1SBTA

Atomic coordinates for subtilisin bpn (or novo)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
275
Chain Sequence
b'AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN BPN'
molecule tags Hydrolase (serine proteinase)
source organism Bacillus amyloliquefaciens
publication title Atomic coordinates for subtilisin BPN' (or Novo).
pubmed doi rcsb
total genus 81
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1972-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sbtA00
1P8JA 3LXUX 3TECE 1SVNA 1ST2A 1SUBA 2V8BA 3DE7X 4LVOA 2DP4E 1T1GA 1TMGE 4NMXB 1KDZA 1C9NA 4OMDA 3TI9A 4DZTA 3WHIA 5FBZA 1AF4A 4CFYA 1BH6A 3DVRX 1NDUA 2W2QA 5FFNA 4HVLA 3A3NA 2PWBA 1BFUA 1IC6A 4NE9A 1Y33E 5AMXA 4LVNA 3DDZX 2WWTA 3I2YX 4Z2AA 3H42B 4H6WA 3DE1X 2X8JB 3PRKE 1S2NA 1NLUA 1SH7A 2ST1A 3OSZA 4H6XA 1KDYA 3SICE 1XF1A 3EIFA 1KE2A 1TO2E 1SIBE 2B6NA 2Z30A 4AKTA 1SUCA 1SCDA 2SNIE 1PFGA 4WOCA 3GCXA 5ARBA 2X8JA 1TM1E 1TM7E 1Y1KE 3TI7A 3DE6X 3I34X 2DUJA 1LW6E 3DW1X 1R64A 2W2NA 1SUPA 4WOBA 1SELA 2WV7A 5ARCA 1OT5A 2Z58A 1GNVA 4KG7A 1YJBA 1BFKA 5JXHA 2ZRQA 2IY9A 2XRMA 2PYZA 1DUIA 1Y34E 3LPAA 2PRKA 5JXIA 1CNMA 1S02A 1YJAA 4C3UA 1AU9A 1R0RE 2XTJA 1C3LA 1SBCA 3VTAA 3CNQS 1SBTA 1HT3A 1Y3BE 3EE6A 3F49S 3HJRA 5FAXA 3ZXYA 4C3VA 1Y48E 3T41A 3WIUA 1TO1E 3VHQA 1GA1A 2DQKA 4H6VA 5B1DA 1BE8A 1SPBS 1WMFA 2WUVA 2W2MA 2Z2XA 1SIUA 1T1IA 1VSBA 2W2PA 2Z57A 2TECE 5AQEA 4AKSA 3DE3X 5I9SA 1SIOA 4JP8A 1TECE 2IXTA 3SQOA 1A2QA 1MEEA 4M1ZA 1IAVA 3DVQX 4HX2A 1KE1A 5SICE 1PTKA 2PMWB 1BJRE 1SUAA 1Y4AE 1P7WA 1OYVA 1EGQA 1T1EA 3DE0X 3DVSX 3DYBA 1V5IA 4ZARA 2P4EA 3UNXA 1GTG1 2ID8A 2HPZA 3DE2X 3AFGA 3BPSA 1BE6A 3GT3A 3LPCA 4RYDA 5AVJA 1THMA 3BX1A 3F7MA 3I30X 3Q40A 1Y3FE 1YU6A 1SBNE 3VV2A 2E1PA 4MZDA 1AVTA 3A3PA 3DWEX 1Y9ZA 3I37X 1EA7A 3D43A 2HD4A 3VYVA 1AH2A 5JXGA 1SBHA 1Y3CE 1V6CA 3AJ9A 5CW1A 2Z2YA 1Q5PA 1SCBA 2ZWPA 1PJ8A 2SECE 2G4VA 1GTJ1 1C9MA 3VV3A 5B1EA 3DW3X 1YJCA 3QTLA 1GTL1 1TM3E 1Y3DE 2SICE 3Q5GA 1SCAA 1KDVA 1JEAA 4YN3A 3D9QX 1WMEA 1S01A 1SUEA 3DE4X 3WIVA 3QMPA 1DBIA 1P7VA 2SBTA 2Z2ZA 4NE7A 5ARDA 3P5BA 1GA4A 1NDQA 4DWWA 1GT91 1OYOA 5K7SA 1TM5E 2GKOA 4CG0A 1SCJA 2WUWE 2W2OA 3A3OA 5JXJA 4CFZA 1C9JA 1TM4E 3F7OA 2PKCA 4KPGA 1GNSA 3PTLA 4KB5A 1TK2A 5JMOA 4OV6B 3BGOS 3GCWA 1SBIA 5AVKA 1WSDA 4OMCA 2PQ2A 2QTWB 1ST3A 1SUDA 2ID4A 2ZWOA 4BWGA 1CSEE 1SCNE 3LPDA 3QFHA 1GCIA 1MPTA 4B5LA 1SN7A 1PEKE 1WMDA 3AJ8A 4FONA 1WVMA 3GT4A 4GI3A 4DJ5X 3L1KA 1AV7A 1ZVKA 2PWAA 3DE5X 3ZXXA 1AQNA 1ZVJA 1UBNA 1GA6A 3WQBA 4ZOQI 1R6VA 3EDYA 4J94A 2Z56A 1Y4DE 4I0WB 4K8RB 3VSBA 3CO0S 1AK9A
chains in the Genus database with same CATH superfamily
4X1IB 2V8OA 3JQBC 2QD4A 5TC4A 1TA0A 1X15A 4G1BA 1IXKA 4MO9A 2HFJA 13PKA 1T0JB 1T9GR 1C2YA 2G5PA 2JFOA 3GO4A 4XGNA 1IBRA 5CEFA 1E0AA 5DX8A 3RODA 1KJ9A 3LAWA 1QVAA 4AO6A 1D0VA 1CQIB 1G5FA 4M46A 4PC7A 1Y4UA 3EG5A 5AHRA 3LFUA 4LMRA 3FNEA 2EHDA 3JQGB 2QM0A 5D5PA 2PEYA 2Q6IA 2HFKA 1ORIA 2R6JA 4RAOA 3ESAA 3DPUA 3HU1A 5B3LA 2BFCB 3VO9A 2JI7A 1HETA 3HDVA 1CUSA 4GGPA 2AOUA 2KX7A 3AGPA 1YBVA 5L45A 2R68A 1EIWA 1P2VA 3UJ9A 4O4IB 5DT2A 3ZGLA 2GQ0A 1HNWB 1DKQA 1DTSA 1U0BB 2HQBA 4PC1A 5LZ5A 2ZTLA 3AV3A 3O8BA 2NQ2C 4KE8A 4KMSA 2CVFA 4CNBA 1U0LA 3Q6NA 3OSUA 4EA7A 5J2UA 4TYQA 1GZ6A 2BGGA 2B4QA 1RXWA 2F1KA 4W5WA 1XVLA 4NCNA 2IHJA 3RJ9A 2WTUA 2J0QA 3WHLA 3RVNA 4IMJB 5ADWA 1TD9A 4YMVA 4UQOA 1SJ9A 4F2GA 4EPWA 1ZGJA 3LY9A 5AM5A 1AN0A 2RJ3A 2VDWB 3WMFA 4AKSA 4D8WA 1DRWA 3WK4A 4ZIRA 5EI5A 1X8JA 1Q0HA 5DYTA 5E7MA 3MFYA 1REQA 2XUJA 1I7PA 3JD3A 3NXKA 3MN1A 1AUVA 4QQRA 3PC3A 4LXQA 5IMBA 1T5BA 5HIAA 1L3IA 2P90A 3PIRA 4MOWA 5HGJA 1Z0UA 3AUAA 3BG5A 4D9JA 2VAVA 1THMA 5E0KB 2QIOA 2NUPA 3NOVA 4ZU1X 3VV2A 2GN6A 3ZCVA 4F91B 1QIHA 3OE1A 2PYDA 2ZUDA 3LCJA 4KO8A 4C4TA 2HJRA 4CYMA 5EEHA 4WFQA 4GLFA 2CVZA 1L5WA 4NCIA 5EXPA 2VPZA 1YXMA 2Q1WA 5HBGA 1D5CA 3OF3A 1GV1A 3ZZTA 3KOOA 3OG9A 4BLTA 4C0HA 4U3JB 4A2WA 4L50A 2QN2A 1I4EB 1JYSA 1MA3A 4CIYA 1SCIA 2GHIA 5EIHA 1MT3A 2QQEA 1NUAA 3ZZNA 1H6AA 3TIXB 2WBLC 3ZWAA 1OYOA 3CX6A 3CZAA 3G5AA 5C81A 1EXNA 5D51S 4YCBA 4KGZA 3PDIB 1XZHA 2W2OA 4O4LF 4OBEA 4B3CA 2VF8A 4I46A 3RVSA 4HNQA 5AT1A 2PKCA 1RYYA 1V16A 2DUMA 3FBWA 4HEQA 2WYUA 3WRYC 4YO8A 5E9QA 5CYFA 2DULA 3LBFA 4B82A 1PVVA 4ZQGA 3HA3A 1I51A 5G1PA 4DV6B 1PDVA 4B43A 1GPNA 4F60A 1GAWA 1UBFA 3GL9A 1CJVC 2BL4A 2WU3A 2HA5A 3DZCA 3GJ4A 1XKXA 1E66A 2C9BA 2HWUA 1T9BA 3G6WA 2CXSA 3W4IA 2QVBA 4WZAB 3TLEA 3W5SA 1G5TA 3WIEA 5HWSA 2AN1A 3OA2A 4GR4A 4N4AA 4C20A 1Y6FA 2O2HA 4LRWA 2YNMA 5KOHA 1B8OA 1WBJB 7ADHA 1KK2A 3WB1A 2A3NA 2Z3ZA 4TZ0A 3ZWBA 2QT0A 3PC8A 4CQMD 4AQYB 1Y81A 2JD2A 3I0NA 4NMLA 2JH8A 2QYTA 2W43A 5D6NA 4F3YA 1UQUA 3RRFA 1DPGA 1NP3A 3BFPA 1U2RA 3JASA 1O4VA 3EZFA 4CMBA 3OJEA 5JJIA 2I4TA 1E5TA 3M6FA 1MOQA 2OCBA 5CGZA 4PG5A 3FLMA 3ECSA 1PWXA 1R88A 3LF1A 1FNNA 3AETB 5CX4A 1DJMA 3H3XA 5TJHA 5G0UA 4OLBA 4E1AA 2D54A 2ST1A 3IP3A 2WUGA 5L95A 1SOUA 2NXEA 3ONVA 1SD5A 3GRYA 2C2OA 1QQ7A 3HSKA 4AWBA 2CZCA 5LM3A 3DTTA 1OAAA 1SM4A 3KYIB 5G3ZA 2QSJA 4YGYA 2O2ZA 1ZGBA 4OKNA 5DBOA 3O3OB 1HXHA 2DUJA 2QZZA 1GWNA 1Q1NA 5E8JA 3D3NA 4Q18A 1F6WA 3DEFA 4WK6A 3MOIA 4P4SA 1EWYA 4MV3A 4YX9A 4WRRA 4JNKA 5FNVA 4Z8YA 2TS1A 4RPCA 1UT8A 4IJVA 2IV2X 4UPEA 4EG1A 1J42A 4MWSA 3USZA 1Z15A 1QH1B 3PUVA 1UXOA 5ETJA 4PC2A 2G7MC 2NM0A 1BU8A 2FDRA 3UMBA 3K9HA 1D2RA 2ZR7A 3AVUA 3P4YA 2FLKA 4UNIA 4ZYTA 3GGCA 1H94A 2UUPA 3E7XA 3WWYA 2LWIA 1SIWA 2XZPA 4W8HA 3ZU3A 5AVWA 4RZHA 3NWOA 3E7WA 1Z47A 2OAGA 4QYIA 4AS3A 4E07A 5KX5F 1IL0A 1YZVA 2QTTA 4FHEA 4G5OA 4PSDA 4RKWA 4F2WA 1SMKA 1Q7GA 1AS0A 3RYIB 3TSCA 2VCHA 3IQWA 3T0IA 1WCV1 4YNBA 4PR0A 4IIFA 1H9CA 1DX4A 1K0UA 4NLLA 1H8HD 1MTOA 1SBNE 3NG1A 3FOCA 2WWGA 3OPYI 4WZAA 4AXBA 4HH1A 4FDLA 2PBRA 1IN8A 4FBLA 1QSGA 1RQLA 2VVTA 4GM1A 4JLSA 3K6SB 5EJ5A 3FMOB 1C7QA 3MCZA 4DMGA 1KZ6A 3ZHYA 2X3UA 2HI0A 5EKTA 1XZJA 3GRFA 5CVJA 4LQCA 1BKYA 3PQ4A 4YGXB 1V1MA 1NUHA 3KVYA 4CG1A 5K8CA 2CDRA 1GFSA 4DWWA 3P5BA 2R00A 1YT5A 3U7HB 4AZ3A 3TMKA 4N82A 3PQ8A 3P9SA 4ENSA 4D5EA 4BUJA 2JLVA 3GRAA 2X3FA 3IAS1 2H3EA 3Q0IA 4HQNA 5HSGA 2NSLA 2QJFA 2R8XA 1J2UA 3TYXA 5KTSA 2FCRA 1G8HA 1N6KA 1XRPA 3ZNOA 2OLKA 2JJ1D 4D02A 1QX4A 4G0OA 4DLLA 5KYKA 4ERNA 2O23A 1XMSA 1MOSA 2NX2A 3RK4A 1WABA 2Q4TA 3QPBA 4HFNA 4MW2A 4PG7A 1SHTX 4LBWA 3ZQ4A 5JHHB 4ARIA 1A4IA 3VH4A 3ZZUA 2ERYA 1U7HA 1Q1AA 3KWMA 4R0MA 1O5TA 4I3FA 1XVUA 1QTNA 4LJ6A 1MB9A 3IT0A 1R4MB 4W7HA 5HJ2A 3QLJA 4CCSA 2FPIA 3CVUA 4KYTA 2Q9AA 4ZYLA 2O8VA 1CT9A 3WMWA 4A8HA 3WLJA 3CKKA 4LYYA 2V0GA 1R5JA 1NP6A 1KZYC 1U99A 3BHNA 3QHQA 4QOJA 1EAYA 2ZUUA 3F8TA 3JZFA 1FYDA 1TLTA 4K81B 1G5RA 4BN4A 4XE5A 2W37A 1QPBA 1SKYB 3KJHA 2A33A 3JWPA 1US8A 3N76A 5FBZA 5LBIA 1ZI8A 2AUTA 1TVKB 1D4OA 3TTXA 2I9PA 3CUYA 4NTZA 4BPBA 1T2EA 3NDRA 3VO2A 5DHSA 2X13A 3CUEF 3IVXA 5AHKA 4TOIA 4F8JA 2IDMA 3NHKA 1RRGA 3O4GA 1XA4A 3HUUA 3KB2A 3Q9LA 4HFJA 1VCHA 3TZBA 1Y1LA 4BIMA 2GN1A 2QAGB 4R9SA 4Q21A 2OO7A 1V35A 3ZJTA 2QJWA 1JHDA 2KI5A 5ALWA 3VFDA 4DNQA 5EZYF 2C2HA 1GZDA 2GEKA 2R6CA 2QUBA 3B3QA 3FOZA 2PSJA 8OHMA 4O2AF 1JTVA 2GESA 1Z4OA 2A0KA 3NALA 3IE2A 1W46A 4H3VA 1MJGM 3H0EA 1S4QA 2EQAA 4H4DA 3C8MA 4HAWA 2YJGA 4G9GA 3AR8A 3RVPA 4B6QA 2HU8A 2RGXA 3FPJA 4WJKB 5EUBA 3RAFC 3C3DA 3VAAA 1OYYA 4YI3A 5HEKA 3V8EA 3UATA 4OX9Y 2V6MA 1SPBS 4XWOA 4CT5A 4US0R 4JLWA 1UXJA 1P1RA 1L5ZA 2GJ4A 3F5FA 1FFEA 3L0DA 5DDIP 3M9XA 621PA 1I4WA 1R15A 2AXNA 1JSXA 1SIOA 2H59A 4X8OA 3ROZA 1P7YA 1T2UA 3B1ZA 2RB5A 1HL3A 3D2LA 3Q85A 3RS5A 1PJZA 1IXYA 1HRDA 5ALOA 4U4AA 5EJIA 4Q6BA 2YV1A 3PGMA 3A4LA 4HS9A 1J1IA 4D0RA 2Q49A 2ZSAA 1XCPA 4IJ5A 4D4MA 1EZ4A 1SB9A 4Z0TA 1R3DA 2H5JA 1AIPA 1NKSA 2YC2C 4E5VA 2CV0A 1V39A 1JYFA 3I30X 4P33A 1VKZA 2E87A 4UXHA 1COWA 3QLUC 1IHYA 2D8MA 2I3ZA 4INZA 3TJMA 4YCAA 4BEJA 4FKMA 5U1PA 4B7AA 4ZWNA 3UWMA 2XZOA 2DWUA 2G9QA 1C9KA 1V6CA 3AJ9A 3DC7A 3GFPA 5FFFA 3RU9A 5CFMA 2IEAA 7YASA 3QU7A 4ZI5A 4TYYA 3MWKA 3R7WB 4K1LA 4QUJA 1FDTA 4JP5A 3WL8A 4RIHA 4KQXA 1O94A 3FMPB 4F7DA 2ADFA 2C2GA 3F98A 3E0XA 3QY0A 4RDCA 1ECGA 1TAQA 1TXGA 2NT3A 3E3MA 4UUBA 4BZXA 4LY0A 5E1MA 2Q2WA 3GD7A 1ULTA 4C7VA 1P7PA 3VR6D 1YDMA 3IUEA 3IVGA 2AZ4A 4RA6A 5H4GA 3K35A 4OCZA 5ECWA 5IBQA 1WXIA 1E2NA 1NASA 4AW9A 1O5IA 3MLBA 1UBHS 1SG9A 5H82A 1YR3A 4D9IA 2JI8A 3ZHCA 1JPVA 4QJ3A 3WK6A 4MGEA 3SX2A 3N2GA 4D4IA 2RI6A 4RWZA 5I7HA 1ZJWA 3KSMA 4YHBA 2P69A 3KVOA 1FP1D 3H8WA 4GQBA 2AI3A 1CZNA 1NI5A 1XVTA 5IVKA 5H3LA 1ECFA 3P0JA 2F2TA 2WQ7A 3H11B 4TMVA 3ZK9A 3ZWQA 4CQMA 2BFEB 2WYIA 1NOIA 1DV1A 1FFSA 2XMSA 3K9CA 1U3UA 4HTFB 2QT9A 2QG6A 5EUMA 1X7WA 2XITA 4OB8A 1WP9A 2FTKE 4OLJA 1X39A 2FW7A 1DC3A 1PF7E 1EFTA 1OI2A 2UZ3A 1K6IA 1H1TA 1U9ZA 3AH8A 1VL2A 4TWIA 3RM3A 2C7OA 3NC0C 4QXPA 3VMFA 2WWWA 2PWBA 3CMCO 3AU9A 1ELOA 1XMXA 2EFHB 4ML3A 4FQ5A 3AEKA 5F98A 5IABA 4GR5A 2VNJA 3H17A 2UZ4A 1JLMA 4MA5A 3ZCSA 1IN7A 1TO6A 2R84A 1TZ2A 5JEEA 1PFGA 5GJWC 2H8GA 3IILA 2W6ID 4RMNA 5DM4A 2Q7OE 3TDKA 2CF6A 2A4MA 1WSWA 1UAGA 2FXIA 4JJ8A 4X41A 4XUEA 4DMUB 1TU4A 1LX6A 1X9HA 4FR5A 4K9PA 5CDFE 3HGMA 3U6BA 1Q95A 3UW1A 2HMUA 2AN3A 1QGZA 1R6BX 2VT6A 1U7OA 1ZIDA 2DWPA 3ROMA 4QOIA 1Z7YA 2JKYA 5JNUA 1OXMA 2IPMA 3HGQA 3HBFA 3VR6A 1T6NA 1A5AB 2H06A 1M2JA 2YHIB 4K40A 2R4TA 2OXTA 3NHYA 1OGIA 2WVAA 3I9V1 1Q3KA 2NTYC 3IHWA 5C32A 3IDOA 2P4SA 2IFTA 3SQWA 2X1LA 4OLAA 3N0RA 2HLDA 1FW6A 1F2TA 1RWMA 2AJBA 1SCUA 3IH5A 1ZCFA 3S1LA 4O2BF 1P5ZB 3RRMA 5FF9A 4QTYA 4ZYVA 1X3LA 2BFFB 4NCJA 2IV3A 3HCWA 3ZGOA 5BNZA 1M73E 3S28A 4ZCSA 2BEUB 1IQUA 2FOIA 2OY0A 3UCXA 2JAWA 4WACA 4E5YA 3MJHA 1LQUA 3KOWA 2RGWA 3FJ1A 2JW5A 3NWJA 4I55B 3HJNA 3BX1A 2C7QA 5BUQA 4XWYA 2RHLA 2FMFA 1NYTA 2XTZA 2VWGA 3OCWA 4D0SA 4XJSA 3N1UA 1GCUA 1Z12A 2F43B 2NVBA 3QLTA 2F1JA 1AKYA 3LO8A 1H0HA 3CVVA 2QRLA 4IX9A 4XTRA 4GOND 4YDSA 5BSVA 4BASA 3LL4A 4Q3DA 2GXUA 3T5BA 1P0FA 1IEQA 1L5HB 3O8DA 4S1WA 2XPCA 1G6OA 1JZTA 2QTVB 2M1XA 4P80A 3LRTA 1W1IA 3FHCB 5CBPA 3JV7A 4MQBA 4G4IA 3BE8A 4F4FA 2H4ZA 2IZ5A 4MQEB 5FCDA 4RPKA 4L9SA 3AXSA 3C87A 2C9ZA 4OY3A 5MDHA 4MUKA 2HDHA 2HUPA 2WPDD 5CJPA 5AK5A 1A9OA 4KR6A 2QTWB 1A5TA 1EDBA 1U04A 4L0MA 3CR8A 2JGFA 2EDCA 5DRYA 5GIOE 3B1WA 1RPJA 4QU5A 3TLGA 2WICA 4X00A 1T10A 4DCGA 3AF0A 3AJ8A 4OFWA 4CLRA 1JKXA 3K32A 2DRIA 2VDJA 1AV7A 3D1JA 1PV1A 2PX2A 3TINA 1QP4A 3LVRE 3IAS6 5E3JA 4LF9B 1CD5A 1NLMA 3U3DA 3CONA 4CHTA 4KQ6A 2WQZA 1XO1A 3T9AA 2Y92A 4Y6OA 4IKEA 1M8KA 1R3UA 3QUAA 4EPTA 4FEAA 1LI5A 1I3LA 3IXMA 1LF0A 1JA0A 1B73A 1I4LD 4CBVA 4EGCB 2JFQA 1SU6A 2RHBA 2JFXA 3PVCA 1NDHA 3WRVA 1YA4A 3AONB 2VWQA 3TZQA 3EA0A 3INTA 4Y2TA 2VHVA 5J1TB 2EJTA 1G18A 2XMBA 3EGWA 2ZOSA 1JMKC 3OQ6A 2AZTA 5KU1A 1LX7A 1Y42X 2IOHA 3V8RA 1MOZA 1YHYA 1ADGA 4YY3B 1IPHA 4KE6A 4ZMBA 1ANKA 1YOVA 4JI8B 3PX7A 1K3TA 2Q3DA 1N0HA 1QYRA 1DT5A 3J81k 2DR3A 1OLUA 3BZWA 3MGKA 4UNNA 4DA7A 1YRAA 4NH4A 4XPIA 5FO0A 5TS2A 1GSAA 3LA8A 3MTGA 1T5SA 3W7AA 1CEYA 2UVPB 4B6OA 2A5YB 4I1UA 2Z9CA 3FDZB 4JVLA 3Q8MA 1A7KA 3LQQA 3DDCA 1KFCB 1G21B 3SZUA 2SCUB 4MGHA 3RJZA 1YL6A 2Q8NA 1SUSA 3V9AA 1WR8A 2GPYA 2E6KA 2IUYA 4RUKA 4TLMB 2X9NA 1U11A 1LBIA 2HZBA 3RT7A 1M34E 3ETNA 3V4VB 1VJCA 5FA6A 2CDNA 5LZ9A 1LD3A 4U1RA 4UE3S 1HNXB 3KL2A 1HZZA 2MHCA 2CL0X 3GFVA 4GM0A 4J6EA 1N2SA 3SC6A 4ARVA 1NUTA 3ENQA 3O8QB 5AK3A 3G8AA 4FOPA 5KQSA 1G66A 4KTTE 4O1HA 1PSWA 1R6XA 4HYEA 5KTTA 1FFHA 4TKVB 1NRJB 5IKMA 2HHLA 1YFKA 2XQGA 4JBXA 2P4UA 1UJNA 2OGTA 3ORQA 3PKZA 5JH7A 3WLHA 4H4CA 1ADCA 4CKYA 2CLFB 4HAOA 1YC2A 3ADBA 4CEJB 3LT4A 4R3UC 4IVNA 2NYVA 3I32A 1IUKA 6LDHA 1Z13A 3QNMA 3B7PA 3W6OA 4WCVA 2G1UA 4JLJA 2XLBA 1V4NA 5IF3A 4YCJA 4CI9A 2NGRA 4JJ7A 4I1VA 4OQNA 2ZREA 4M87A 1TJPB 2QN7A 3IBTA 3DCJA 5FIUA 4NZNA 4PGAA 5EERA 2Q29A 3R3SA 1U0GA 1E3IA 1UL1X 2PEZA 1NATA 1EJ0A 1H2RS 1P7VA 1Q17A 2VDWA 3Q3VA 4LDAA 3C7TA 4R6WA 4ZIRB 5HUJA 5KYTA 3DOOA 3IT1A 5GONA 2QL6A 4EUHA 2O1XA 3SJUA 4R1OA 4X91A 2DJ5A 3UJ8A 3VNAA 2O8BA 2I66A 4G5GA 5CP8A 1MRNA 2H2GA 3MWLA 4ZAGA 4EA6A 2R8ZA 3T0GA 4YPFA 2B8JA 3ROFA 1Z33A 4TQGA 3V8BA 2L0XA 4LCBA 1ITZA 2IP4A 2VWHA 3PQEA 2VBIA 5ISMA 2A8YA 1RWOA 5FLYA 1E3DA 1PZXA 4X8LA 2R8PA 1GCIA 5C7LO 1XTJA 4B6EA 2PMEA 1ZD4A 2WZQA 1REQB 2WYOA 3L1KA 4WK4B 3O0DA 3IOBA 1ADFA 1AKNA 3AV0B 1T3ZA 5FWDA 4J94A 3EA4A 4MVJG 2IZ7A 3O03A 4DLXA 2VQ3A 2N46A 5B64A 5CFZA 5PGMA 1XPOA 1NW6A 1QZXA 3L9WA 4FD2A 3KJQA 1ISGA 5ALIA 4YRSA 2NNLD 3OLWA 6CHYA 2HADA 2Y1DA 1J2EA 2Y2VA 5E4JA 4EO9A 1I32A 4PHTA 2ZJ0A 3LXMA 3PUKA 5DWDA 5CDYA 2VZ0A 3H7AA 3KVNA 2FXVA 1Z6YA 2J59A 3JQEA 3E2MA 4KITB 3PDWA 3K5HA 4WHMA 4YFYA 4L4YA 4WECA 2EWVA 5BRNA 1J1ZA 1K7YA 2IU6A 2ZPTX 3ACCA 4FWIB 1EG7A 1FQOA 1HH4A 1WHSA 3DMTA 4PC3A 3VKWA 2X7JA 2WSSA 1BX1A 2I7VA 2QRQA 1FB5A 1BCSA 1LKZA 1RWWA 2BEJA 3LZ6A 4OKIA 5TRTA 2PH7A 3TXYA 4NXNB 3N70A 5E1OA 1WOMA 3IL2A 2CD7A 5FP0A 1UMBB 3MB8A 2Q3FA 5E1DA 3M4ZA 5A5GA 5K20A 1GCAA 3WBJA 3VZCA 3A7EA 2X41A 3K5IA 1XD9A 1YJBA 4PHCA 4LXGA 5CLLA 5EE5B 3L4EA 3WQRA 5FOTA 3VUFA 6NULA 4B6JA 1OXSC 5LNK1 2ZE7A 1C4XA 2MU1A 4OQQA 3CUTA 3H5LA 1QAOA 1T2AA 3EYWA 2YICA 3I5AA 4JR2A 3KWLA 4JT4A 4L57A 3VA7A 4U0JA 1KJWA 3LKZA 3T7KA 1WY5A 1G19A 1NA5A 2JVJA 1HUQA 3OC6A 5JMTA 5DNWA 2LNDA 3R2JA 1HDRA 1TYZA 4JKIA 1TECE 3QBDA 3WFJA 2R8YA 2OD2A 3IJ5A 3A4TA 3OOWA 3TDMA 3UTDA 4GSLA 1VMIA 3BMOA 1ID1A 1O8CA 3DBLA 2V7BA 3BSFA 3G5LA 4HX2A 1FNMA 5JTTA 4RD4A 2XT6A 1EGQA 1EU1A 1FSZA 1PK9A 4B46A 3VR2A 4DTIA 4QIHA 3E7FA 4XUCA 4MHOA 3I23A 3KQOA 1I2ZA 5MN4A 2YS7A 1QBKC 2GBGA 3L79A 4V0NA 3U37A 4Z4QA 3DZIA 4ZVNA 1OY1A 3TPFA 3ZHSA 2YWEA 1VTKA 5JYDA 1E3WA 3RS4A 3VSDA 4TQUS 2BBWA 3QVKA 3BCHA 2CLLB 1HYBA 1WB6A 1QH8B 2GPWA 3BWCA 3RBAA 2HXGA 3EGEA 3IJRA 1A88A 3FY4A 1U3CA 5KUTA 3W8EA 5C5IA 1PBNA 3A1DA 3ILHA 4H7JA 4LK3A 3H9EO 5HKOA 3K0HA 3IA2A 3PUJA 4G1MB 3WDSA 4C3OB 5HFJA 2FX5A 2ZJAA 3LDAA 5JMPA 3C3XA 2YJTD 4QBFA 4F4DA 3E82A 1K06A 1Z8HA 4GQIA 4EQ6A 4NYIQ 1U5BB 3U4CA 3ZY4A 1BMFD 1QDUA 5AW4A 2W93A 5IN4A 1MO6A 4Y6SA 3MTBA 2PX5A 1CB7A 2XF2A 5HKBA 3C43A 1KC3A 1RHKA 5KQGA 4QYWA 2Z08A 3B1JA 3H4IA 4AB1A 3U7IA 3LOUA 4RHCA 4YRRA 3AQIA 3HWX1 1SHKA 4RGYA 4AI6A 4NV0A 7GPBA 2F48A 1ZIPA 3ED5A 2AV6A 2FEOA 4RKRA 2VBCA 4OM7A 4AG3A 3IEUA 2QNIA 1YONA 4V24A 2W9XA 1C3XA 3F6PA 3M2TA 3KB6A 1IZ9A 2A78A 2PT7A 2VATA 2ZS9A 4JENA 4KU4A 4HLQB 1WDLA 2FWAA 2WJGA 5CT5A 1TMGE 1M74A 4W63A 2IPAB 3PJRA 4HLUA 1ZLYA 3LQ2A 2JHFA 3A14A 1ZUD1 2B5VA 2PS1A 3BMCA 4OYRA 4OHMA 4K3VA 4AF6A 3TR5A 4ER7A 2DHRA 4LW8A 4GLBA 2IK8A 4PLVA 1USVA 3KTDA 4CNQA 2CF5A 2OHHA 4YHHB 3DLBA 3D4IA 3MBOA 5EPUA 1EBUA 1DAPA 5DGTA 3OMWA 3M89A 3Q12A 3NM6B 5DI3B 3SYKA 1Y6JA 1TM1E 2MSNA 4M53A 4EHLA 1TZMA 1R0SA 2FN3A 2IU4A 5E2BA 5AXBA 1U0SY 1E9BA 5LJIA 4TXJA 1UBMS 3ED1A 1EFVB 1H6DA 2ZSUA 3PNVA 5DBHX 2PU7A 1TK9A 4IVRA 2BOVA 3PUYA 1XCBA 5TDHA 5IYZA 4KXUA 1W581 2XTJA 2YH2A 5G53C 4TXLA 3Q98A 4G0YA 1QV6A 4W1PA 5BOSB 5LP6C 4HD8A 1MO3A 1TL7C 1VIVA 2VJQA 1LDMA 3I9NA 4M37A 4UEKA 2X1HA 1MC1A 3B6JA 3B5JA 3TB6A 4AX8A 1FDVA 1UWLA 4L5JA 4D7AA 2BT4A 1G42A 4TT3D 2HHJA 1MLDA 2BEVA 3D7LA 5K0CA 2ZM5A 5D00A 2ZTSA 1QQ5A 2RFLA 3JQDA 3T3GA 5KINB 2Q9BA 2HJWA 3EMDA 2JGIA 4GF5A 2WD7A 1P0PA 1LF5A 2H31A 2O5VA 5L6LB 3CLRD 2PMDA 1FS4A 2Q2OA 1NMQA 2VNIA 3D7KA 1EBFA 3JD0A 3NAGA 3E0QA 1V1RB 4OHPA 4R98A 5DISB 1PTKA 1K8QA 4D92A 1F6DA 1SULA 2Q1YA 2WUEA 1RRPA 3DKIA 3GQVA 3H6KA 3SQLA 5BRAA 5IARA 1HT0A 2DFKB 4GC9A 4NAVA 1S5PA 4PRKA 4KQEA 1KEZA 3AKEA 1AH2A 1JILA 4YJ3B 3CB4A 4QU0A 4BB6A 3EPRA 2VS1A 4URYR 3V4SA 5JZMA 3NC1C 2QT1A 1RQRA 7REQA 4PHGA 4EFMA 4RESA 1CY0A 1JFLA 1P6QA 4FGUA 4X92A 2A5FA 4YONB 3H5TA 4GOJA 3OA0A 5AKGA 5F52A 3GVXA 4TL7A 2PWPA 4K05A 1QGED 2FK8A 2PZLA 3H1TA 1IB6A 1KSFX 1YJXA 2X40A 2ZQYA 4U9IS 1GXSA 2GXSA 2B82A 1YDGA 1GVHA 3ZKAA 4PVCA 4HQOA 2ID9A 1VLQA 2VAWA 3O8QA 3U3XA 1ECBA 5HFNA 1GNSA 1DBRA 2IHZA 3K73O 1WW3A 4OGKA 4FEYA 3B60A 5FORA 1U28C 2Y6UA 3FZEA 1O97C 2WP8J 2EZTA 1ZJJA 3NKFA 3OFNA 4XD7D 4FYYA 3WLIA 2E4XA 4BAUA 4MWZA 3LV8A 2R7KA 3U19A 4L0QA 1EEHA 2VHJA 2OWDA 3DFKA 2Z6AA 3IAAA 1TRHA 5F1YA 4KODA 1J0EA 2RAFA 3D0RA 3PD0A 4PX9A 5HRCA 4X1KA 3F9IA 4RH0A 1G0NA 1FYVA 4LRQA 3WKDA 1CRLA 4GMDA 1QORA 2BHNA 5BOSA 4DUZB 2QLNA 1U3DA 3C3JA 3LBAA 1J99A 3EBLA 3Q7TA 2EBWA 4NMXB 5JSZB 4JT2A 3SJAA 1UUFA 1VJ5A 3FNIA 1LGYA 5K0GA 2IYYA 4RXUA 4WKOA 2I1QA 4ZEOA 4OQMA 5GY7A 3T35A 1KBQA 5IZCC 3STXA 3FWHA 3OCZA 1QR6A 3DMTC 4HXGA 4MARA 3NM4A 4WUVA 1DWOA 2PO7A 2DPGA 4QJ4A 5LA6A 2RK6A 2E7ZA 1U7ZA 4G0WA 4U5XA 2RGYA 2C57A 1XROA 4OXIA 1YB7A 4YLGA 2ACWA 3I58A 4MI9A 3T7AA 3W5DA 2W4IA 5ELLA 2J5QA 3UANA 2X0NA 3IUQA 2KLHA 2ODEA 1HDOA 4IMPA 5FBWB 4X66B 5JAMA 3AOEA 4OTZA 1MVLA 1T0PA 2WKWA 3V1MA 5K8VA 2B8EA 1KYQA 1GPMA 3IBSA 1XPJA 1E79A 2HMAA 1CV2A 4LDZA 2OCYC 4L75A 1DBSA 2X7XA 1C3LA 1SAYA 5FXMA 2OCAA 3G2QA 1PJ2A 1PQUA 2FG5A 5BP7A 4RBNA 3IDZA 2Y68A 3H9BA 4BX8A 3WRYA 4Y6GB 2NZ2A 3KTAA 5DN9A 2B78A 3PHIA 1WMFA 3NIFB 3HSYA 2TECE 3WAGA 2RC5A 5A4IS 2YQZA 3I3OA 1KYYA 1RLJA 3SXPA 4BS9A 3LIPA 1Y7LA 1A2QA 3SS7X 3SKXA 4CF3A 4GS5A 1YRYE 2MYNA 5C8XA 1MUUA 1VG1A 2J9ZB 3A6LA 3KHKA 1IY1A 4QQFA 1XP5A 3WSTA 3UGTA 4DC0A 4KAXA 4D4JA 1Z26A 4E21A 2CVHA 1JJFA 4OVKA 2VXYA 4U7JA 2D3WA 2G67A 5EWMA 4U8GA 1DDGA 3CNEA 4BKOA 2CBGA 3HEMA 2DKOA 1IVSA 1UXGA 4QFDA 1OC2A 3L7LA 2X4GA 4F0JA 5EP4A 5AUNB 1U63A 1N8TA 3ESBA 3FAZA 3QXXA 4ZODA 4Q1DA 5MFZA 2JLWA 1XUOA 4Y9UA 2AJ8A 2IJGX 3OX1A 4KX3A 4DUGD 1VE5A 4EYQA 1K92A 1GL9B 1R1DA 2EKDA 2VNKA 2P1ZA 5TIIA 4TLBA 4IWXA 1YFLA 1L5RA 3DNPA 1XQ9A 4TRMA 3K1YA 4YUZA 1K1EA 3NTXA 5AW8A 1WNTA 4V39A 5EIBD 3G23A 3WGKA 1RQ2A 2PUWA 4GYYA 1RAFA 4PV7A 4JLDA 3SG0A 3NS7A 5JS2A 3IE0A 5AVXA 3KE9A 4QWWA 1MW8X 3MQFA 4XH9B 1KP2A 2BGUA 2IZZA 1YRLA 3C5WP 3D7RA 3IOCA 3Q6IA 1VP3A 3OKPA 3QPCA 2FW1A 3OCUA 2DQ4A 3NOQA 1AGXA 2XRYA 1KDTA 5LYYA 2ZRPA 3AYZB 1SN7A 4S1OA 1SO8A 1FMLA 2HNBA 3D3WA 1ODIA 4X62B 1SA0B 3GAMA 5JI3E 2J48A 2QTMA 4PO3X 1ABFA 2JDIA 3HDHA 2P2CA 3H6GA 4UATA 2I4LA 4JJAA 3WKAA 3FYUB 3OTGA 3ZS9A 2Q27A 2GPJA 5KNDA 3A1CA 2JZCA 5AOBA 1ZH8A 1TAGA 4DY4A 3DT8A 4Z7QB 5G0TA 5LA6F 2R6HA 2XY4A 3W4JA 5KO2A 4UU1A 1Q14A 3UMMA 4GVXA 1MKYA 4XUGB 2O59A 4D79A 4N5HX 5I7UA 1DUSA 4R2IA 4F2HA 3JQQA 5ANRB 3BK2A 1MO5A 2E4WA 4TTQA 1Z0AA 2QM3A 4EG8A 1SUIA 1I6WA 1V45E 1XTRA 2WAMA 3OTHA 2PMFA 1T2DA 3WNZA 4UE6A 3H8SA 2REQA 3U17A 2PS0A 3MTJA 1KYIA 5IHXA 4F9FA 4FJ0A 3UJBA 4OL0A 3MWEB 1E6WA 1JR3D 3TL2A 3ZV4A 4LRYA 3MXOA 1ZU4A 3KR2A 4YV0A 3S29A 2ZSDA 2H0RA 2JD1A 4DMRA 1NUUA 3RQSA 3JASB 4MR9A 5C4IA 5KWEA 3CNQS 4J7UA 2M6LA 2X22A 4LYHA 3DOUA 2IPOA 1A7UA 1J8QA 3KU1A 3ZI0A 4ARBA 1WV1A 3N3BC 5B58T 2NOAA 5C1IA 1XKQA 3QA3E 4JBWA 4B40A 2AR7A 1UMCB 3C3MA 1RWKA 3D2AA 3BIXA 4RMGA 3VHLB 3HPRA 3T7CA 1PEAA 1ZJ5A 2N1BA 3WWEA 5JS8A 2PJUA 1WX1A 3QW4B 2JRLA 1PNOA 4OMFG 1NW9B 5DMHA 2ATVA 1DCTA 4I4CA 4KI0A 4RPGA 2OCLA 1CZKA 1UMDA 4ILKA 1K8RA 2IVZA 3IAM6 4WCFC 3KEOA 4CV1A 4E6PA 1MPXA 1ZD5A 4RYDA 4BVKA 1Y8CA 5FRDA 3WK8A 6REQB 4E5PA 1FA9A 1IAQA 1UPCA 4GW3A 4Y0VA 5C8YA 5AO9A 3ROXA 2HK7A 2COEA 2X58A 2IYXA 1MFZA 1DKRA 3FDZA 3FYCA 3GUYA 3K92A 1R8XA 1IBMB 2NO9A 1BE1A 3KXPA 4GZMA 4YALA 2IUFA 4NZMA 4MI6A 4PINA 1CETA 1MC8A 4LK2A 4RHUA 2M6SA 5EXTA 2NAFA 4ASUD 2WIBA 1NX9A 3C1AA 2VPPA 3IEKA 2D1YA 2WPNA 4ACAA 1GRCA 4EB8A 3G9QA 2M98A 3CEHA 3EULA 5A06A 1KI4A 2XUIA 1PR9A 3EMVA 4K26A 3SLRA 4DIMA 5BV7A 5BSWA 4BY9E 2BFCA 1FUEA 1D8AA 4P4SB 1X7YA 2PFKA 2DPXA 4G5RA 1LBQA 2XGOA 3IMGA 4E4RA 4JOSA 3DOIA 5IM4F 2HGSA 3SS9X 1ODKA 2C4TA 5ENVA 3AUKA 3GJ0A 4DG9A 1K0FA 1AM4D 2KW5A 3QMWA 2P1RA 1E3MA 3ICEA 3P97A 4CE6A 2QI9C 3KJZA 4OBWA 1JKMA 1XZAA 4X45A 5EMMA 1JHAA 5IEJA 2PZAA 3DEAA 4Q4AA 2OV8A 4FONA 1N57A 5FTMA 5JS1A 2PH1A 1Z38A 2PVPA 4JR1A 4D99A 2ZRJA 2B4AA 5CJ2A 4U02A 1AQNA 4YREA 4ED9A 3DYIA 1OV4A 4XQ0A 2Q99A 1DG9A 2BFWA 5JNLA 3Q3GE 2BI8A 3IUJA 4TKMA 4S2EA 2FZWA 3WNCA 2E9SA 2X2OA 1P8JA 2EP5A 5ED4A 2COUA 1D2GA 3HJFA 1L6RA 4X0EA 3K0AB 4UULA 1EM8A 4PX3A 3CUUA 4AZ0A 3WHIA 1H2XA 2LCQA 2QYOA 5FWYA 2P2NA 1W29A 4IJ6A 1RYBA 4BLPA 2VPWA 4R7TA 2ASVA 3W8DA 1WCIB 1RQNA 3HCNA 3IPXA 3TUJC 1UC4B 1E18A 2YWGA 3INYA 1HEYA 1JQ3A 4OXYA 5I4CA 3AR5A 1YKGA 4F1JA 1KOGA 4BLQA 2DTEA 4QQ8A 1IATA 1L5FA 4KWCA 2H2DA 1GGFA 2ZBDA 2AQKA 3RSFA 1ZM2A 3JQCA 4K87A 3THSA 1KI6A 2WILA 4ENQA 4OHUA 3ZTTA 2HWYA 2VF5X 4FP9A 1NR1A 4RM2A 3L7KA 4OHZA 3BFXA 2ZSKA 2JFVA 4X61A 4RKFA 2Q7DA 1CY6A 1ORTA 4CG2A 2EKPA 4Y1GA 1G0OA 4GX1A 2AG1A 4H6VA 2GCOA 1U0HC 2WF6A 3OHSX 4HATA 3PGKA 4DY6A 4H1WA 3JYOA 2ZCVA 4YRZA 1LBSA 3JVDA 3R6LA 4BEBA 1NXXA 2MYPA 2ANCA 2ZB7A 5T8KA 5E7QA 1ONOA 1UZNA 3H2GA 3PDUA 1KIFA 5K6AC 3ORFA 2BSXA 1ULSA 1MO4A 5LQCA 1M8GA 4G65A 1TYBE 1LWOA 3B1XA 3LKBA 1JEJA 2UZ1A 3HUEA 3PGVA 4P4TA 3TLMA 3RSQA 4DPLA 3BH0A 2NSHA 1SURA 3EOAI 2GAOA 4TKZA 2P9EA 1SRQA 2XA1A 1N0WA 1CF2O 5JSHA 3BJIC 5ALZA 3GLTA 4AO7A 1XAJA 3HJBA 3EZ9A 3K8QA 3UAYA 1YIDA 2VJYA 1V96A 1SPXA 4RJLA 4BP1A 1ZM3A 1YR1A 2KS6A 1O96A 2W2TA 2C1XA 1P73A 3ZW7A 4OYLA 3FGPA 1CJSA 3TNFA 3MTIA 2F8TA 2AOTB 1GT91 2QU8A 1HBJA 3K0FB 2ZRDA 2EKZA 4EOGA 5MN6A 3V8PA 2ABWA 1WF6A 2H3HA 4L76A 2P27A 1T9KA 3FHJA 3GA0A 4O0MA 3ZE0B 1H3EA 2LV8A 1SC3A 2NU9A 2O3RA 4OQPA 1MDFA 4M89A 1DJLA 2BTQB 2PAFA 2VQSA 3FUVA 3P4UA 3QVGB 3HBMA 3KDSE 3ZIAD 4NCXA 3FPEA 4DE5A 1QNFA 2GKGA 3DMNA 3FKSA 1IIRA 1X0VA 3WADA 1NHGA 4L5CA 2AXPA 3L6CA 4CF7A 5ALHA 2ZJFA 4CKWB 5TMEA 2BI7A 1MXHA 5HFAA 2XZDA 4KHPB 2VAXA 4ROTA 4HLNA 2YWRA 1VPWA 3TZLA 1U2DA 5LU9A 1P44A 2G0TA 1Q15A 4AXXA 1E7RA 2VBGA 4BUCA 2D7JA 3IUMA 2NMVA 1OH6A 3T1TA 1J09A 3FFAA 4P0TA 1GZ4A 2F1HA 4M7PA 3LXUX 4XASA 1ILWA 1Q0ZA 1ST2A 2PMKA 4KL8S 3SK0A 2CXOA 3KJXA 3MS2A 4UNPA 4HEJA 4KFTA 4WKBA 3WGIA 3V80A 3AHJA 3QKTA 4DDHA 3C24A 3E2PA 1IXZA 2WC1A 1M6HA 1AMUA 4RTJA 2O0KA 4E7OA 5L53A 3ECCA 2J0SA 2UXCB 5K8JB 5TF0A 2ZR9A 3A6KA 2ATXA 4BN0A 2HK8A 2X0KA 4QVIA 2O8DB 3QVWA 3DAGA 3TIFA 3ZNNA 1FQWA 1OI3A 2BSAA 3UGKA 3ZW8A 5AUOB 1CYEA 4MV4A 2WG0A 4IIXA 3HA5A 1H2FA 1P2SA 5HJEA 1X9IA 1NJFA 4AN0A 2C7VA 3WDLA 3WGYA 4YR7A 1VSUA 1WULS 1YTLA 2MR5A 3S40A 4EJSA 2IOFA 4GYKA 3QZUA 4LVCA 4AY5A 1NG1A 1JKJB 4M7OA 4XUDA 1DUIA 2R48A 3DHWC 3WK9A 1T13A 3BEOA 1YZKA 5CA0A 3N7AA 1NF8A 1ZUWA 2VC2B 1L5OA 4L27A 5JVDB 1OPRA 3SIPA 3OTOB 1LXCA 1F20A 3EXHA 1KPHA 1O96B 1I9GA 3F5MA 4FHZA 1O9GA 4PFQA 4YAJA 1QK4A 3E6AA 2V7QD 4KN8A 1DWQA 4NU6A 4QXOA 1O8BA 5F21A 1ENOA 3EISA 5A6SA 4AJEA 4NL4H 3A25A 3T3NA 1WDKA 4LHZA 1R5OA 2RG1A 1D0SA 1XQXA 3VBEA 4DMKA 1QO9A 3SR0A 4Y6RA 5IEBA 2WU8A 4BC0A 4TWBA 3OC0A 5L7YA 3BWXA 4KQ1A 2DVMA 4YYEA 3E9DA 4F5DA 3VC2A 2NQ8A 3K9FC 3QQPA 5DM60 3WMGA 4KXFB 4E5KA 3OF5A 1SBZA 5ALJA 1UIMA 4ZO7A 2QZSA 3DE2X 1VHDA 4RK1A 4L08A 1L7XA 1U8FO 1E1RD 1VPLA 4KMOA 3U4HA 3WB2A 4EGFA 5JBQA 1C3JA 2GYUA 3EARA 2ZK7A 1DOAA 5DYNA 1K89A 1ZC3A 2FUG6 3QKWA 1K5DA 2R79A 1ONSA 3UXEA 2NU8B 2C4KA 3CX4A 4DLPA 2DOKA 3NHRA 5HDBB 3KKEA 1P3DA 3ORHA 1NKVA 5FKJA 4JI5B 3BJRA 3SHTA 3VISA 1PEDA 5EG5A 3E9RA 1N33B 3C3WA 1XP8A 1XZDA 1QJCA 3PEUA 4NICA 1M6VA 4BQRA 1NU8A 1SVOA 1SY7A 1GPDG 3BBPA 5JIBA 1KEKA 1E6LA 4P1ZA 5DXFA 1ZK1A 1OPXA 2QI9F 1WP4A 2DSNA 3IRVA 4PO8A 4JDUA 2O07A 5J43A 1CJBA 2G9RA 1XRNA 2CCJA 1HFEL 1WCWA 1XALA 2PD4A 4JJGA 4G23A 1GQQA 3UQYS 4F71A 5IDYA 5ECDA 4X97A 3M3HA 2I7DA 1NFRA 3TQOA 3NT5A 3JAKB 3KSRA 4K8OA 5GVRA 5FJJA 1TTTA 4HWGA 4P81A 1A9SA 5GPBA 5U4QA 5CX1B 4A3SA 4BNWA 1E7YA 3P0FA 4GOLD 2IHUA 2V4ZA 3FLEA 5CIYA 3I62A 1IJKA 2JL1A 4XX0B 3TM4A 3C3KA 3VGJA 1NMYA 4N47A 4JU9A 2QORA 1RIIA 3ZBUA 4J2OA 1OTYA 1UBTS 1YBHA 1FIUA 4U2GA 2JLAA 1W8DA 4P6VF 3H97A 3P7MA 5HW0A 2DP4E 3JWHA 3L43A 4G5FA 4IDPA 1KYZA 4EVIA 2EX0A 1R6DA 3F8WA 4I99A 5HKKD 2F3UA 1PJ4A 2CHUA 5EN4A 3WZ2A 1DSSG 3H8JA 5JMWA 3N8NA 1HOTA 1X6VA 4Z4EA 1ZEMA 3ZK7A 4NAUA 4D4GA 4DABA 4JI1B 3UAXA 2FPWA 3QH4A 1KVQA 4LWOA 5T3YA 3U5TA 4WBSA 4TQ9A 1F2VA 2O2YA 3TGLA 4TMWA 5AKYA 3WLOA 3NASA 3TF5A 3ADKA 2PK3A 2ZUEA 2X8JA 3LQ1A 4FN5A 5D6OA 5KHLB 3TI7A 1QYIA 2FSSA 3A6FA 3LS2A 1EUDA 2QMHA 3KQWA 2IS6A 4MUFA 3A10A 4F3TA 1CDEA 1U4SA 3HP4A 4FFLA 1DO2A 4QEZA 3UHAA 5IHPA 1W36C 1ZNQO 4NENA 2PCJA 3G0OA 4BAGA 1G63A 3OFSA 4M9ZA 1Z4MA 1CDDA 1R0RE 2R0QC 1ESDA 3I9OA 1SU4A 2OCDA 1T8WA 5DYGA 3EEIA 4QJBA 4RU1A 2XH8A 4E22A 1FX1A 2HUNA 5AQ1A 3AOGA 1N5LA 3KHUA 4OMUA 4R84A 4IX1A 5JJKA 4X7BA 5CNIA 4O4HF 5BNFA 2ZZMA 1W94A 2JBWA 4MV9A 1R4NA 3B12A 2EYUA 1JHYA 3GGJA 4CKXA 5KYGA 5FI1B 3VOBA 3F73A 1IPEA 1T5IA 4BZWA 1IAVA 5CHEA 3BCRA 2AN9A 3MMXA 3OY2A 5D7BA 2W83A 4RSHA 4KFUA 1ZSYA 4B3IA 3REQA 1O9BA 5H1YA 2QXUA 2R87A 1GTG1 1YSCA 3GDWA 2WTMA 3GZTB 4TYMA 3VR1A 1ZAKA 4ZK2A 4G9EA 5B4VA 3GLIE 2C1EA 3X43A 1HTWA 3ZY2A 4EK9A 5BNTA 3CX8A 5F2EA 3E81A 3TGPA 4EGSA 1KYWA 4LJ4A 4EJSC 1Y3CE 2XVZA 3DZBA 3GT7A 5DULA 4LRUA 3LK6A 3OCYA 3VU1A 3HVKA 5KSPA 5KQMA 4Q15A 1B76A 2D1RA 2YWHA 1JFFB 3DHNA 3QV1A 4Q3EA 4FFBB 4HWOA 4ES6A 1O89A 1JKIA 4QGSA 3GLFB 1TF7A 1ZCAA 2W2KA 2WSSD 4ZQCB 2J9XB 2ZT6A 4I5FA 1RLOA 3W1WA 4AJKA 1KQGA 3LH5A 2V1XA 3KT6A 3NHJA 1RYEA 4FWTA 1EYZA 2KHZA 4IV0A 1G2PA 3GMDA 4NBKA 3LECA 4BQPA 3P9PA 2B92A 1UANA 2PX3A 3A4IA 3JQAD 1G5IA 3VR3D 4J9UE 1Z25A 2VDLB 1U3TA 2GCGA 3ODGA 3L4JA 2OO3A 3MRTA 1U4OA 1H5UA 5DW0A 4FNAA 3L7YA 1VLLA 2KE5A 4LISA 4AN4A 1XMJA 2R66A 4M9RA 1JEYB 1WXQA 1RAEA 3JD1A 1NC1A 3OEHA 4ER0A 2M6RA 4N5IX 1F7VA 1AKMA 1PW7A 3AVTA 3CJRA 4FDUA 4ZT4A 4NULA 2PWAA 4O4IA 1N77A 4I81A 4IIBA 5HF5A 2JB9A 3TLGB 3WHKA 1AKQA 5FWXA 3ROTA 1ISPA 3JPWA 3FIJA 1F1BA 2NSYA 4D56A 4NV1A 1NW8A 3R8FA 3NYRA 2L82A 1C3EA 2JARA 2YXDA 3LC7O 3VH1A 4CCYB 4K9QA 3A0UA 2E82A 1DELA 3SZLA 1L4FA 3OEHD 4E46A 1R0WA 3P0RA 5D2CA 4IFIA 1OHHA 1Q74A 4Z2AA 3TJRA 4JYZA 2HWXA 4PICA 1DDOA 1XJ0A 4DV5B 1KE2A 2IHVA 1IY0A 1MB2A 2GMWA 1ULBA 4GKJB 1OAKA 4Z53A 1XNGA 5I4BA 3PX2A 1HR0B 1ZIXA 2EU8A 2XODA 4HH0A 3WO1A 1WTCA 2CGEA 3DWIA 4J76A 3KJFA 1NQWA 2CLDX 2Z58A 3OJLA 5ALYA 5KEIA 2LP4Y 4DBZA 3OPXA 1YBAA 5I7AA 3T1YB 4E31A 5SZHB 1SKBA 1AXRA 4YJGA 3R5SA 2EF0A 3N8GA 3F67A 4JQSA 1EQUA 1NWCA 4MQMA 4LSGA 4BBAA 4JEHA 1ZS9A 1K2VN 4M38A 2HL6A 3AKCA 1T3HA 1PL0A 1L9KA 2H4WA 2XYHA 1HWYA 2ZYGA 4I9FA 5ICCA 2DT5A 1W47A 4RV9A 3B2QA 4DLZA 3QBEA 4DSOA 1XMIA 4LXHA 1DINA 1JB1A 3HDQA 3U7QA 3WR5A 3PFCA 1ICEA 5HKAA 2WHQA 2GJKA 3P9QA 1Z5NA 5KYUA 5HRAA 3PQ2A 1GNTA 4P86A 1M6YA 1ND6A 5ENZA 4G4SO 4IG9A 1F0YA 3MSCA 3WGGA 3BF8A 1S1MA 1OOEA 1RLMA 3HHEA 4JWKA 4JH0A 1Y3AA 2P6PA 2J32A 1F0PA 2I2DA 3FI9A 2QY6A 4I9HA 4PLWA 1ZA1A 3TLYA 1CE8B 1YU6A 3AJRA 2WDZA 2AWNA 4YUWA 5F3WB 4E14A 4L3VA 1JT2A 1OF1A 2VLBA 3ZUPA 3A6ZA 3F78A 3LUKA 2CWWA 4ZU6X 4Y6QA 5LJLA 1EK1A 1E61A 2OGUA 1CR1A 1USGA 2WIKA 2WUFA 3C45A 3EIEA 4UUPA 5E6UA 2NO5A 2Y1OA 1P2BA 3JW8A 3QEOA 3TIVA 3MA0A 5AXCA 4LHEA 2O8FA 5CM9C 5TE9A 3IB6A 2GAIA 3R9WA 4DIDA 4TS4A 2UYYA 2E4AA 3D4BA 1MABA 1V6SA 4KN5A 2X3YA 3K6JA 3OY7A 1MIHA 3MGGA 2Q28A 3AYXB 4EX6A 4Y0NA 4C78A 3NGMA 4CLHA 4OV6B 2AR0A 3ZWKA 1JF8A 1YQTA 2O8BB 4IZOA 4MNTA 4LF7B 4GBJA 4B3MB 5A5DA 5A7FA 1O03A 2XQIA 4HSEA 1JLHA 2BHSA 3USES 3RC7A 3EOBI 1U7PA 4Q47A 3OOYA 3SP1A 1G3QA 2GTHA 3SLGA 3HVRA 1CFZA 3H04A 3JZIA 1K88A 3RUEA 3D5QA 1YJQA 2WT4A 3BCSA 3U62A 2DUUA 1D04A 4PXYA 1UPBA 3PWSA 3DM9B 3H1EA 4HQ0A 1MVOA 2BJHA 3CCFA 3PF8A 2OESA 3UCFA 2F9MA 1ILEA 1MX1A 4NEHB 3HI6A 5KYXB 1U1GA 1T5TA 4BU1A 1E0DA 4E70A 4DS3A 4F96A 2YYYA 3NANA 4MKIA 3THYB 2W6JA 4Z1OA 1XI2A 2ECKA 4L4UA 4QDOA 4A0GA 3EZGA 1W0CA 1Y33E 1DC6A 3DJFA 3FYHA 5PNTA 3MT8A 3G79A 3LBYA 2FUEA 1QZ3A 4Y1EA 2AUMA 4KUHA 3VPDA 3MWFA 4ZI7A 2GARA 2CNBA 1XYYA 4QODA 4UD6A 3IUSA 2HU2A 4II7A 3BTVA 3JR3A 3TDNA 3R9IA 2P79A 3SIRA 3C2QA 1TMKA 5J63A 4D43A 1V1MB 1N6LA 2GEVA 2NVUA 3IURA 4P58A 2O8EA 3RYHA 1IONA 2ONYA 4ND3A 3GMTA 3X3HA 3ZE6A 4Q16A 5GONB 3UMGA 5FNVF 4RS4A 2HA2A 3HN2A 3D0KA 4RSMA 1SU7A 2BFOA 5HX7A 2EQ5A 4UFPA 4NDAA 1XA0A 2PZ8A 4L9RA 2Q3MA 3LQRA 5LQRA 1MT0A 3IXLA 4DWJA 3JU3A 1HG0A 2Z5FA 1JTFA 3GLQA 4UUNA 3DLCA 2FMUA 1KZ7B 2PS9A 3TW8A 2Z5LA 5DSZA 4GZLA 1MHPA 1DCMA 2B61A 4ND7A 1U8EA 4LY6A 1CVLA 5A3VA 1EWTA 3DT9A 5FUWA 2VP6A 3EQ7A 1JAIA 3P45A 1LK0A 4XGIA 4KP7A 3TZKA 1BXKA 4KGVA 2D1TA 3WK7A 3OJCA 5GZ1A 3FN4A 4NK5A 4S0XA 4JVNA 4O8CA 1F3OA 5C4GB 2XNKA 5DTQA 1B3BA 1WZNA 2RBKA 1K7XB 5JRZA 3OBIA 5ESWA 4BEVA 3CEPB 1Y37A 2WFAA 3OE7D 1XWIA 1IZ7A 2QZPA 3KFVA 4MZDA 4FMPA 4DNOA 2X5JO 3L41A 2ZRCA 2VHTA 3MLEA 3PPVA 2XUDA 4FTWA 1P19A 2G40A 4NENB 4TS3A 5FUQA 3AL0C 1L7PA 5C31A 5C53B 3WGUA 4ENUA 1YB4A 2A94A 4M83A 4HAYA 2IX3A 3A7DA 5DOZA 1Z8FA 2OQRA 4XQCA 3W2IA 5M04A 2YZGA 1E32A 3WQSB 1K4KA 3MMSA 1HI9A 1TRKA 1DBIA 1QH8A 1VSQA 2HQRA 2R8RA 3CO5A 3IUBA 3K2IA 1GRVA 3FGZA 2B8TA 4TLEA 3K05A 4B3FX 3QXJA 1KNXA 4K6HA 3W1EA 1EUYA 4RVDA 2DFPA 4KDCA 4UBNA 1H5NA 3AJAA 3C98A 2ICAA 1DMSA 3PXUA 4UJ5A 2GEJA 4P5PA 3LOPA 5CYPA 3DNFA 3HLKA 3EHDA 1NPYA 5CGQB 3WDKA 3MGCA 1SHJA 3EEBA 1CZRA 4LPSA 2WI8A 1ZMBA 2BIFA 4N0MA 3PJDA 4WOKA 1VI6A 2P9JA 2AQ8A 1JXMA 2VK1A 1U0EA 1Y7TA 2P2LA 1P4HA 3DXYA 1BIFA 3FPSA 3RTBA 1V5FA 3UCEA 1T4GA 4B5LA 4MPJA 2FU5C 1VG9B 5DCYA 4DSNA 4UOZA 2OHGA 2CNWA 3SGLA 5FA8A 3N7UA 1Q0SA 1BWQA 2OV4A 1GCGA 4I50B 1S9HA 4XGRA 5DBGA 1BXGB 3TL6A 2PLRA 4UUMA 1E62A 1KO4A 2CXUA 3P9RA 1CERA 4AO8A 2RIRA 1C30B 3E05A 4FYKA 3FTNA 3SJBA 3AERB 3O8NA 2O3TA 1RJ9A 1RU3A 5B2FA 2P8SA 4ZVPA 5T4BA 3D64A 3Q3IA 1P9RA 1Q2UA 2Y1XA 4EUFA 1S6YA 1QIKA 1YQGA 4H2DA 1Q12A 1RNLA 4P7FA 4RKYA 2JFZA 2WRZA 2F3SA 2CVQA 4QC2A 1G6Q1 4OQYA 4BVAA 5KC8A 3LPMA 2X1MA 3E3AA 2AKYA 2XGMA 3E1SA 4NYJQ 4U0KA 3EY9A 1SK9A 1GPH1 3RC8A 3BRWA 4NJEA 2AMYA 4BP9A 4A4DA 4TKUB 5BWLA 1NX6A 2FA9A 1AGRA 2V5UA 3ZD9A 3EVAA 2RARA 4K2HA 4W7IA 1VJGA 3CGGA 1JU4A 4ITRC 1R8QA 4UMVA 4KYIB 3EVDA 4N0PA 1LS6A 2TYSB 2GDZA 4H31A 3LPAA 2QYHA 4QGFA 2OZLB 2ET6A 4ZCQA 4C2AA 3D6TB 4NH0A 1BMDA 1VECA 2NVWA 4KEAA 3AP2A 4DT1B 2OCKA 2Z04A 1ZMRA 3JQRA 2JVKA 1H6BA 1XRRA 2RH9B 3LCUA 2H52A 2J3JA 3AF4A 4G1EB 1K68A 3VKHA 3QHAA 1EBBA 1PT8A 3PNLA 2FPPA 2EBFX 2JATA 1VBMA 2OENG 4R5HA 2DFDA 3U3MA 3F4KA 1J97A 3CHYA 4OAPA 1Z29A 4Q5IA 4EB6A 2D59A 2NPOA 3MVEA 1ATZA 4HNTA 2YRFA 5DTJA 5KBYA 2LGJA 1YZYA 2WKQA 3UXHA 4IJMA 4RADA 1P2UA 3TX6A 3SC2A 2YYZA 1J4AA 1OTHA 2X7HA 5AKEA 1Y4SA 1BE6A 2PKWA 2AEFA 4AJHA 5JD4A 2C5BA 4LOIA 2R44A 1N36B 1M2VB 2GEUA 4BNDB 5JSUA 3ICPA 1G8FA 4YRBA 1SXJD 3EGVA 4URHA 1KAEA 4FNOA 3H11A 1I7SB 2JGRA 2I0FA 1GXSB 4NBWA 1VKJA 1IZ0A 2I4RA 3GDGA 3CRRA 1ZQ9A 1QOPB 3TSWA 1XDDA 3M7IA 5BT8A 4BX9A 1CXZA 3T99A 1ECJA 1U9IC 2C3MA 3AT1A 3GCDA 4X1IA 3U31A 1YNSA 3BTUA 2R2GA 5DI3A 2WWRA 3TQCA 2C4WA 4A91A 1J6UA 1JJIA 3MNFA 3WQHA 2RH8A 3W90A 3CVWA 3D02A 1Q44A 5HZMA 4R2HA 2XE8A 3C48A 3I1FA 2OE2A 4Y30A 4A8JC 2G9VA 3DR3A 4MQEA 1E2PA 4AROA 2G06A 1V11A 1RIFA 4X1KB 2I2WA 2VF2A 3D3JA 3RTEA 2IPLA 2DHQA 3IKJA 3IJEB 1E64A 3QELB 5AM4A 5BXQC 5IU6A 4KRFA 4RF4A 4U2DA 4W1QA 2OA0A 1IM8A 3VSAA 1Y0BA 4F8YA 5CB4F 2CLEB 3PE6A 1G2OA 2K6GA 1ZK0A 2W5UA 3C16C 3NATA 2F59A 4Q7QA 3NI2A 5K3BA 4QKQA 1W85B 5ALXA 3ABQB 5KVVA 5DSTA 2ZUWA 3H3FA 3IQGX 4HF7A 5SYMA 3SU8A 4TGLA 3TCKA 1GUDA 1KGSA 3V32A 1L4KA 1RQGA 4BZQA 1I24A 4X7PA 1DZIA 3MXTA 3TTVA 1QOQB 1I2AA 5F7OA 2Q0XA 3KM0A 1PV4A 4XEUA 3IEMA 4K9NA 3ZDEA 1QE5A 2ZI7A 4KVGA 3LO5A 4RTRA 1EWVA 3NRCA 2FFQA 4GU5A 3QE2A 5ECGC 2XECA 4E2YA 5DIFA 1HFWA 3PPXA 4ID9A 1P3JA 3OLZA 3QTTA 1PFVA 1KSGA 3RCBA 1I4TD 3IOMA 1K9VF 2GPSA 3TR0A 1HDGO 1JG7A 1NXWA 1CHDA 1O4WA 2LDBA 3G2KA 4FFSA 4LG1A 3S55A 4A2PA 1XLTA 3JATA 5BW5A 1CU1A 2HAEA 4ASUA 5B1IA 1FP4A 1J20A 1MNQA 1WUHS 1M2VA 1YOVB 3NTVA 4S35A 4BNDA 4XVCA 3G13A 2B4RO 5ARCA 2P30A 1GITA 4XWTA 3T3DA 1ENYA 1I0LA 3JS5A 4GYJA 1F4VA 2IY9A 1BW9A 3BGWA 1W1UA 4GL4A 1KEWA 2JGDA 4BMXA 4A0RA 2H9AA 4E09A 2C04A 2ZTUA 2VTBB 4L0CA 1GIAA 1YUMA 2A5LA 5LXTA 1VL0A 2KLBA 2OC4A 5IDVA 4B3SB 3AFIA 3H5WA 4FLMA 4US1R 5AM1A 1AG9A 1G4AE 4Y8VA 5EXSA 4NCBA 2NO7A 1B14A 3OQOA 2VDKB 2RSLA 3G2IA 2G8NA 4HB4A 4MRRA 1A97A 1DO8A 1S2IA 4HDQB 4EKEA 1NSFA 2O57A 3ILYA 5A3SA 3D8SA 5DLEA 2HIAA 2PUHA 1T8UA 3V97A 1DGQA 3IFSA 4BB0A 1DBWA 1EP9A 4HEA1 3QU5A 3TSZA 5BMVA 3MGAA 4ICIA 3SZGA 1XN1A 3KOUA 4J6FA 1KJQA 2FGKA 2FP3A 4GUDA 3KOYA 4O59O 3A1SA 4O2BB 5J40A 4BTEA 3VC3A 1PR2A 3MRXA 4NONA 5AIAA 3TH5A 1U9CA 1Y1PA 3HA7A 3O8CA 1UFVA 3I2IA 2H00A 4I4TF 1TLLA 1Z75A 5J2UF 1M6NA 3UXYA 1LVUA 2YRWA 3AP1A 2BZSA 4RY0A 3U4GA 3VTFA 4ZEMA 4ZRNA 4QOHA 2W4QA 3BSSA 5KNCH 1WUKS 1E3SA 3ES9A 2O54A 2J07A 2C3YA 3O8OA 1VDMA 4GEKA 5E95A 1EP1B 3K09C 2OPHA 3D6AA 4UW9A 2I99A 1GNQA 1E2GA 4RPLA 5EZYB 3VHXB 2GBPA 1UWCA 2CLIB 3NW9A 4KSCA 1NVBA 3MW8A 4LRXA 5CT6A 3DE4X 2YY5A 2H1SA 4KXXA 2RB4A 1GFIA 5A05A 5KX5A 4MHTA 4DLSA 1JP7A 4HYYA 1JMYA 4BCCA 1C9DB 4W9MC 2J0UA 2Q21A 3WLQA 1RM0A 3ZXUB 3HYLA 4YP7A 1VE1A 5ES3A 3CU5A 1M2FA 1DCFA 1DL5A 1LSUA 4DIFA 3PXXA 1T5OA 2YXEA 1VLMA 5KYWB 1AS3A 4L73A 2F6RA 2JANA 2YASA 4YT8A 5M7EA 3ZCUA 3TLJA 5FTLA 1E2DA 1XIVA 1I8TA 3AVQA 2EZ4A 2BCJQ 2UYCA 2QAGC 1A9RA 2VA8A 1EE2A 2ZBGA 1Q7BA 4JI0B 2CNWD 1MPTA 5IFKA 1BWSA 3ASYA 3WGQA 3ZBQA 3VR5A 2H2IA 2WNSA 3PNBA 4KWEA 5T5QA 4QTXA 3KSUA 1ZQ1A 4DVGA 4KXVA 1UMDB 3O1HB 4MP6A 2H2WA 2ZXUA 2FWJA 2A5DA 2ONCA 3GMSA 5K1ZA 3VSBA 1LH0A 3O5AA 2AC4A 3T54A 3TBKA 1N92A 2VI5A 2ERCA 1T1GA 4U00A 3RS3A 4C4OA 3GF4A 1ISIA 4ZHQA 1NV8A 3MTAA 3ZR4B 4JCCA 2D4AA 4RF3A 2ISSD 1TT5B 3CRNA 3DZ8A 2WE7A 5IM5A 4EECA 1K86A 1NLUA 4K5QA 4OI2A 4FCCA 4DRXA 1OD6A 1DQPA 3C7CB 3GCGA 2R1UA 3GH3A 3K3PA 5JNWA 5DHPA 3U7GA 1Z3IX 4B34A 1YH3A 4BLRA 2JJ2D 1B0PA 1T3LA 1X7YB 2OSVA 1FQJA 5BSEA 1HORA 4GBMA 4YMHA 2QLTA 1CTQA 4EMBA 3CQ9A 4J0KA 3KDPA 1GDTA 4MWDA 6AT1A 1Z5VA 3LFTA 4IQGA 2F7SA 4NBLA 3OKCA 4NNPA 2NV6A 1B0ZA 1JLSA 2FZEA 3GRVA 3HKEA 4NVRA 1GJRA 2WSYB 4NC9A 4NNJA 5ALQA 3LX4A 1QIGA 2XMZA 4PAMA 3DBHA 4WMLA 1JIQA 4ZOLB 2IKSA 4PC6A 3IO5A 5EZYA 3VHXA 2B2NA 1YI8A 3S70A 1D2AA 1DARA 3MAGA 3PTZA 5I7VA 3SHOA 1DOZA 4ZCPA 3C14C 1YVDA 4MUAA 3F3MA 5KSWB 1BU5A 4JEIA 5C1BA 2HN9A 5B58C 2PS3A 3ICCA 3I5MA 2JKZA 1G7TA 1OKKD 1N2EA 2PMWB 4QM7A 3UT5A 4YRIA 2C9CA 2UUOA 1H8HA 3L8ZA 3UNXA 3HVIA 1FFYA 3LRXA 1Q16A 2FV8A 5B7QA 1MAVA 3NP7A 4R9NA 5K0ZA 4LYEA 1KXZA 3QVOA 4F4IA 1GG5A 4OL9A 1KI9A 3N07A 3URMA 1MX9A 5EP2A 3SSAA 4X6LA 3ZE2B 3NDJA 3PQ3A 5KTMA 2YW2A 3SDSA 2HBRA 4UXJA 1F5NA 2BM8A 2CDBA 2VPXA 1SOMA 3HLTA 3TMYA 4DGQA 2O6HA 5LN1A 1GUBA 3F2IA 4QGAA 3OT4A 3REGA 4IXDA 4ZICA 5I9NA 3IO3A 1OTXA 1AKTA 1RWPA 4NBSA 4K6FA 5TJ9A 3UF0A 2FPRA 1ZHHA 1G4UR 1KS9A 5E38A 2WUWE 4I3GA 5F4BA 5KNLA 1UMBA 3PJGA 8ABPA 3N75A 1VPEA 2C00A 4JGIA 4R0VA 1UQRA 2A9KA 5CDFA 2RHRA 1MV5A 5GM2A 4DIOA 5FJIA 4AJOA 2PUEA 1RCUA 4R71A 1GGMA 2CSUA 4HFMA 1U0JA 2D0OB 4BWFB 4JD5A 3LUBA 2Z0MA 3E3OA 5F5LA 1BCSB 4MUMA 4CV3A 1PS0A 3K9GA 3OCCA 4ZVKA 4JMPA 4I5GA 1ZW1A 4IEEA 5E3IA 2NWQA 3H2YA 2JEOA 2O4CA 4DZRA 3LC2O 4DXHA 1W4AA 1CR6A 3FUTA 3KQQA 5EFZA 1UMCA 2Y1WA 3DCYA 3OOHA 1Z39A 2QVCA 3K0AA 4Q93A 4YFVA 3M1AA 1YBFA 2FH5B 4XGKA 4B6FA 4RGVA 2AJDA 2VYNA 4B3RB 1V6AA 2HMSA 3CWZA 4OGGA 4AN1A 4XIGS 4K6GA 3JWIA 1DFIA 4TS9A 4BE7B 2V7EA 2X2EA 1IHXA 1MAWA 4G24A 4U5QA 2VQFB 1CLEA 3PA6A 5CCXA 5K2MA 1Y1RA 2P68A 1ZVMA 2OQIA 4U2CA 5CT9A 3ETCA 2VDRB 2YNMC 4HGOA 1KRWA 1P1KA 1TIPA 3GJXC 3K30A 3KPUA 4BFWA 3T1VA 3KX2A 4AM8A 4YQFA 3UJNA 1X1QA 2GERA 3DQZA 3RU3A 1YE8A 2OEPA 1KO1A 2A0XA 1KMQA 4KHZA 2XE7A 2VP0A 1M1ZA 3ESXA 7MHTA 3TQHA 4FSHA 5IBPA 4LFAB 1Z16A 1OXKB 2YMPA 4IIDA 4QSMA 1RAGA 1DC7A 3GVPA 4JDPA 1Z2EA 5E1BA 1HEIA 3IV6A 1EWRA 1GQOA 5EZ6B 3SNKA 2ZRAA 3VJLA 4KGXA 1YS1X 5I48A 1EXVA 2PL9A 2HA7A 1FUIA 4AZSA 3VQTA 3EG9A 2NIPA 3QNUA 4QOEA 4I36A 4WOJA 3TFQA 1IG0A 2EEZA 4KV7A 4GZ5A 2AXQA 1VHQA 2FUNB 2Y3IA 1P61B 3WMXA 3I5UA 3L01A 1N0VC 2OKGA 5JPDA 3M6WA 2JIDA 4JSTA 1VIMA 1R6UA 3WIUA 1EGMB 1QP0A 3N2LA 2A9VA 4K9MA 4TZKA 4QLBA 4IFTA 3SR4A 5KZMB 3CX3A 3IEIA 1TJNA 3IDFA 2P11A 2AFHE 3NYIA 5EA2A 3WSVA 3IBCA 1JDPA 1PTJA 1TMOA 1MN6A 2HLDD 2Z1DA 4MUYA 2F1RA 3GA7A 1A9XB 1G9SA 2KB0A 1Y4AE 2XKJE 3MJDA 4TLDA 4PR3A 4ZARA 3SOZA 3C5HA 5KTYA 1Z2OX 1TIBA 2D2FA 3KPYA 4GKBA 4ZVUA 5F7XA 5DI9A 3BZBA 3UA3A 4LJ7A 2ISQA 2WNIA 2YJ6A 3N2EA 3PHCA 4RQUA 3INNA 1C7FA 1LQTA 4BLSA 3VNUA 3HUFA 5LQJA 1XE3A 2AG6A 1QQAA 4II2A 4HWPA 2IYPA 2XRZA 4RTLA 4ZYUA 1X7XA 3EDOA 3VV3A 1UINA 2CL6X 4UHHA 4ZI3A 1W5BA 4BTLA 3ILXA 1QHEA 2SICE 3CWQA 1LSOA 1OIXA 2TMGA 3OFND 1NBME 3D6UA 1ND5A 2LIPA 3KJEA 4UOQA 5CVVA 5AXAA 2BLLA 4EUSA 3AILA 4YXWA 3K2BA 4FVTA 4HWTA 4UU0A 2W71A 3AM4A 4ALKA 5I7FA 2ZJ4A 4FGZA 4HC4A 5CA0B 1C81A 3L7JA 2JJQA 1KY3A 4FMDB 2QDKA 3CN9A 4R2XA 2HV8A 1FW8A 1NQAO 2P4HX 3JALB 3EH1A 1W7AA 3FCSB 4LGYA 4HZGA 1RQ7A 4YCCA 3ABZA 3HQ4O 2A1TR 5CDUA 4HEHA 4PSAA 5C34B 2QA5A 5AD1A 1P6UA 1PO7A 2VHXA 3V2GA 1C7RA 2ZAGA 1CUWA 4PQYA 4DZZA 1V48A 1GQYA 3GT4A 4ZQHA 1W1WA 2BJVA 5HMMA 4IDBA 5F2OA 3H9UA 2A7QA 2WWXA 3ZWMA 3KL4A 1TA4A 1ACJA 2X9VA 4IPTA 3RT1A 4K86A 4FB5A 1OH7A 4LJRA 2ZCJA 2WV9A 1AZTA 4AMBA 4B35A 2I78A 3NX4A 5FPQA 1SBQA 1S8AA 2FUCA 1JJVA 3PQ5A 3GVCA 5DCUA 2AEMA 3ZHVA 5BV8A 1TCUA 1XMQB 2XHZA 5C1PA 1U0FA 3O93A 2P6OA 1C9NA 3KDAA 4DA4A 1O6CA 5I7OA 1Z45A 4MRAA 4J0HA 4DB2A 1KWKA 4CR6A 1V16B 2XI4A 2QVLA 4QU8A 2P67A 1QE3A 1AHPA 2X5OA 3OX2A 3V8MA 3AHCA 1DBQA 1P31A 4EB0A 3V7YA 5FPKA 2WA1A 2DH5A 2BGKA 3CM0A 1GPWB 4G0ZA 1YR2A 4MWTA 4UUQA 1ORVA 4HHEA 5AI8A 1FS5A 1PZMA 1MZVA 4BMSA 3PUZA 1UQTA 3HVHA 4R8SA 3P9KA 4KK4A 4RLHA 4UBJA 4ZVLA 4J3FA 3STTA 1JQJC 1NVTA 1AKEA 4OH1A 5HILA 3GLGE 5EHGA 1ZRMA 2Q5FA 4JUIA 3AESB 5DBFA 4HN2A 2RGUA 1NFFA 1EHIA 4DDVA 5K8LA 2QUHA 1T1SA 3QX8A 5K9ZA 4BMPB 2H4HA 3CLUC 4P22A 2JLBA 3QEBZ 1N8SA 1EVQA 3ZVRA 3GYGA 3OESA 4JI7B 3C0KA 3KUXA 2B4YA 1QM5A 1JKFA 1ZCBA 2EKLA 3AR3A 3DF7A 1X80B 1XWWA 1SGWA 2OM6A 3OCXA 2AJLI 4RACA 4RZIA 1OFUA 1E6EA 1MORA 2OT3B 3AHFA 2YRXA 4OXNA 5TQJA 3TRKA 4DDWA 5A3QA 2CXXA 1GM5A 3MS7A 3ST7A 3HLYA 1EWQA 3BQNB 3SSNA 1EQAA 2QR5A 3QF7A 1GQFA 1N5MA 1QK5A 2OG1A 3GDHA 1NV9A 3OLVA 1EVYA 2RI0A 4URFA 4QTUB 4TQAA 4UAGA 5SICE 4L22A 1Q50A 1WUYA 4B76A 3WA7A 2BFBA 2V5AA 3BAFA 3VPAA 4A5OA 2OOKA 1ZN8A 3WA6A 3ER6A 3FUWA 5IKEA 1C8KA 3RFCA 4PANA 3EGIA 2IYSA 2WTXA 2ZE5A 4K9OA 1XSEA 3DQPA 1L7AA 4Z99A 4D41A 3UH1A 1NNI1 1D5WA 1F8XA 2Y8EA 1MU0A 4LHWA 4KOEC 5JDIC 1NYQA 1SZDA 5D3MB 5TQ0B 4B7ZA 3G59A 1PP4A 1R10A 4QPDA 2AT1A 5DXJA 2G4VA 3ELYA 3OKAA 4F12A 1JL3A 1AQYA 2BTEA 5HS4A 2PBZA 1DC5A 1E5QA 1JSCA 2N0SA 4JZYA 4XA8A 4AX4A 1TQ6A 1EB8A 2DWOA 5IAJA 2YIDA 2NO0A 3FXAA 1FTSA 3GEDA 5FL3A 1EQ2A 5LA6B 2FPPB 4LJ5A 2C5EA 4RDHA 3RFXA 2NU8A 5AVQA 4UZSA 3H2ZA 4DSAA 3TGWA 3CY6A 4G8DA 4DLAA 4R41A 3TR6A 2A9RA 1G38A 3VSEA 3ORYA 3C1UA 4PYQA 2OCXA 2H9IA 4Y9TA 2W00A 3X2SA 2IPXA 5SZIA 4RYLA 4UEQA 4YB8A 4REOA 1ADYA 4HNUA 3LA6A 3U44A 1GQ2A 3OD1A 3B6IA 2GA9A 3LOQA 4RVSA 2GM5A 3WL7A 2D5AA 1ZONA 4Z1MD 2A1UB 1JE1A 1E20A 2JIPA 2W2VA 2O50A 3CZPA 3OZBA 4XX0A 3V1NA 5JZ9A 1V2GA 1F0NA 2DPMA 3EW9A 5ED0A 3UVEA 2E21A 2IBMA 2N9UA 2VSYA 3DWGA 4BECA 2WB4A 4DJ5X 5JJLA 2LBPA 2YIVX 1V7ZA 4IUCS 1FL9A 2CFCA 4YAEA 1AKVA 4NBUA 2HMWA 2ZRLA 4TTIA 5BSUA 2EGUA 4HFRA 4HI0E 4DBVO 3M6AA 1L1RA 4ZV7A 3RVKA 3N2NA 3NCTA 4MW0A 3VOSA 1T8RA 1E6KA 1TTPB 4HDAA 2MSCB 2VK2A 4GUAA 1X80A 4ZDIA 1GKYA 3PR2B 1JBEA 1PBTA 2ZJ8A 4U39A 1FNSA 1HV8A 2C5LA 3CN7A 3CZRA 4XD2A 1Q19A 5DLYA 5KQRA 2GBLC 4KQKA 3N2KA 1LNSA 4G85A 4PQFA 5GONF 5JCZA 3TOCA 4ZALA 5F1KA 2P2YA 2Z83A 2AUNA 5M2QA 3TTSA 3R9XB 3V8NA 3FB4A 3GJQA 3OQNA 3AM5A 2H08A 1ZESA 3A6DA 2YVQA 5EINA 3DL7A 2FPSA 1GDDA 3WWPA 3MTEA 5JALA 5ARBA 1LPBB 3HADA 3FWYA 2Z5GA 3OMXA 3QWAA 1EX1A 2B8NA 4LDPA 4TL6A 2MR6A 2VJMB 4QYMA 4WXYB 2IYWA 1P18A 3U3JA 3ZIDA 4DLKA 3E8SA 4NR0A 2BGIA 4NFLA 3U16A 1C7JA 3LM8A 4MW4A 1L5YA 1N1EA 4PS0A 3U7RA 4H35A 4EUEA 2WJAA 4BNFA 2PLFA 1HL7A 2J6IA 3ZWVA 2J31A 3HV0A 4QREA 1FFXA 2PWYA 3JAWA 3AFMA 2PKYX 2RGCA 5FHRA 3U7FB 1T2VA 1KXJA 3E58A 3LE8A 2E4UA 3SDZA 2PT5A 4EO7A 4ETWA 1WBBA 3TFWA 5H4HA 2OV6A 3GRZA 4FFWA 1AB5A 1BKDR 1L3CA 5EJ8A 1Z6XA 4H15A 5BN5A 1EVLA 4HX5A 4ZDJA 3RSGA 2ZDQA 3SJ7A 3ZLUA 3O95A 2J30A 2DM6A 2RKWA 5A4JA 5KTRA 3KETA 2O3UA 2VFAA 2FQ1A 4NYMR 4CCYA 4OLFA 4LCJA 3OQ1A 4MR8A 3V00A 4AMYA 1E9AA 1DBPA 3BWEA 3NUZA 4IKOA 4DT1A 1Z4KA 1FP4B 3QWHA 2LRHA 1HZJA 4X8MA 5FPPA 5H0IA 5H68A 4E51A 3HUTA 3WXBA 1CPYA 2W98A 1A5ZA 1DKNA 5JCOA 4Q3AA 1Y9ZA 5I3CA 5I8ZA 1LDBA 4FZRA 4IP0A 2HO4A 1YZNA 2G28A 3FI0A 1BN6A 1NXSA 2IGTA 1J2RA 1T8TA 5FYQA 4EPVA 4NDZA 5AW2A 4B09A 1HT2E 2WKPA 2I6SA 3ZV5A 4MI3A 6ADHA 3I12A 4WN3A 3FNGA 4CM6A 4JNCA 4I6JA 1XVIA 3DTVD 3H5VA 3HFJA 2QL5A 3HG7A 3PVSA 4MJXA 1O57A 3N2IA 5EHNA 3WFIA 4EZBA 1FFGA 2AYZA 4FFBA 3IP8A 3AUSA 2OTCA 3CFYA 4Q9KA 1PJAA 4G26A 5CJJA 4CLDA 2GM4A 4ECAA 5K3EA 5SY6A 5MGNA 1A82A 2CHFA 2GJ8A 3O9VA 2JGAA 4D9MA 4D9EA 1JEQB 1Y89A 1WSDA 3SBXA 3TBHA 4Q37A 2VCYA 3DXFA 1WKCA 3MWGA 1XAHA 1LJLA 1LV8A 3ZUGA 2XKAA 3DV0B 1RXYA 1EFCA 4CZ2A 3WBFA 1Q91A 1Z7EA 2B98A 2FN7A 3O7MA 2VNAA 1A7JA 3QVSA 4FINA 3VR5H 2OHFA 3GELA 1CC1S 4H7FA 4DTCA 5I9BA 5B12A 3UA4A 4OQEA 1OXXK 4ZOQI 1L3BA 2GYVA 3KLPX 5ECYA 1VYHA 1WMSA 2H1CA 4Q3LA 4F3CA 3NBQA 3A6EA 1QC5A 4AP6A 2YHIA 1NFQA 2V7TA 3ZHQA 4DMHA 1NJ2A 5FWXB 2BV3A 2HRQA 4UTVA 1FTQA 2D1QA 3A9UA 4NZ9A 3PJEA 3ZWCA 5EMHA 1MG0A 4V0RA 1I2MA 3UFBA 5EXXA 5AMXA 1L5LA 5JZVA 3PFHA 4UZFA 3ZIUA 4QDKA 3ZDFA 5AVYA 1XEWY 2ZIXB 4G97A 2C29D 2YS6A 3H1PA 4YMIA 1XF1A 1BGVA 1U8CB 1FLDA 2QD3A 3L82B 4RX1A 3V7UA 1O6BA 4F04A 4YJ3F 5IXJA 3AF2A 2A0FA 2QZ4A 3F5SA 3PFGA 3WQQA 4JQYA 3BB1A 2YJNA 1WZCA 4X6YA 3EIQA 3H6HA 3P52A 3EF0A 1XVAA 1DIHA 2ZWIA 4OREX 2IEGA 2EGHA 5HOQA 1ESNA 2IVFA 4L8WB 3TXXA 1PR6A 1KK3A 4MGZR 2YZKA 4PZAA 1O0SA 2AD1A 2VYQA 3EIOA 4L16A 4Y2JA 3O94A 3PEEA 1N3YA 3IULA 2I7CA 3QHPA 4EBFA 2I4OA 1RPTA 4YAFA 2WU0A 4K2AA 3DA8A 3HM9A 4K9SA 2PG3A 2BM9A