CKLA 3WMRA 3AFNA 5P8WA 2CXPA 2D2VA 3U1BA 2LCFA 3ONVA 3W1EA 3OEHD 4LDNA 2IGTA 1K5GA 1RAGA 5LR6A 3IAAA 4I4NA 1JG7A 4D9IA 1YMQA 1L5WA 5GONA 4DM3A 1BH2A 3UANA 2HX1A 2DG2A 2DVMA 4CMAA 3UWDA 3UQYS 3NBXX 4P2GA 4M6WB 4L85A 2WUDA 2C2YA 4WNCA 2E48A 2EFCB 2Y9PB 3BXOA 1YMVA 1L7BA 3OJFA 3ROQA 4L76A 2W6NA 4MW6A 4WVFA 5E9AA 2EBUA 1ZM2A 4B48A 4IEFB 2WA2A 3W7BA 4EJ2A 3TGPA 1VA5A 2GZHA 2VZ0A 3HFGA 4HDSA 3SWWA 5JVDF 5EMMA 4DM7A 2BCEA 4RTLA 4HDKA 3TLAA 4GI5A 3H3FA 3EZLA 4MHSA 2BFEB 1Z13A 3E2PA 4OHCA 1I4LD 1XSEA 3L92A 4DIUA 5IAJA 3DAGA 3KAQA 3B9BA 4NNOA 3LQ2A 4I4LA 3WKAA 4COOA 2I65A 4Z6KA 1N6PA 5C0OE 1DXOA 2IEZA 1PJQA 2Q5OA 3SR0A 5I7VA 3DBHB 2AHOA 4LXHA 2ZM5A 1W1WA 4DRZA 4I19A 3O2QB 1S5PA 2J0UB 4G4SP 4JHLA 1D6MA 1EKXA 1H2ZA 1XDDA 1Z5GA 2Z08A 3LNCA 4M7WA 2IDJA 4PPFA 4UMEA 3Q41A 4UMVA 4EBFA 1JXQA 3AW8A 3DT9A 1RPZA 1RHRA 1T1GA 1P0CA 2CN1A 3MTEA 1WTCA 1UPCA 3P19A 4OLFA 3ZKWA 1KQGA 3OQVA 2GEDA 2VZ9A 1ZVQA 4L95C 3ZHBA 1V26A 3OVMA 4OHOA 1J70A 2ZUUA 1SK8A 3FKJA 4KAJA 4MVWA 2AX4A 3GLGB 4BX9A 3T4EA 5CURA 1N2SA 4R2LA 1BDBA 1OA0A 2XQFA 3KLMX 1JE1A 5CP8A 2VHCA 1RQXA 2Q3CA 1CUJA 1QSGA 2FGJA 4GP9A 1DKNA 3II6X 4MKHA 4AKTA 1DG1G 2A5FA 3NAQA 1MO2A 3EPRA 1T25A 2IZ7A 4AJPA 5FUQA 1Y7IA 1N57A 2R00C 3FF4A 4OHXA 1NT2A 1HK7A 2XKAA 4TVSA 4W7SA 2JGIA 2IT1A 2KQUA 1A9XB 2W37A 1OLSA 1I2CA 3NEYA 4HFMA 3S5JA 5BP7A 4Q3LA 1XT6A 5AUQA 4B7XA 2YWJA 4KGXA 1ZJ4A 1HE2A 5FUWA 4JQZA 1ISGA 1L5MA 4LDQA 1U2EA 1XIVA 2P9FA 4J1TA 1MW8X 1RI2A 3BQNB 5F3WB 5FNVF 3I4CA 2J3DA 3AJRA 4HPWA 3P0IA 4EHFA 1HLFA 5EJ8A 3WB0A 4P34A 1BN7A 3LC7O 3EDMA 4HWOA 4H7FA 4AZ0A 1FS4A 3E7XA 3EY9A 4TTSA 3HFJA 4L15A 2OK7A 4WXPA 1JEQB 2I2AA 3FGNA 1I36A 3AR5A 4QGGA 1UODA 4Q9AA 2JFYA 3DV2A 4NAVA 5FJIA 5IUJC 1N34B 3FDJA 1BA2A 5CR9A 3TGWA 4E12A 4E4RA 4F85A 2RCYA 3A1WA 2OT3B 4UDYX 3V80A 5IFLA 4LF7B 3GCXA 3GIWA 3ZU3A 2QMHA 4DRXA 4HXFB 1K1EA 4NV0A 1AJEA 4B8ZA 1WF3A 2HF9A 3E05A 2A9JA 1E1KA 1A9YA 4LOHA 1I3NA 5BVGB 4TYPA 3K0CC 8ABPA 1JA1A 1M8JA 1HSZA 4LJ9A 5CJPA 3R7SA 4KFRA 3EGCA 1GRQA 4JI1B 2HMVA 3HY3A 1QBGA 3F9RA 4WE3A 3FOZA 4JJ8A 1KORA 3EA0A 3IHKA 1V8PA 3PJFA 4QXQA 1E3WA 2NUPA 2YWBA 1P1HA 4LTDA 1UBNA 1NKTA 1OROA 2H4FA 4YJ3A 4YP9A 3U9TA 1A5AB 1X14A 4BNYA 3ZWVA 4YLYA 1GQ2A 3HA7A 1DEAA 4QBGB 4W5WA 4CG3A 4J2OA 5EGSA 1GGNA 3SOPA 4YUZA 3VZSA 2VTBA 3F9CA 2XCQA 3PPVA 3N0VA 1G20A 3THSA 2ZSKA 6PFKA 2C84A 5CCXA 3QUAA 4GRIA 4WBXC 1VIYA 2AOVA 2WAYA 1TM4E 2A86A 2IYUA 4JLKA 4NVRA 5IVIA 1GSAA 2Q0QA 3GJ8A 1VP3A 4MYCA 1LDBA 2ZUVA 3GG9A 1FXWF 1N8NA 1YSCA 2PBRA 3IAXA 4M55A 4EGQA 3G49A 5I47A 4L5IA 4O4HA 3UAZA 5CT4A 3ZBQA 1TIKA 1UPTA 1SXJC 2NVOA 1C7FA 3K96A 3LCUA 2QRKA 4LPKA 3IDFA 2NYAA 4FCCA 4FJ0A 1K4MA 4L07A 4S24A 1GD1O 3T52A 4BLVA 4CF6A 1VDMA 2QORA 3JZDA 2Q49A 4TSKA 5ILGA 2QAGA 1CUUA 1ZD1A 3JQAA 1OZAA 4ZC8A 1ACMA 2AFRA 4UVDA 3UMMA 4N3NA 2QZ4A 2O7RA 4BO3A 2E5LB 5CPFA 1TJPB 5TGDA 1WZ2A 2IBMA 3IDOA 1NW4A 3CEMA 1BDJA 2H4JA 3T99A 4TRJA 2A9OA 2ONZA 3KJFA 3IUNA 3DBIA 2XH8A 2O8CB 5H83A 4ZV9A 4OLBA 2YL2A 1OB5A 4I2NA 2QE7D 2NUTA 3HEAA 1UDRA 3BK2A 4XYGA 3RNLA 3A4NA 1BXKA 1AOXA 1QLHA 2EL7A 1QCCA 2RC6A 3HA3A 2BUBA 3OZGA 3M1LA 9LDTA 4L8VA 4RCZA 1S89A 3GO4A 4IH4A 3V8MA 3FNEA 4RD0A 4HX9A 2C9YA 4UFNA 1Z6TA 4OTZA 3EDYA 2A9QA 1JJFA 3SHTA 4JASB 1CNEA 1CP3A 3QUSA 2PS0A 2XOEA 4RF2A 4X93A 4FMPA 3KBOA 1Y8ZA 3T3NA 4ILEA 4DE5A 2ODPA 3QYPA 4RM2A 3BH7A 5K3AA 2YMMA 1GYPA 1JDVA 5DXFA 2GKOA 2FPUA 3R40A 4HB0A 4L3VA 5FB3A 2FSIA 1ZGGA 3ZCXA 1ZICA 4B6QA 2D8AA 3H1GA 1P8JA 3CX3A 1KL7A 2GA8A 2NZUG 4ZOAA 4MVJA 4PC2A 1DQSA 1G1AA 1N7JA 4PAGA 4F60A 3EQ9A 4HADA 2PS9A 4X0EA 3IP3A 3HO8A 3K1ZA 3VC1A 2GK4A 3ZIAD 1YJQA 2C9MA 2C58A 1SQFA 1WZCA 3CUWA 2AMYA 1DUVG 4CR8A 1ZRHA 2UUPA 1X9HA 2PEZA 1ZONA 2FSPA 1LPNA 3KT6A 3MBOA 4ERXA 1KZHA 4IFBA 4HOYA 5I4CA 2J9FB 4XWGA 4ZT4A 1H0HA 2I7TA 1R8YA 1PZGA 3IILA 3WSWA 4F3NA 3GG2A 4KO1S 4O5AA 2UVPA 3PNQA 4UE6A 4KQCA 1T5TA 9GPBA 1L8XA 3FE2A 1T0JB 3JTMA 3N6RA 2C2OA 2H9YA 4RJTA 4YT5A 5M04A 1H9AA 2O6HA 2ZKLA 1I1NA 3Q4GA 3N7TA 3GZTB 5I9NA 1YU6A 3D5TA 3ZJ5A 2J0QA 3QWFA 3KQHA 3OY7A 3EHDA 3HBJA 5GOZA 3Q85A 1T9DA 2JFFA 4WQMA 5REQA 4F9GA 2XVAA 3P71T 4M0EA 1F1JA 2PMBA 4NMLA 3GX1A 4R9RA 4GGMX 5T3UA 1K7XB 2DGDA 4UBOA 1TTPB 4IM7A 3TJZA 3WG9A 1GHTA 4KODA 1XNQB 5EXTA 2L0XA 2DBZA 2DPGA 4EGAA 1AGYA 3O2NA 3OPMA 5ITZB 3L1VA 1QC5B 4U7DA 4Z5XA 4MUYA 1H2YA 4LDRA 4QRDA 3MWFA 3GIDA 4U2FA 3DV0A 1HSOA 1O4VA 3LT4A 1ZI6A 2WKSA 2X9NA 1R4NA 2Z8YM 4WESB 2CL6X 4O33A 5U1PA 2QLMA 1K4YA 1NM5C 3FD8A 2FEXA 5CB6A 4JOSA 1A04A 1IULA 2YMQA 3NIWA 4IJ5A 4AC9A 2YFKA 3ZWXA 3ADDA 1MB3A 3CZPA 3G23A 5EIFA 5GTDA 4ABTA 3RYCA 3DULA 4XD2A 3ZDXB 1GU7A 4X60A 5LZ7A 3RB8A 2BHRA 4K8RB 2QZZA 1DJLA 3TI7A 4MRAA 3IAM6 3GC6A 4U7PB 4EY8A 2ZI9A 1E3TA 3P2MA 4J7AA 1Q16A 5MFZA 2DQSA 5I8PA 3LQ1A 4JZYA 4IXNA 1JQJC 1X1RA 2CK3A 2DHQA 4R8VA 1UT5A 4C21A 3BSSA 3CZRA 1VJ0A 2C8VA 4OHKA 5CEFA 3CVXA 3A4MA 3G59A 3STTA 4F11A 5TSDA 2G76A 3OFJA 4W82A 4TKVA 1UR5A 3ZC3A 5ADVA 4MROA 3PHLA 1GPBA 4BJ6A 1MEJA 3BE6A 4FBMA 4HJXA 3N05A 4YHBA 5EMNA 1OAOC 3TIVA 5B6JA 5TF4A 5KNCA 1U98A 4EI2A 2J0SA 4DV7B 2V7VA 4R2XA 4WVLA 4BZWA 2ZWMA 3R09A 2J5XA 4IDNA 1OLUA 1QQ6A 2QQ5A 4PZCA 3RYFA 4WECA 5KTPA 1EAMA 3K9LA 1Q3KA 3GRZA 5KOJB 3W79A 4GMXA 4QDZA 2FWBA 3ZH2A 1O9GA 1JH9A 4U0JA 3U4HA 2D54A 4WIAA 2RAPA 2WB2A 2XNSA 1P8AA 2KW5A 2OCLA 1NGSA 2PMWB 5FBZA 4BNVA 2AJ8A 2FWAA 1MOQA 2CW5A 1IN8A 1D9XA 5CVCA 4ZREA 4TUYB 1IE3A 3MLAA 4HAZA 6YASA 2J4CA 3P9QA 2FR8C 2YUIA 2GCOA 3WRXC 1DXYA 4BVLA 1PWZA 2A9FA 4H1WA 1NVMB 3SNHA 3L8GA 1IJEA 2AXQA 3ZNQA 4B83A 4MQLA 4HGRA 5EWMB 5LXTA 1ZH6A 4NJEB 4IIUA 4IXMA 2RB5A 1V1RA 3L84A 4KYTA 3MJ4A 3AEXA 2PIDA 1UDXA 2XB8A 4HGNA 2XR1A 4KV7A 5AKYA 3QNUA 5LZ9A 3C8HA 1Y9AA 3ET4A 1WSWA 2DUWA 4XUDA 4KLAA 3SKVA 1QCZA 3FVQA 5ESXA 1AQUA 2IS4A 3ZV3A 4PGAA 4KQ1A 4CV2A 2QPOA 3SP1A 2ZP1A 1FP6A 3KXIA 4MLDA 2A14A 1XB2A 2C9DA 1JI0A 2FEWB 3DPIA 3FUCA 1KY4A 1TJNA 5GY7A 4R51A 4Y2XA 1GGHA 4NE2A 2AD5A 1UMCB 2C4MA 2GOYA 1YQXA 1ZI9A 4IZHA 4RJLA 1ABEA 2BCJQ 1XRSB 1QUEA 2CZGA 4ZAVA 4Q66C 4FPXA 2P9JA 5FBKA 2AJCA 5HTOA 1ISRA 1FSPA 2ZYRA 4MV6A 1XQYA 2W6IA 1DL5A 4FX2A 5LLDA 5F78A 3QV2A 2HWXA 4NBSA 2GF9A 2Q21A 5HJEA 4QTZA 4RO0A 5TPWB 3UPDA 4G07A 4H9GA 2ZB8A 4Q39A 3CU5A 4F97A 2O8BA 1KO1A 3TYXA 4YAUA 5GJVC 3BH0A 1WMEA 2J3HA 1S02A 4Y9SA 1K63A 4J90A 4OM8A 5ALZA 2O3JA 1SCBA 4PPQA 3EDQA 3OMXA 4AKSA 2E55A 3DZKA 2AQ8A 4KQJA 3BD8A 1W5TA 1KHTA 4J0CA 2XKKA 4RK1A 1OXKB 1YZKA 1IM2A 2QX4A 3UF0A 1FPQA 2LP4Y 4N8SA 2O3QA 3PENA 2BJWA 3ICEA 4IICA 4IFEA 2YJ6A 4EQZA 5CCDA 1G3RA 2NG1A 4E2FA 1CP2A 1Z5PA 1LDEA 3JAKB 4MGHA 4LYGA 4XZ3A 2B92A 5FL7A 1FNSA 2BZ1A 2UYHA 2D5LA 1UM9B 1R6DA 2OSVA 2QVLA 2V7QD 4QUEA 1RLMA 4DOMA 2YZGA 2ZB3A 3HJFA 1LY1A 2PPVA 3T3IA 3FCOA 3JPYA 1AB5A 3KBBA 2R87A 2RAFA 1MJGA 4UU8A 3QVOA 3R20A 3F3MA 4N40A 1WLSA 5C8DA 2HF2A 2C99A 4ED9A 5A6SA 5IJ0B 1PG2A 5IWCA 1AS2A 2W42A 3UAXA 3A6PC 2AN4A 3PZRA 3T7KA 4NPAA 4PZAA 2OBBA 1W29A 1S3FA 3Q3IA 4X6YA 1IK6A 1DKQA 4OUKX 3G5AA 2Q5QA 2RHWA 1SWVA 2P41A 3AL3A 5U4XA 1C3OB 4RCYA 2EX1A 4Q9DA 2QVXX 5EN4A 5JDIC 1QPZA 4WLOA 4LYHA 1NJ8A 2F8MA 4HCJA 2XUPA 1RMQA 3KAKA 4MWSA 1R9NA 2QYHA 2SHKA 3EXFB 4ME6A 4TZTA 4E88A 2INGX 5C34B 1C30B 3CUUA 1C2TA 1Z16A 1I32A 2JLAA 3AR3A 1CR4A 5AVOA 3I39X 3TCXB 2GXAA 3UN1A 2CB9A 3FH0A 2UYQA 4HDQB 3LQFA 4V0RA 4D3YA 3G8YA 1SKYB 3R9IA 1UK8A 3U1VA 1J9EA 3V1LA 1UWLA 3ZBTA 2VBGA 1P2FA 3WGNA 2VEDA 3W5JA 3NIFB 3BG5A 3PP8A 2VSXA 1J5PA 3ETNA 1JTEA 3PXCX 3W6UA 1VL1A 1JDTA 2FRDC 3AILA 3ZD6A 1ZM3A 1R74A 4RQUA 4MV9A 2FG7C 4YJDA 4AKGA 2XY4A 4PZ9A 1R0RE 1UXJA 1XVVA 3VH3A 3HUEA 1OE0A 3FSRA 3I9V1 2QOEA 2X4GA 4K5QA 1OLXB 2H08A 2JBWA 1V35A 1PT9A 1CJUC 5KHLB 3ZNPA 3BWBA 1J8YF 2BV3A 2O2IA 3IP9A 2H63A 2VTDA 2QW1A 3LO5A 4QJ4A 1OU4A 5D6OA 3V7WA 3WYFA 2GHQA 4M60A 1QG0A 3GEIA 2BBTA 1US8B 2ZAYA 2ZIFA 5DK4A 5B58C 4CM6A 2GPTA 3DBRA 2D74A 4I99A 1KVUA 2NOAA 3I0NA 1LS1A 5A62A 1HMPA 4M9XA 4A8JC 2X15A 4HR7A 4X1IB 4YMGA 2IDKA 2O2HA 1HQCA 3HJBA 4RA9B 3ZCSA 1EXVA 5E3JA 1RLOA 1ZJWA 1KEKA 3R7AA 5EXDA 4AUEA 4MS1B 3JQEA 4C78A 4GZ5A 5AOCA 4POAA 1XXHE 3W90A 1TAHA 4QWWA 4YUXA 3EGEA 4XW2A 1D8TA 2IF2A 3EQ8A 2VDLB 2D2IA 1MHTA 1JE0A 2CGEA 3N8HA 1MU0A 4DIKA 2BEVB 5LP6F 3JALB 3U81A 10MHA 4TTIA 3P26A 3W5DA 4BV8A 3IKMB 3MOSA 4JODA 2ZPUA 3ZDQA 1XEAA 3VYWA 2O0LA 4D46A 2UZ0A 4HTFB 2DZDA 1HUQA 1QIHA 4OSEA 1BQEA 2VCHA 4G41A 1EUDB 2NPIA 3PCTA 2QLTA 3OHSX 1O77A 1NN0A 2WMNB 3IL2A 4N76A 3THOA 1YV9A 4RANA 1GKIA 3ZY6A 1YFLA 4JP1A 4BEVA 5BR4A 2HV9A 3IEXA 3OX3A 4NARA 1E6CA 2F1IA 4C1BA 3GFTA 3LH5A