1SBTA

Atomic coordinates for subtilisin bpn (or novo)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic coordinates for subtilisin BPN' (or Novo).
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
molecule keywords SUBTILISIN BPN'
total genus 81
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1972-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sbtA00
1A2QA 1ZVJA 2QTWB 2W2PA 3D43A 1R0RE 2ZWOA 3CO0S 4Z2AA 1P8JA 1NDUA 1R64A 1TM4E 1WMEA 1BFKA 1HT3A 3I34X 4H6XA 2GKOA 2Z2ZA 2ID4A 1GNSA 1MEEA 3A3NA 4C3UA 1C3LA 1Y4AE 2WUWE 2X8JB 1KE1A 5JXGA 1SBIA 1SUEA 1SUBA 4KB5A 4H6WA 1Q5PA 1SUCA 1YU6A 3PRKE 1S2NA 3BX1A 4LVNA 4NE7A 4H6VA 5AVKA 3SICE 1GTJ1 5JXIA 5I9SA 4CFYA 2V8BA 5B1DA 2PMWB 1CNMA 1TMGE 2TECE 4NE9A 3TI7A 3LPDA 4B5LA 1KDZA 5K7SA 1PTKA 1S01A 3DVRX 3VV3A 1AVTA 2W2OA 3BGOS 3T41A 1TO2E 1SCAA 3EE6A 5FFNA 1AQNA 2PWAA 2SBTA 4K8RB 1AF4A 4OV6B 3ZXXA 3DE7X 1EGQA 4LVOA 5AQEA 3GT4A 2DQKA 3DYBA 1SBHA 1GTL1 1GTG1 1SH7A 1BJRE 1SUAA 1ST2A 1LW6E 2IY9A 2Z57A 1SCDA 1TECE 3A3PA 3I37X 3L1KA 3PTLA 4I0WB 1VSBA 4OMCA 1XF1A 1AV7A 4YN3A 3DE3X 1BH6A 1P7WA 1SVNA 1KDVA 3ZXYA 1GNVA 1WSDA 1GA1A 4DJ5X 2IXTA 2WUVA 3QMPA 3DDZX 1ST3A 3TECE 1THMA 1BE8A 1SUDA 1Y3CE 3LXUX 4JP8A 1TM5E 1UBNA 2Z2XA 3WQBA 1YJCA 3F7OA 5AVJA 3Q5GA 1SN7A 5FAXA 2HPZA 3UNXA 4AKSA 1JEAA 1YJBA 4J94A 5JXJA 1TO1E 1NDQA 5ARBA 1IAVA 3GCXA 2ZWPA 4BWGA 1Y1KE 1DUIA 5SICE 4C3VA 3DW1X 3F7MA 1SBNE 3EDYA 2Z58A 1SCJA 3GT3A 4NMXB 1SIUA 2WWTA 3AJ9A 1C9NA 1GCIA 5FBZA 3DE4X 4DZTA 3DVQX 3CNQS 1SPBS 3Q40A 3BPSA 3VV2A 1Y33E 1DBIA 2XRMA 2Z30A 1WMDA 4RYDA 3VSBA 2W2NA 3H42B 2Z56A 3DW3X 3VTAA 1Y48E 4GI3A 5AMXA 3WHIA 1SBTA 1Y3DE 1PFGA 4M1ZA 1OT5A 2ID8A 1Y34E 2DP4E 1TM7E 3DE2X 4HX2A 1ZVKA 1GA6A 3I30X 4FONA 1C9JA 3DE5X 1V5IA 5B1EA 3A3OA 1CSEE 2PWBA 4ZARA 3DVSX 3P5BA 1Y4DE 1R6VA 2E1PA 2ZRQA 3DE0X 3GCWA 2Z2YA 3LPCA 4MZDA 2WV7A 1GT91 3VYVA 5JXHA 1SBCA 2B6NA 4WOCA 1MPTA 1SCNE 4WOBA 3EIFA 4CG0A 2X8JA 4ZOQI 3SQOA 1WMFA 1Y9ZA 2HD4A 1EA7A 2P4EA 2XTJA 3DWEX 1GA4A 1Y3FE 3VHQA 1Y3BE 2SNIE 3F49S 4KPGA 4DWWA 3I2YX 1OYOA 1TM1E 2G4VA 2ST1A 3HJRA 1PEKE 3QTLA 5CW1A 1P7VA 3D9QX 3OSZA 1KE2A 2PQ2A 1AH2A 4OMDA 2PYZA 3DE6X 1WVMA 1KDYA 1BE6A 4CFZA 1SELA 3WIUA 1PJ8A 1T1IA 2PKCA 3QFHA 1SIOA 1TK2A 4KG7A 2W2MA 1AU9A 4AKTA 3DE1X 1OYVA 2W2QA 2DUJA 1TM3E 5ARDA 3TI9A 1BFUA 2SECE 3WIVA 1C9MA 3AFGA 1SCBA 1SUPA 5ARCA 2PRKA 1AK9A 1V6CA 1NLUA 1IC6A 1SIBE 3AJ8A 3LPAA 1T1GA 4HVLA 5JMOA 2SICE 1S02A 1YJAA 1T1EA
chains in the Genus database with same CATH superfamily
4JU9A 3H17A 3MRXA 4OGLA 1LPBB 1O0SA 1PI3A 1ZOSA 3T5PA 5E0OA 1MEEA 5CCXA 2WTBA 2Q1WA 3UOGA 3DC2A 1O89A 4KPYA 4OJMX 1AXGA 5H81A 3G9UA 1T8YA 1N5OX 3FRJA 4J0QA 4JITA 1GT6A 3V8MA 2XOKD 3G9QA 1R5JA 5BQXA 1QGED 1SCQA 2H1VA 5K3FA 3SSMA 1MKYA 1UBJS 2ZIVB 3KRTA 3CVXA 2D1SA 5ALZA 3SP1A 2AFHA 3S2IA 3MOSA 3RVJA 3FMOB 3T7SA 4EY4A 4TVKA 5B30A 2NO7A 2FHPA 3C6QA 3IUSA 2IQIA 4KRYA 5ALEA 4D44A 1IVSA 1GO2A 2Z5VA 3K8OE 1XP5A 4TLAA 2BFCB 2XUOA 5BNIA 3AW8A 3FYCA 4HKTA 3U7EB 1VHQA 4N3GA 3K0HA 1QO7A 4B4WA 2OHGA 3FRHA 4AUMA 3N8KA 4MW9A 3V4PB 4FCTA 3GLRA 1JB9A 4YJHA 2NSLA 2REOA 3DB2A 3NBQA 2L19A 1V7QA 2H2FA 1P62B 1P5JA 4QPDA 4WLFA 4ZYYA 2WP0A 3WB1A 5GJWC 5C5CA 1O0CA 1HFWA 3DMDA 4GSLA 3ORQA 1LKZA 4FGKA 1ZA2A 1IVNA 2QIOA 3EUFA 5HA5A 4Z51A 3NHFA 5H9WA 2AJCA 4LNAA 4RVUA 4ZMRA 3D6TB 2KYRA 5JSHA 5AXBA 2PT6A 1J5XA 5EL0A 4N5NA 2O8EA 2ZJBA 5CITA 4EYQA 2R1ZA 1TDJA 1F7VA 4LJ4A 4OBEA 1OUMA 2G9ZA 3ZD9A 3MEQA 4EKNB 5REQA 3RRJA 1WABA 4UHBA 4BFYA 3SZMA 1PAUA 3NRBA 4A4DA 4EHNA 1JWBB 3QEMB 3WK6A 1ORDA 3OE7A 4RTQA 4MIKA 5L4LA 2ZVDA 3AH8A 3MJHA 4YHBA 1WMDA 1WCWA 1YQTA 5AT1A 5I7SA 4O4JB 3OA2A 1ZYUA 2FLKA 3OPQA 3QVTA 4Z8YA 4DJJA 3IVMA 5EWLA 5DNYB 1IM5A 4M1ZA 4GIBA 1L4YA 1RMTA 3BMQA 3W5SA 4POAA 3PFKA 1HA3A 4EG0A 1GNPA 2EP5A 3H0EA 2Q2OA 3RGWS 2OFPA 4TV8B 4BNFA 2EJUA 3HA3A 1GUFA 1Q1EA 3GDGA 4DBLE 1UXKA 4AO6A 3RF6A 3AUAA 4DQLA 1QH9A 1EVQA 1YB2A 1P31A 5CH5A 3L9WA 3MJFA 5DYNA 5C18A 3GVCA 1NT4A 2SNIE 1V41E 3EIHA 4DEXA 3AHJA 3MT8A 1EXNA 1UFKA 3ICCA 4MQ4A 4RSMA 2WU8A 2JC3A 1AGXA 4ZHQA 2JANA 4Z2YA 1K8YB 3ICQB 1SIOA 1B6GA 2A88A 5EFZA 3IT2A 3RUFA 1FVXA 4OI1A 1V3QE 4MARA 3RSOA 2UYQA 3HJNA 4HXYA 1GPUA 4OK6A 1IEVA 4R1NA 2G9NA 1UFRA 2X9GA 2PXHA 4NBRA 1EWTA 2JJ2A 1ZINA 1XU9A 3HPQA 1X1DA 1U5BB 4N4AA 5HCNA 3K35A 4HYYA 5SZJA 4C7KA 3R7BA 2DQSA 4PN7A 4AK9A 3MNFA 2NUBA 4RVSA 3C1AA 4PSDA 5IKOA 5BW8A 4G5GA 2IHTA 1J7JA 1MAAA 1P1JA 5B7PA 4YY3B 1NOJA 3SLRA 2WSBA 3RFVA 2C7RA 4JWTA 2I1LA 2PG3A 2NO5A 2X6TA 4LWPA 4QOGA 3BJZA 2Y1GA 1RZRD 3K9LA 4P0TA 3A05A 3L7LA 1P1CA 3DZIA 4JMPA 4CQLB 2PGAA 3BVPA 1IDOA 2D1TA 4HBZA 4RD2A 1W73A 2OZEA 3EVDA 1L7MA 3IV7A 4Z8XA 5FQNA 5ESRA 3JY6A 2JEOA 4ITRC 4P98A 2QRPA 3KL4A 4F86A 1GVNB 1RRFA 4YXFA 1E5TA 4UVIA 3RYFB 4B6QA 5T3YA 4G8JA 1TZ2A 2Z0MA 1RLJA 1K75A 1LTHR 1E2EA 2B37A 3PNLA 5E1OA 1NI5A 4V1CI 4LQDA 3ESCA 4F1JA 3DOCA 1SZDA 1QC5B 1XDGA 4F46A 5FOUA 1RVV1 3LOPA 4WSOA 1T5BA 2KBFA 3PX3A 4C14A 1Q44A 5ARBA 1RFGE 5A71A 1ZIOA 1M72A 2V96A 4ABTA 3N7TA 4UDXX 4M0FA 3EGXB 1DTWB 2QTRA 3W79A 1U4OA 1M6WA 4MW6A 1L0BA 2O54A 2EU8A 2WHXA 2VC2B 4WERA 4JVSB 2X8AA 1E58A 2HF8A 3TMYA 3IESA 2IDMA 1WQ4A 3FPGA 3EDMA 3TJRA 3UV6A 3X3HA 1FNSA 1PTJC 1Q2UA 4EA6A 3PWKA 3EEQA 4MGKR 5DBEX 3ZWNA 1C0LA 2EGGA 4AT1A 2YFYA 3SM3A 2PS3A 4DG9A 2O05A 4D9MA 1DIGA 2BFAA 4I9NA 2JIDA 1CJTC 1KQPA 1KVTA 2CWWA 1P2VA 1XZEA 1B15A 1VJCA 2OQRA 2A5GA 1KPIA 1WL8A 3LT2A 4J2HA 4L95C 1N75A 1Q21A 4V3BA 4UCFA 1GHTA 4K5QA 3ETCA 3ZGZA 4CPDA 2VZ8A 2Z83A 3R7FA 3WGVA 5EIEA 2ZR8A 3M4XA 2HCJB 5C8YA 3S3TA 2FFJA 3RKSA 3FNRA 3IUYA 2JIRA 4URYR 3HKDB 2BJVA 4N49A 3TM5A 4A73A 5K3OA 4J76A 5LP6B 4S2UA 1W5BA 3MPUA 5C32A 1M73E 1MAHA 4V2UA 2OD2A 1Y3BE 1PV1A 4KPGA 4UVEA 5I9TA 4LOKA 5KNLA 5C34B 2N75A 1M5RA 4JLAA 5JH7A 1U7WA 4OF4A 4XWYA 1WSBA 1U2ZA 4ITUA 1I2MA 3W5DA 4Z4CA 4OMDA 1FZTA 4CEHA 4ZTZB 1I7DA 5ELMA 3PZRA 1LQTA 4Y9UA 3OG9A 4HHEA 5J5CA 1U9IC 2BM8A 2GERA 4MWGA 2R87A 3DD5A 5C8YB 2H57A 2X0JA 1EDBA 3WOVA 1BFDA 1O0BA 2YHAA 1KYYA 2PRKA 4QPCA 3GLGA 2Q8QA 1DX6A 3M4YA 4OJTA 1CZNA 2P3LA 2RGWA 2YINC 2ZE8A 4TKMA 5CNJA 3I6QA 2J5BA 2YJGA 1KDPA 2CCJA 2QQ0A 3ZDRA 1Z07A 5KKAA 3A1NA 1P6QA 3NIGB 4H6PA 4EJSA 2WF5A 3C7KA 4BLVA 3VOSA 3K94A 5AUOB 3PYXA 2YXLA 1CIJA 5LBUA 1BOOA 4URUR 4YCCA 5B2FA 4D57A 2BGKA 2RE8A 1UPTA 4FB4A 3W5HA 1RCFA 3CNHA 2ZUVA 3LC2O 1UDXA 3V97A 4BFUA 1VRVA 3IVGA 4R4JA 1V5WA 2OORC 2QQFA 3DVRX 4FC7A 4K6OA 1UDRA 3MC1A 3RRFA 4EITA 1KZGB 3UY4A 4ZKEA 7YASA 3GLGB 1SWWA 5B37A 4HDOB 1UEJA 3DBIA 5CVVA 4QM7A 2A4MA 1JW9B 3CB2A 3SK0A 3DOFA 2P90A 2VR1A 1MIHA 3REFA 4CHGA 4Y98A 4CLOB 3WZMA 1MX1A 2PKEA 3Q9NA 1MC8A 3A7EA 5H3HA 3NBFA 5J3JA 4UHHA 5FR1A 4ISCA 4QYMA 4D98A 3QVGB 4CKWB 5ERGB 1G4HA 4ND5A 3IPCA 1C14A 1JFRA 1QH8B 3UHFA 4CQLA 4P22A 4N03A 4LOIA 2ACWA 2R7AA 2B34A 2Z8YA 2PSSA 3K5WA 4REQA 3RC7A 3S1LA 1FQJA 4TN1A 1CULC 4FFVA 3UOWA 2X0DA 1SCKA 1C8LA 5KWVA 3G9ZA 2CXQA 1U0GA 1RKUA 1W6RA 3FTEA 3BMQB 3SZOA 4LDRA 1FP7A 1F06A 3SSAA 3CX4A 2WFLA 3NCTA 4PYIA 2LW7A 3WNQA 1I7SB 1P17A 4OB6A 4G4SP 1U4NA 3G7UA 4FOLA 3VZCA 4IDCA 4LPKA 2BMJA 2OQVA 3HL4A 1QDUA 5MN4A 1N2CE 3NATA 4S35A 4KE9A 5A7GA 3UT6A 4US1R 3FNBA 4YPVA 3PDJA 4GNRA 4BJHB 4FXPA 3F67A 1QH8A 2CXXA 2DFKB 3P94A 3R5FA 4Y67A 1D1SA 4MRNA 1AN0A 4FVTA 3H4MA 3FGZA 3MWKA 1OLXA 4MPJA 4NBNA 4HLDA 1IRXA 1K0UA 2EERA 4TOIA 4BE7B 1Q0RA 1V11A 4C7XA 2P9EA 2OGTA 4LRQA 3H5OA 3TLYA 3TR6A 4NS1A 5KAPA 4A5SA 4GI2A 1JPJA 1S8FA 4C0JA 3QE4A 2D0OB 1NE7A 4EVIA 2ZLBA 2XYHA 1GGFA 4JC5A 5ED4A 5BR1A 2C2HA 1KSHA 2I22A 2J0EA 3MWYW 2G9VA 4O1HA 1VKOA 3LPCA 3I76A 4LXHA 5C53B 2D2EA 1YVPA 2JI8A 1NU6A 5KHOC 3OJLA 4U6QA 1EE1A 2IH4A 3NHBA 1KU0A 3BERA 3DV0B 1CS4C 3BAFA 1N3IA 5IZCA 3A04A 4LEIA 4KVZA 3F9CA 4EL0A 1ZGGA 2IC5A 2R5FA 3D8RA 2ZE5A 5JNVA 1GNRA 1J2UA 1JDZA 3AVYA 1XJQA 5AJTA 4OHCA 5EUBA 4EO4A 5KCZA 1U0BB 1JLLB 2V0GA 4F2PA 4CM5A 3AOEC 3H8JA 2QL6A 1NOKA 2F67A 4NATA 1L7AA 4X44A 5I3ZA 5C8ZA 2Y6UA 4TWZA 4DBLC 2DPMA 1JKMA 1IPFA 2JD2A 2QORA 4R8MA 1G1AA 3JPYA 3R20A 4LN1A 3AESB 1RJWA 3GFQA 1Z4LA 1OLUA 1CJKC 5K0SA 3SKVA 3DLCA 4BQPA 1SZJG 4C6SA 2ZWOA 4JLJA 3KZXA 2ZBDA 2B92A 4HFRA 1AKWA 2XB2A 1E9CA 1SRQA 2WWWA 3E9EA 1JQJC 4IUYA 1WU8A 3OESA 1KVUA 2HZ7A 4JR1A 4YJFB 1SBYA 2DFLA 1Q5PA 1UWCA 4EY8A 2O7RA 3BXZA 3ANTA 3A9SA 4L4XA 4IIJF 1LV7A 1XMPA 4DCUA 4UUNA 1T4CB 1MABA 5H7XA 4DLAA 4B33A 3F8WA 1IHYA 5CH3A 1PT9A 3M9XA 4M54A 4YR9A 1UXJA 4MO2A 2EBUA 2QENA 4DVGA 1EDEA 2WNSA 2WSMA 1E2NA 4RADA 4C20A 3HWWA 2NO9A 2VTEA 5HMLA 1W30A 2BAGA 4RTOA 1Q17A 3FOEC 2OBBA 3STYA 2FMKA 1VE7A 3WTBA 3LX8A 1C7EA 4AFNA 3RSHA 3KYCB 1CUUA 1DEKA 1ADJA 2W2XA 1DQNA 1IUNA 2WPDD 3L1IA 3LE8A 3M1LA 3EIUA 3AUKA 4D0SA 5KQSA 1M34A 2A92A 1K3TA 1RI3A 3R23A 1M2JA 1JHMA 4Q0MA 4CV3A 2NTNA 2JFZA 4Q3OA 5CT5A 1ULZA 2N42A 1KDOA 3WQBA 3N28A 4PQRA 4CF7A 4QVKA 5AKYA 4G9EA 4TXNA 5JXJA 4RENA 2BRUC 3PHJA 3WG9A 1UXIA 2O2IA 3WAKA 1CEYA 4OQLA 4FB5A 5LQUA 2YW9A 1HKUA 1JPUA 2J85A 1U1CA 3F6CA 5JJKA 3VO2A 5BXQC 4URHA 1B42A 4AZ0A 3QBEA 1KIMA 1VFNA 5JAQA 2AF3C 4G01B 1E2QA 3RTEA 4X9XA 1SXIA 3KE9A 1TW3A 1XDDA 3JU3A 2BDUA 2BTQA 5HJ2A 2G5CA 3FHJA 5BSMA 1J56A 3PVZA 5SY4A 2WIAA 3HXMA 2RCYA 5GMOA 4C89A 5EINA 1FCJA 2FFQA 5IARA 4BZZA 1OFUA 2A1TS 2VNJA 5CM2Z 5ER9A 4NBVA 3WLQA 1JLHA 4H7HA 5CJ2A 2JLAA 4FLEA 2FPSA 4DILA 4K9NA 4EUKA 3ZU5A 5CEFA 4WVLA 2OXEA 2PWBA 1FFBA 4KAAA 4ZO8A 4GVPA 3U49A 1E63A 4EG1A 1UM9A 2G80A 3O6VA 1E61A 1NXOA 2H18A 3KQVA 1OH8A 1C7ZA 2HWUA 4TS9A 1M2VB 1PL8A 2GETA 3B3GA 3FOZA 4F3RA 4NRDA 4GX5A 5LJIA 4CF4A 3UANA 4LXXA 3HXQA 1VCOA 1EU1A 2ZPTX 4LWOA 1KO1A 4JI2B 3O84A 1JQ3A 3C39A 1CR0A 4ID3A 2OLKA 4EKGA 2AXPA 2XNCA 4F8EA 2AFHB 4UARA 1K97A 3ZWOA 2OGWA 2W2QA 3QUQA 5CBPA 1GGHA 1JDBC 3EYAA 1SCBA 5IDYA 4X95A 2X7HA 4MRSA 3SIWA 2RAPA 3GLHA 2CE7A 5F77A 3Q6NA 3NNDA 2VHJA 3OIWA 4YMLA 2OYSA 5ALHA 3ZIDA 3KB1A 4P4TA 4ZEMA 5LYJF 2D1YA 3ADOA 4EY3A 2YQ4A 1GR0A 1NQWA 1U0TA 3QLVC 3TUZC 3D31A 3OJCA 1S2DA 1GZ6A 2ZQYA 5JE8A 3SS7X 1CXZA 3HSYA 4WIAA 3DKIA 3L84A 4ZYZA 2Q3MA 3CW2A 4R9NA 1MGOA 4Z4GA 4GRAA 5J4HA 5EMLA 2J9RA 4UFOA 2HU5A 2V8BA 1PZFA 4Z5XA 1EZZA 4RK4A 1XZIA 2ZREA 1XO1A 3NEJA 3REOA 4TKLA 4HDQB 3ETDA 1EB9A 1G3MA 2B2CA 4GGMX 1RJ9A 4IGEA 4HI0E 1QIJA 1UINA 4ILKA 4FWTA 1DT3A 4FIDA 3UKOA 1AF4A 4KO3S 2HCFA 1UDAA 1UBMS 2P7IA 3CNLA 4OKSA 5CXXA 4OGKA 4YBZA 3DL0A 3WV4A 1RZ3A 3MGCA 5DHAA 2V0NA 4LRTB 4YUVA 2WC1A 3SHQA 2GNOA 1NXTA 1Q0UA 1TLTA 2IYLD 2WBLC 4HL6A 2WU3A 5CB6A 5DM1A 3S8EA 4JODA 5ELXA 3DMPA 1BXRA 4QODA 2EFCB 4MPRA 5EERA 2YRXA 3RT7A 5LPNA 1JIQA 2M9MA 5LXTA 1CR1A 1EP2B 1G6OA 2XUZA 4NIMA 1H8HA 1QM5A 4A92A 3BYZA 5FKJA 2FU5C 3E5NA 5AKEA 3K05A 4DNXA 4JEMA 5BR8B 4OU5A 1XSEA 3MTBA 4YACA 3M6AA 3EQ2A 2CLEB 4D8VA 1KWKA 3V1KA 4IV8A 3PQDA 4JEHA 3EZGA 3GVIA 1PNTA 1Y3HA 2YH2A 1WXWA 4YCAA 5B3JC 1YCGA 1J2TA 2GM5A 2SCUA 1T6XA 1UK9A 2DWUA 4BV9A 5LYJA 1XNGA 1QVVA 2V58A 2AQIA 1ATZA 1WD5A 6AT1A 1GPWB 1KJ9A 2VWHA 4EVSA 5JZ9A 2I62A 4W99A 5B7GA 4U6SA 4ID9A 2EP8A 2CW5A 1OGJA 3LRPA 3L06A 2BH2A 2PBFA 1JDTA 4GBJA 5IJ9B 2C2BA 2L82A 1E8DA 4YJ3B 4MA0A 2B7BA 4PQYA 3WRXA 5EIXA 1A77A 1E1NA 1A1VA 1J4AA 3A6FA 1BQ3A 4IIHA 3RBVA 3D02A 3RAFC 4R8KA 2FX2A 3SFZA 4EF5A 3G02A 4HQRA 4JQCA 2Y93A 1OXKB 5BOVA 1SG0A 4PF1A 2IV2X 5C1OA 1TXGA 1FJ2A 4IMJB 4UOZA 5HKBA 1EP9A 4BX2A 1E8MA 1CHNA 1I6WA 4OVKA 4UJ3A 3URKA 1R6DA 3GN2A 2C4VA 5F35A 1NM5C 1QJ4A 1RQXA 2I3GA 4URVR 2WT9A 4R40A 3T7RA 1TJ5A 2RD2A 2YOFA 1LZKA 3PFBA 1S8NA 1Z75A 4RTJA 3F7NA 2IYSA 5F7ZA 3BB3A 4UNNA 3DE1X 4L75A 5IKPA 1QIHA 2ZROA 4L3OA 4BKUA 1HDZA 4LGCA 2BR3A 1P5HA 1NRIA 5AHRA 2EL9A 2GEFA 2ZRLA 3RC9A 4LJAA 3EF1A 4BJ1A 1I3LA 1Y7HA 4HDRA 1MO3A 5DHUA 1WLYA 2WTAA 4OD0A 2GBGA 3ONVA 3EXAA 4PQEA 2GWHA 4MW4A 3NTOA 4REOA 3W2IA 2V3CC 2CLFB 5I8PA 3EBPA 1OAOC 3O8LA 2P9BA 3RRBA 1M8JA 1KYTA 1Y6ZA 1PBNA 2WYVA 4ZWNA 3LBIA 5FEUA 1JFTA 4P7BA 3TVYA 3ZKWA 3O83A 1G9SA 2MSNA 3GUYA 2R3SA 1EFCA 3SNKA 5AVZA 2WYIA 5KNCD 3DHYA 1R16A 3CEAA 3CUWA 2W6ZA 4QGFA 4LSWA 1XAGA 2VF8A 3ACBA 5HS4A 5G1NA 1JU3A 2ZKIA 3NOXA 5IAGA 3RJZA 1A7JA 1SQ6A 3B9QA 1Z5WA 3CE6A 5KJFA 4OV6B 3DEHA 3PPYA 3ZI7A 2ZIXB 4DIKA 5F9MA 4N39A 1ATIA 3S27A 1SBHA 1LBEA 5JD5A 5JH7F 1XEXA 3JALA 1DELA 3AU9A 1RAIA 3H2BA 4MQFA 1AUQA 1O97C 2V5UA 4NE2A 1SXJB 3RUEA 1SM4A 3K32A 4PZPA 3H4TA 1QP8A 3THXA 3P7MA 2CLDX 4HGOA 2QX6A 5LJLA 1K6IA 5DP1A 1P9RA 3JWJA 3GGOA 1Z39A 4HEQA 1GG2A 3H5AA 3RYHB 4F1WA 2F00A 1KC3A 1NQOA 3UHJA 1L7XA 1DXQA 1ODJA 1J0AA 2OCIA 2YFQA 4Q3LA 3H3XA 3MJ4A 5AK0A 1Q6YA 3KSUA 2H6EA 3K1AB 3PT9A 4BWGA 1N2CA 2IUFA 5T64A 3TD6A 4K1LA 3B89A 3ZCRA 4C0LA 4K6HA 3KB6A 1HYGA 3KJEA 4L5IA 1A8IA 3V8NA 1OLSA 3IUNA 4TVSA 2IGTA 2JJMA 1RBMA 4MYHA 4BLPA 3BCUA 2G72A 3KOMA 3GJ0A 3DUFA 3E6AA 1XMVA 4YIHA 3UV7A 4YROA 1IY9A 1XELA 4DJTA 3DGEC 4ZD6A 3AOEA 4FK8A 1N5MA 1X80B 1T9GR 2NQ2C 2FR1A 2CL7X 1H65A 4TMFA 1T3GA 2CXOA 4KGDA 2WE7A 1NW3A 3FUUA 3WBKA 3JW8A 1HZJA 2GILA 3IB3A 2X9VA 4WLVA 3MT9A 2XCUA 2FEKA 3B1KA 2ZSHA 3ZH9B 2RI0A 3SXUA 2C9BA 2WUDA 2G1UA 5FFMA 3F4BA 3KP1A 1M0EA 4QUBA 4XYMA 4M7PA 3E22A 1SOVA 1DKPA 3QWFA 4UUBA 4DJEC 1JECA 1GITA 2GCGA 4JCCA 4AYWA 1XC7A 2XUFA 4FEAA 1HI9A 3P2EA 1AZLA 5KOHB 2GNPA 3CO5A 3VO1A 2B21A 2GF9A 2E5LB 1TCVA 3LHIA 1F2DA 4TWIA 5ICEA 4CQMA 3EOAI 2WD9A 4KQXA 4I1RA 5AQ1A 3FCCA 4Q9JA 4PC3A 4OHKA 1ZUNB 1HE3A 2CUNA 4Y0AA 2GT1A 4ZVOA 3DLTA 3KZNA 1I94B 3O8OB 4JJIA 2AFHE 4N0DA 1QS0A 1RMQA 4M87A 4X6YA 2QMQA 2ZRFA 3EG5A 3UZUA 3W2EA 1AC5A 1EFRD 3NHWA 2FR0A 4QUKA 4ODIA 1W87A 1MJGA 1QANA 3CU5A 1CY2A 3LM8A 3QMWA 4NICA 1N57A 2BLLA 5EC8A 3UENA 2H1IA 2R62A 3AVOA 3DAHA 1PFUA 3U44A 3ORFA 1OXSC 2IL1A 3MXTA 1SXQA 4PGGA 2O8BA 3G2IA 2X5XA 1TJNA 3D2CA 3DTVB 1RC1A 3MMZA 3V2HA 2WJGA 4Q16A 3ZIAD 2GK6A 1CUCA 2CJFA 3CRZA 4TTIA 1N1EA 3ELWA 5E4FA 1HDGO 2BEUB 2C92A 3BEDA 3UUGA 4EHHA 1HDIA 1FFCA 3AP1A 4YMIA 4IX1A 1XLUA 1TQ8A 5TMEA 3U4QA 1FVHA 1Y7PA 3P20A 4NYIR 5HKOA 1ZCJA 3HZRA 3O26A 3DV9A 2YN2A 4HB0A 2ORIA 5AXCA 5I9MA 2QN1A 4OO3A 5AHKA 3HZOA 4K9DA 1DE0A 1OFTA 4W82A 4CIWA 4L4UA 2B7LA 4FP9A 6YASA 4YVFA 1NYRA 1P19A 1R8QA 2SBTA 1KZ9A 1A2KC 3ZHBA 2E9SA 5TY0A 2BM9A 2J48A 1IIBA 4OHVA 3WGZA 4S3MA 3H1GA 2VZ9A 4HJRA 3UTDA 4PN3A 5JS8A 5AIAA 4GMHA 5K8CA 2XOKA 4JC4A 5J2UB 2FR8C 1JAYA 1G60A 3U37A 1PZHA 4O63O 1DIAA 2IYTA 4I1IA 3EFOB 3PUYA 1HDYA 3TTYA 3UOAB 4DABA 2QLJA 2O0MA 5KAMA 2IS1A 4CETA 2G09A 3UMFA 1WAMA 2WJVA 4DXAA 2KSQA 5BSGA 3PE3A 4Q01A 3ZLVA 4UAVA 5KVCA 3C6MA 3R0ZA 3U5TA 2PUJA 3FTQA 5KYTA 1KJ8A 3UMBA 4GVLA 2QP4A 2F3UA 1ONBA 4LC0A 3ENZA 1YC5A 2WF8A 1GPLA 2XITA 4CT0A 1EMDA 2A86A 4UEKA 3CTPA 4I1VA 2P0EA 1RPJA 2R84A 1J00A 3L7BA 5HRCA 2ILVA 3V3KA 2PMEA 1FEZA 1M5UA 2IDKA 3MJRA 1KWGA 3OM8A 5FF9A 1F14A 1L1QA 1PX0A 1QFMA 1RIFA 3MBOA 4ZIRA 1Y37A 2BCGY 1DEOA 2O2GA 4C0HA 1XPUA 3AHDA 1P80A 2POQX 2RARA 2YWFA 4NLLA 3WHLA 1ZH4A 4R81A 4AG6A 4JXZA 1VBNA 3SIRA 1M7HA 2A9PA 3H7AA 5THQA 1PWYE 2YXPX 4UHCA 1J06A 4FEEA 4JXJA 1PD0A 3NIWA 4LBWA 3BEOA 4EI2A 3HB1A 4F06A 4DIBA 3CH7A 4CEJA 2AEFA 3FNIA 4NU8X 4R9VA 5H82A 1KJQA 5ULLA 2QZJA 4WXHA 2J08A 3I0NA 1JQEA 5BV8A 2OP0A 2ZBEA 3GUUA 3U4DA 4DCVA 3DMGA 5DHSA 2XTZA 5HRUA 1JKJA 1CVIA 2IYVA 3PCRB 5GM1A 3S5UA 3X1MA 4AY3A 1XTQA 2DT8A 3NM5A 4NARA 1BW9A 2YY5A 3ZD8A 5AVWA 4UHDA 4CIAA 1S89A 1CQXA 4HH4A 3D4BA 2QVZX 3C3DA 2I8AA 2JI7A 4AB1A 4DLLA 4ZV4A 4AXXA 4DB4A 1O57A 1KI6A 2I80A 4WGGA 3FTPA 3K9CA 1FNMA 1G6Q1 3SY8A 4DCOA 2O8CA 2WNHA 3N86A 4TS4A 1OIVA 2VAXA 2RH5A 5ER6A 2PD6A 1J2RA 3S2SA 3REQA 4PWZA 1EBBA 4RNCA 2CLMB 3HABA 3EVCA 5BN3A 4FYKA 2IEAA 2WKQA 5J4LA 5KSOA 4HTAA 3G5AA 1K3UB 4DT1B 4NC9A 1AV6A 1GSOA 3KHTA 1D6NA 5HIMA 5JG7A 2UDPA 1ZD9A 4OSEA 1B2LA 1NJGA 1PYDA 2ZDHA 1Z4OA 3GJ7A 4JBIA 1PFWA 4UHKA 2OV8A 3V33A 4Y6OA 2I8LA 4JLDA 1YMQA 4PM4A 1G2IA 3OLYA 3K8QA 4X5OA 2O23A 1Z7WA 1MG0A 1LVUA 2G88A 4R8SA 5T4EA 4ZVUA 5MHTA 1H0RA 3ZDZB 1KAQA 5KOJA 2RH9B 2HY7A 3NC1C 5KREA 4B44A 3PC2A 4NH0A 2NVWA 2UZ4A 3MUNA 5B6IA 5ALMA 1EUDB 2OFOA 2QL9A 3FZEA 4KFTA 5JDCC 3SQMA 3WFZA 5HCUA 1JV2B 1RTTA 2ZSEA 2QLTA 1JG6A 5G0TA 1GUYA 2BMVA 1VP3A 4FHZA 3PGLA 3V4RA 1XZDA 2Y1XA 5LZ9A 2P9CA 2HDHA 4BTVA 4P4SA 3QF7A 1MO6A 5AVOA 2M2IA 1G8GA 2PU7A 4XWTA 3DL4A 1SD5A 1Q95A 3B36A 5CGQB 2CJWB 4BNZA 1A3CA 1YBHA 2C7GA 4GWGA 1S9DA 2B98A 4K3VA 4UOEA 4MWEA 1CF9A 1SUWA 4LYFA 3NU1A 4EKEA 1KZ4A 4R1LA 1PHPA 5DNUA 4CF6A 1EDOA 4F4CA 4V38A 4WKOA 5JNUA 1PNRA 5KYGA 1YR3A 1TE2A 4NULA 1QK4A 4YAWA 4WEQA 2ZI3A 5SICE 2XE7A 2Z4SA 2ZYAA 2FEOA 5MGBA 2EXXA 2AHRA 3NHRA 3B7WA 4RJLA 2VP3A 1G8JA 1UQTA 1KZYC 1VL0A 3DHVA 2O8DB 2AYYA 4TSRA 3LT4A 4PSAA 1L1FA 2V9CA 1W0CA 4PZLA 2NTEA 3D3KA 1VHJA 3Q15C 3UA4A 3AV3A 1KY3A 4KIFA 1SCIA 1SVUA 2BHLA 2F8LA 2ZIAA 1ZOIA 4F8JA 1D2CA 3K0AB 1XVLA 3UGKA 4XYEA 1TM7E 3JARB 5TS2A 1FBNA 4DM3A 1F6DA 4RMNA 5LUAA 4AJ9A 5U4QA 3QU9A 4MUHA 4R2XA 5IBQA 3TEMA 2AJDA 1FVOA 2WG1A 4U8HA 1NYLA 2HHHB 3MHPA 1Y5NA 4Q02A 4Q3NA 5TQJA 4JJGA 2XOXA 3KHUA 4OBBA 3ZDYB 2ZBRA 2YJ3A 4EHAA 5ICCA 2HREA 5CB4B 5T8KA 1V16B 3SHFA 1DLJA 5I9BA 1MPXA 4DR7B 2O8CB 2IX3A 3FWYA 2ORYA 3GL9A 4DLVA 4Q6BA 4RO0A 4PVCA 4FR2A 4QBKA 1G7CA 4F5DA 2QL7A 2X0RA 1VM6A 4WWHA 3T52A 3UIEA 2WA2A 5D5HA 3OPYA 2XGGA 4Y7DA 4YDSA 3VR1A 3WSVA 4AMGA 2WIDA 4JIGA 1A9XA 2NSJA 3FCAA 4RWZA 4FYVA 3WGYA 3BWYA 4OI0A 1EK1A 4A91A 2R8YA 3BWMA 4QU5A 4LF9B 2HMWA 4WJZA 2VDRB 3BRWA 3N2IA 3SQLA 1QRSA 1BFUA 4KR7A 2BEVB 2YZGA 4EKYA 4N5IX 3RDPA 3QEAZ 1B26A 2D5LA 2JLRA 2QLLA 4GD3Q 5ECDA 5BV2P 3ILXA 1T1EA 2BUCA 1Z5GA 2C31A 2PMBA 2YNMD 1J22A 4H6XA 2GYVA 1TTPB 1QX3A 2B4QA 3EAGA 3IDFA 4WZ6A 2ZUUA 4D9IA 2G6BA 5DASA 2V7VA 3TR0A 1W34A 1H0SA 3C8DA 4XWGA 1PNVA 2VRNA 2YBEA 5ALYA 1TRKA 3TRHA 3G0DA 2VTKA 1CYDA 3FOWA 5EJFA 3B13B 3RKUA 3UMJA 4ZVMA 3FLMA 5LMCA 3V1YA 1EUCB 5EWMA 4F93B 1GUAA 1R0CA 1VI5A 3IT3A 4NTZA 4P5DA 1I8TA 1Z0ZA 4KX3A 5AM0A 1NR7A 2PLWA 1R0WA 2XQIA 3CUYA 1EJ0A 4E03A 1SCAA 2DFTA 3E4DA 4M8KA 3TK1A 3UJDA 3LXRA 1NQAO 5L95A 1CIVA 2I7XA 4P35A 4B3IA 4BJ5A 2Q1UA 3K6JA 1G55A 1JP7A 3IXQA 3WK4A 1GU7A 2ESRA 1AB5A 2Z57A 3AV0B 3NJ8A 3I8XA 1SU6A 4MQEB 1VYVA 3MLBA 4IHJB 2H3HA 3PD7A 4QPJC 5TPZD 3ZW8A 5IG2A 1P39A 4F3NA 1QYWA 4DLSA 3MOIA 4MV5A 4B7AA 1KRHA 4U9UA 1FFYA 1XN4A 1X92A 3C70A 3NEYA 3NP7A 2ZRJA 5JHHB 4C30A 3NTRA 1VDZA 1UDCA 2GF0A 3R9XA 4RK1A 1M8KA 1GFWA 3OFND 4AKSA 1CUHA 2VT3A 4TKUB 2J8ZA 5EZ5A 3IQGX 2GUWA 1LF5A 1L5LA 4MYUA 4EB6B 1HDRA 1Y1KE 4PC7A 3UFBA 1ZM9A 4MX8A 5KWJA 2XMZA 2DPYA 1GZUA 1FNNA 5DULA 5KZMB 4MB6A 3T0GA 3OQNA 3EDYA 2ZQZA 1GCOA 4HFMA 3GD5A 4IO1A 2BONA 4CM3A 3D1VA 5C80A 4DMKA 3LIPA 4JSRA 3CSSA 4K87A 3BMCA 3BK2A 5DZSA 3ZD7A 3OQIA 3FTDA 4I3GA 4NQZA 4YECA 2PYDA 3B52X 1X7YA 2YJ5A 2FWJA 3HB0A 2WKWA 1RRPA 4GYYA 5DKFA 3NH9A 1RWXA 2DFVA 4BB5A 2HPHA 4I1YA 2WHEA 3A3YA 3FDFA 4MVJD 1ZW1A 2OMEA 4KXFB 4Q1BA 3PKZA 4JCOA 1L1RA 1T9HA 2OQIA 4WK2B 3UC9A 1UKBA 3OAAA 2Q8PA 4HADA 3BTOA 2Q5FA 4Y30A 4H15A 1UT8A 1ISSA 4EFDA 1KO4A 3E1GA 4FHGA 1VB3A 1I9CA 4HS9A 1Q0LA 1JKXA 1TUIA 4GI5A 2YTZA 2VG8A 4YPOA 4GE3A 4C03A 2CZGA 1NMEA 3R8FA 5FUMA 3LF2A 3RU9A 2VVTA 3I6MA 4JJEA 5KMGB 1IMJA 1PJ8A 2IUYA 5F64A 4H17A 5CDUA 3DAFA 1KU6A 2QTZA 1FL9A 3AFGA 3UXHA 4P53A 4BDTA 4F96A 3OBIA 5E2BA 1K68A 3WLMA 4QT4A 1PGJA 4EX6A 4TUYF 2ONKA 3UHPA 1YR1A 3H19A 3V80A 5J2UA 5F98A 4MV0A 3TX6A 3TR5A 1KZ7B 4IEEA 1NJ1A 1TM4E 3CC8A 1UP7A 2QVYX 4KIJA 4MV8A 1D1QA 5H3CA 1A71A 1YBMA 2ZEJA 4QOHA 4QDTA 5BW6B 3RU3A 2XYGA 5JPDA 1FDRA 1PT8A 3ZZUA 2HI0A 1B0PA 3TZHA 2B99A 3GJ8A 1KFKB 5T4BA 3NGLA 4NOLA 2FFHA 2OP1A 1IOLA 2X2OA 2XF8A 1KK1A 2Y0EA 3OTIA 1K6EA 4ND3A 3SXPA 1NX9A 2Q4DA 1Y7TA 3K09A 2Y4NA 4PC1A 1KS9A 3LP6A 3VR6H 2BCJQ 2UKDA 3O3OB 1B6SA 1D8AA 2CLIB 3GLVA 2WB2A 2V7QA 3CUUA 4ZAFA 4YAIA 1PR2A 4MA4A 3WKCA 4A0HA 4KQ9A 1AXRA 3VKUA 3TZCA 5AI6A 3OOHA 4US0R 1O95D 5LD2B 1QWSA 3DAYA 1NQXA 1PJLA 1PUIA 4KFCA 3RGGA 3WL3A 1MOQA 3NV9A 4C7OA 3KQOA 4H35A 2FV8A 1M2KA 2EKPA 3VPGA 1PU2A 4FWBA 3OT4A 1H1LA 4BNGA 2A5JA 3O8QA 3UMSA 4ACAA 2L18A 1DDIA 1HGXA 2MYPA 1NUHA 3KKEA 3F7OA 1CRLA 4INAA 3PD0A 4NECA 3C5CA 3R74A 3RO7A 2JIPA 3R3ZA 2A2ZA 4CNQA 4W7IA 2EJVA 3FGPA 2AZDA 2GZSA 3PXBA 3CRNA 4QREA 4ZOCA 5GGXA 2PX8A 3HDQA 2FOXA 3B51X 1L5SA 5EIFA 3WLPA 3ER6A 1SU4A 4YJ2A 1Z4NA 2DR2A 1F60A 4Q6WA 4ZU1X 5L9AA 1V6AA 3EEIA 4O2AA 4LGYA 3WS7A 1STOA 1FMLA 4FXOA 4KXVA 1FP6A 2IYAA 1CY1A 4AC9A 3D7NA 4NZMA 1CUSA 4QFDA 4N7JA 1JEJA 2AI1A 2W4MA 1ZNQO 3MWLA 3W90A 3NRCA 1RJEA 5TXGA 4IAOA 3RVDA 5BRNA 4E33A 5ALFA 1OILA 3IBGA 1EINA 1A50B 1YK1A 2D54A 1ISRA 5A7HA 3JZMA 3OQVA 1AG9A 1JA1A 2RMKA 4ATNA 1Y9AA 1GXSA 2ID8A 3IAHA 1CQJB 1DIRA 3GQBB 3I2IA 4UUOA 2AFRA 2FUEA 2EGHA 1U8EA 3CLKA 3CSDA 2JARA 3GGJA 4IS3A 5DEOA 3S7TA 4XVRA 4LZAA 2VJNA 3CJRA 3RYIA 1TVKA 1TIPA 4WN9B 1P0MA 1JHXA 4FJ0A 3TMKA 1EHIA 1A5BB 3BMCB 2JFGA 2Q6VA 4NWIA 5D1NA 4E4RA 5CK5A 1NBHA 3NOVA 2ZT6A 4HTFB 3ZJTA 2E4VA 4UHEA 2QUKA 1U0SY 2Q3LA 3AEQA 4QXQA 2JIZA 1HNXB 1GGMA 3H1AA 2HK8A 3ICVA 4L51A 4W6ZA 4M60A 4X8MA 5LLSA 5EP1A 2NU9A 3FOFC 4IILA 3WRVA 4WBNA 3CH5A 4J7AA 1W0KA 3FM9A 1GXSB 3OSZA 4RS4A 4ZQBA 4DTCA 3X2EA 2B4AA 4UTRA 2I4OA 1XJCA 1R0ZA 1T43A 1MFZA 3KQSA 2J46A 2LP4Y 4IH9A 1TK2A 4QPPA 5F4ZA 4AKTA 3AEKB 2JJ1A 3CH6A 2FPWA 3PGJA 2OO5A 2DBYA 4ND6A 2XQGA 3VJRA 2ZZKA 4FGSA 1M7GA 5D3KA 2LTAA 1H0HA 1WPGA 3QU4A 5CTJA 2XAAA 1P75A 1VHLA 3IP7A 3K6SB 4K0KB 2VHZA 3KR0A 1QYCA 4TV9B 5DHFA 1R18A 3S6JA 4LXYA 4AZVA 1ZBDA 3DBOB 3F0TA 3FHLA 3KZOA 4MGEA 5BMVB 3DTYA 3GJXC 3LPMA 4UNQA 2ID4A 4MQEA 5CM8B 5CT4A 3TOZA 3WAGA 4DC1A 5LKRA 3FNQA 4UTXA 5JXGA 2IH5A 1RHUA 2BHNA 4KB5A 1U63A 3DONA 4EI8A 3UB4A 4G9GA 3TTSA 4UAGA 1QCZA 4Q4DA 2C0PA 1RXVA 3CW9A 2EZUA 5KNCH 1D2RA 2GBCA 5A0TA 1XEFA 3RTDA 3OSUA 3RASA 4B5LA 2ZCVA 2HQ1A 1U8UA 3TTXA 5HUJA 1US8A 3KYCA 4IIJA 2H2IA 2EBFX 1E9FA 3DMRA 3NWBA 2HSDA 2GVZC 4I5EA 2A0KA 4X66B 1Y81A 4EARA 1BMDA 1I3MA 3QKTA 4LVOA 4CKYA 4ML3A 3PQEA 1EFLA 2HNAA 4M9RA 1NNSA 1SCDA 2XSZD 5IU6A 5AM4A 3THSA 4RTKA 3GGCA 5KNBA 3GP5A 3SBXA 4BLSA 2Y0PA 2GHIA 1PSWA 1W0JD 3C8HA 3DT6A 5FFFA 1G3RA 1Z08A 2WKSA 3ELYA 3SHTA 4AY4A 4E5NA 4GEKA 2XTNA 4Y1RA 5DI3B 4TYWA 1BE8A 1X38A 4IKEA 3EOBI 4FMDB 2GAFA 2B8TA 1W85B 2D3WA 2HCTA 4RZHA 2Z9DA 4TLMB 2OYRA 4LNUA 2IHUA 4NU0A 2PV0A 1SQ0A 3ZXIA 5K4AA 3RUIA 4DA6A 3LKDA 4ZU3A 5J5AA 5I9LA 2RGNA 5IT0A 3NKLA 1Y42X 2JK0A 4OQFA 2BBOA 1YI8A 4Q9IA 3BQMB 2PWZA 3F97A 5LLDA 2O2CA 3S2YA 4NV0A 1PWEA 3IPYA 2CJPA 4NMXB 3W3ZB 2P40A 2A84A 2PMCA 2P5SA 4RCYA 4A2PA 1GTSA 3KQUA 3URMA 2TMDA 4G1FA 3CVYA 2P3OA 1A9XB 3I5UA 1SHJA 1RXUA 1T91A 1AD2A 3CG4A 3MJEA 4FE4A 3S8MA 4V0NA 2YZMA 4RA9A 4ZJYA 1GU0A 1YMUA 4W9MC 3A06A 2XZDA 4XOIA 4C5AA 1Z6XA 1DC6A 1OXBB 3DZCA 3E7XA 4HEJA 1ZMOA 3I39X 4LHSA 3X1DA 1GKKA 3ZHZA 3FPCA 5DB4A 1XRJA 3NHKA 2C98A 4K2AA 1JHOA 1KOGA 4CLHA 5ITSA 1W36D 4RBNA 4Y2HA 5BT9A 1X8XA 3IJPA 2ZU6A 4C2BA 1QFZA 4JC0A 2FE1A 1IJEA 2C82A 2AKYA 2AZTA 1Z5UA 1W8IA 2AOTA 2DM6A 2QXYA 1X15A 1XU7A 2ZJ1A 3AQIA 3Q0EA 4OY3A 3VJKA 4H18A 4P2BA 3ZDEA 1RI4A 1E5QA 3A1EA 4WOKA 5JRJA 1KFCB 2HD4A 3ILYA 2HXGA 2IS4A 4ENRA 5IM5A 1RU3A 1T3SA 1XVIA 3BH7A 3DMHA 1C4WA 1G19A 2RK4A 3DUWA 3PNSA 4MHSA 4WECA 4EMTA 3SSNA 1Q15A 2VRWA 3A37A 4QSHA 1BIFA 2FZGA 3C7AA 4G89A 4GOND 5TIIA 4KYUA 4LBVA 1X7YB 4GLLA 1PK8A 4ZOLF 4BKOA 1HE4A 1ZLXA 4AW9A 1S1CA 5FHQA 3B53X 4ZHQF 2DUJA 1KL7A 3K96A 1YFKA 4L2IA 3W2TA 1HYQA 3MRTA 1KI3A 3ZNNA 1N34B 1NLUA 4MP3A 3MS7A 3T1HB 1CRZA 3D0KA 5BWMA 3RB8A 3TE6A 3NBZC 4OYYA 1HT3A 1PZEA 1LJUA 5EHGA 5EIHA 2N1MA 5DDIP 3AGPA 1F0NA 2GN6A 3DOHA 5MN6A 2ADMA 1SBIA 2ENUA 4HH1A 4LVNA 1JDVA 1Z38A 3INTA 1OD6A 3QEJA 1O5IA 1GKYA 3K71B 4HGYA 4LJLA 4LYGA 1VA5A 1Z5VA 2OTCA 1TADA 1M5TA 3CLVA 1VJGA 5IT9A 2XMDA 1ODFA 4UDYX 3CR3C 2HWWA 3GXOA 5KPJA 5DTQA 2D06A 1F4PA 3OFVA 5I5GA 5K3BA 4K8OA 3J7TA 1JZSA 4LYYA 4R0VA 1ZGAA 4KGVA 1JHPA 3HO1A 2I6GA 1EH5A 2ZUEA 4RPHA 4BRWA 1XTVA 3L5KA 1QOZA 2FQ1A 1QTIA 1KI9A 1QFSA 3PXEA 1UKAA 4CCYB 5FPKA 1G66A 3N2GB 1E2FA 1XF1A 1XKQA 1F8UA 1V5GA 4KQCA 4NBSA 3H2HA 5F1YA 3SNHA 3GRCA 3LTEA 1PGOA 2I34A 2HDOA 3MJTA 4Q21A 2LWIA 2XCLA 1DFHA 2AR9A 3FB4A 4XX0B 4MV1A 4EJ6A 2GHQA 1JTEA 3NX4A 4JUIA 4AJ2A 5HUQA 2O6HA 4XX1A 2ZUFA 3TSYA 1MNQA 4HDSA 4YWHA 2AYXA 2VXYA 3AR5A 3K8ZA 4U4AA 1WLSA 4HH0A 3QOXA 2YVQA 1BKDR 2GK7A 1TT5A 2CSUA 3IP1A 2B1RA 3P4XA 2A59A 3R3WA 4JAVC 4CKEA 1A8SA 1JSZA 1JKIA 1ILWA 2OBNA 5B3AA 1XZKA 4Y2SA 3STUA 2IQ5A 3HCWA 4JUFA 4KYIB 2XKAA 3BPSA 3LO8A 1P91A 2C2YA 2HEIA 4F71A 6PFKA 1AZWA 1T2UA 4OM8A 1YA4A 1TVMA 3PL5A 4GC9A 3A2MA 4TTAA 4ZT6A 1L7PA 1A4RA 2AQKA 4KU4A 5E38A 2G0NA 2CDRA 4PX5A 5FT9A 5KWSA 2ZITA 4GL4A 4YWJA 4LOHA 4WK6A 1IULA 1L7DA 2YC2C 1PQYA 1D04A 3L6UA 4QTZA 2AW5A 2XAUA 3E9DA 1TQHA 3FVWA 4MEAA 3B6IA 1P2GA 4B3GA 4KLRA 2R0QC 3VHRA 2IYZA 3UT5A 2FEMA 4RQAA 1IUOA 1KEKA 2Q5JA 4EENA 4DNFA 1HSZA 1CY8A 2QGZA 2QM7A 4E70A 1O4WA 3G1WA 1IONA 5GOZA 5IRCD 4MS1A 2GDJA 3R6TA 4CIYA 3EGCA 3DBRB 3N6VA 3ZC3A 5IZ4A 4BTLA 2VATA 3JQ9C 3QKRB 1X1QA 3LUGA 4II3A 1E2MA 1E6UA 2NZ8A 1JHAA 5C1PA 5D5PA 2R6DA 4ZMSA 5EXTA 3CVWA 4HSGA 3DM9B 3KB8A 3H6GA 1R0LA 2EX1A 3LWZA 1UEIA 5KTYA 5EI5A 2X0IA 1X39A 2Z3WA 4UBJA 3SJ7A 2NO6A 3EW7A 3LPAA 2QXUA 1EXWA 5EKTA 1P73A 3VNAA 3EY4A 1TUBB 3NBAA 2O8EB 4DVJA 2DCUA 4MCAA 3LVQE 3NM6B 4NH4A 1DJOA 2WJIA 1PL0A 3BQNB 3KZCA 3LKVA 5DJ5A 4AMUA 4YRRA 1F0YA 3JWEA 3QM1A 3GROA 2RSLA 5FYQA 4FNGA 1OJLA 4AD8A 3K8YA 4IUCS 5A3JA 3D6JA 4H6VA 4KYTA 4FGWA 2J41A 4WY8A 5AVKA 2PMKA 1X7ZA 1H2FA 2O3QA 1DFIA 1Z83A 2RHOA 1HDXA 1G8YA 3A9WA 2RGUA 3AILA 4U6NA 5HGJA 4KQIA 4JI1B 3F71A 3CCCA 1S01A 2FSHA 2HNBA 3UWOA 4A8TA 3OTOB 4UUPA 2VCEA 1Z2NX 2HRQA 2VJMA 3T5DA 3H2KA 4RIGA 4PQGA 5ADVA 2AMYA 3QBJA 1LDBA 1RYBA 1O5OA 2MSWA 3INNA 3Q5DA 3ZQUA 3I32A 3BTUA 2V7PA 1ZL2A 3GT4A 3KDSE 4Y2XA 3C5EA 1EG2A 1VPEA 1YVEI 3G2MA 1ECCA 2FFAA 2IY9A 3MBKA 4BE9A 4E1VA 2HSZA 2AXEA 4Z4HA 4O25A 1AV7A 1ZIDA 2WHPB 2HWXA 2VZEA 1VJTA 2OHFA 3V8QA 4EWLA 2FMTA 3B78A 1ZQ1A 5IX8A 1G64A 4TTQA 1IMOA 3QEMA 3K15A 1MMFB 2D5BA 4NYJQ 4CF5A 5IXYA 2J4CA 1D0VA 2PGNA 1QIKA 1XU4A 2HCBA 3NT5A 4OH1A 1BWRA 3FPEA 5E8RA 5K8TA 4TKVA 1KXZA 1BMFD 1E77A 5K2MA 1J1ZA 1UPFA 1QHSA 2F3QA 1F8YA 2XVZA 3T3HA 4JBXA 3GRRA 5EHQA 4DIEA 5BT8A 1HL3A 4XQ0A 4MNTA 5AUQA 2ZTSA 4KGZA 3DXXA 2I03A 1UMBA 1JMKC 2GNAA 1DG1G 4B3JA 5CEEA 5TARA 3UA3A 4UVHA 2HMTA 3N0WA 4IRUB 4HAZA 3HL0A 1YWGO 2A78A 3NKVA 4YLGA 1F5SA 4HPJB 1YTLA 4IZOA 4MJ3A 3WXMA 1TVCA 3U0VA 4WUVA 1E7SA 3C15C 4BP1A 4O3MA 3KLBA 1RVDA 3MWFA 4S0ZA 4D4IA 1NBOA 1JMVA 4HDSB 1SA0A 2AK3A 3HUFA 4P4GA 4DIFA 1YZTA 1NUSA 5FNZA 1LPSA 4IUBS 4JLOA 1KAHA 1OI7A 1ZG3A 3QVUA 1OBFO 4MMYB 1DAHA 4QATA 3VDXA 5F7OA 4GMKA 3QLEA 2GBFA 2B1GA 3KKLA 3G5TA 2X19A 1JXOA 4LGMA 5JPCA 1QO0D 2XMQA 4Z4FA 3EAQA 2ZJ3A 4IQ4A 4LRWA 2AN4A 2ZI4A 4L08A 4KDRA 2C5LA 1FLVA 3E03A 4C3ZA 4KR2A 4RZXA 4GT1A 3KWMA 4ZOQI 5JCOC 3RADC 2YYSA 1DDGA 1ZXBA 5FYDA 5JQGF 1F8XA 3OQJA 4IFBA 4EK9A 2MCFA 5A5GA 1P81A 4LSMA 4EGQA 1Q57A 1TQ4A 4CI0B 3D9QX 1AH2A 1B8PA 2XUAA 3KDAA 5CHYA 5HKLA 3ZZTA 1U0HC 4C43A 3LGXA 4YI3A 1XAIA 3V6MA 4QTYA 3TQIA 3W8RA 1XRNA 1Y1SA 3C8ZA 3I53A 3BXPA 2BFMA 3NIDB 3EVEA 4QQNA 4JJ8A 4DBVO 2ZI9A 3B5JA 1QORA 2JCBA 3U4QB 3U60B 1H3NA 2QLFA 1OPRA 1ZY2A 2GX6A 3D43A 3NUGA 3VJMA 3UHAA 3VBEA 3PSAA 3K0SA 1XPJA 2VQ3A 1YZFA 1RWNA 4UBLA 3R3JA 4D81A 5CA0B 2H4WA 1P2TA 5FOTA 3B82A 3SC3A 1YVUA 2J6HA 3BX1A 3K4QA 8ABPA 3PXAA 4JB2A 5HIIA 3SICE 1T6NA 2O3JA 4MVJP 2OKGA 3SYTA 4MO9A 4HB4A 1MQ8B 3WNBA 4NV3A 1UKCA 1WB9A 5IK2A 4KDCA 4N0MA 1FZQA 3RFXA 5MGNA 1U9ZA 1E5VA 1LLQA 1PTKA 2LPMA 2D2XA 2VI5A 3AVPA 4IP0A 4PHFA 5ELLA 4B75A 2WDZA 4C4AA 2PS9A 1WZ2A 3EFOA 2CFRA 2I3BA 3GDHA 3C3WA 3GLHE 3ILHA 4QT0A 4AURA 1B8UA 4MGZR 4MWCA 2EGUA 2W9XA 4BLUA 2JAWA 5E3IA 4OA5A 2WWFA 4WZZA 3WNVA 1Q0TA 4M55A 2P62A 3EGWA 2QRVB 4Q1CA 5SYAA 1XRPA 1ZMBA 5AOCA 4QOJA 1ZEJA 5BRAA 1GQOA 3GJYA 4QE3A 3UB3A 4YRTA 1FX0B 2I4TA 2KLHA 3BDAA 4NAUA 3LOUA 2ZSDA 4RELA 1CHDA 4V0OA 4WCVA 2YMMA 3M1IA 3NHJA 1I2BA 3GFPA 5FL7A 4IM7A 4JXXA 3VNQA 2G70A 4Q05A 3RJ5A 4OLFA 4DMUB 4IGFA 3LUHA 4MYTA 3V4VB 3NDRA 2H1SA 2JFNA 3AY0A 1II9A 2E89A 2REQB 4TQUS 1EM8A 3G8AA 3SPXA 4R71A 1XE3A 2PZ8A 4UOQA 3PIRA 2O2HA 3ASUA 2NSYA 1IUKA 1T2AA 4RK0A 1I9GA 2P2SA 4D02A 1UQRA 3FB1A 3TIXB 3V7WA 1SPBS 4V0SA 1ZUHA 4JENA 3RIEA 5IYZB 5KYWB 1DKQA 1HTBA 1WHSB 3BD9A 1F8FA 1JR3A 3GPBA 1QOPB 5EZYA 5JT1A 3C6BA 1Z9BA 2NVOA 3WJ1A 5ENDA 1KVQA 3B48A 5A1JA 1KEEA 2UVPB 3HDVA 3H65A 1JZTA 2RHCA 2GD0A 2H52A 2WU1A 1ZKMA 1S3IA 1YE8A 3NZEA 2WJYA 3ODGA 2ZBVA 4KRXA 3OUZA 2EBWA 1GL7A 4ZVSA 2JAHA 4R9UC 1OFGA 2XNHA 1XQ9A 5FPYA 4M9XA 4B43A 3Q8LA 1IEXA 4X41A 1WZCA 1E3LA 2JL1A 2NZJA 3OU2A 1H42A 4EL5A 4XA8A 2X58A 3GOHA 3K9FC 1W1UA 1XZBA 2BSXA 2Q3DA 2H1WA 2HBYA 1YDWA 2I6XA 2W71A 5K3FB 3TZEA 2DPGA 4NEHB 4WXRA 3DWEX 5GJBA 5K09A 3ZI4A 4X3OA 4PSUA 1W93A 1QVAA 4RKQA 1XMQB 2HTEA 3PFGA 1AKNA 4KV9A 4KN5A 4IIGA 2PZJA 5CX1B 4BN5A 3VKWA 5IUNC 2QAIA 5JNWA 2F3PA 4XJTA 5ESDA 3WL8A 1OH5A 1FTQA 3AL0C 1W36B 5B7NA 4I1SA 5DNEA 5LNK1 4HRXA 5AR1A 5BWBA 3A3KA 5JZOA 2CBZA 2G9QA 1ZMRA 2XGMA 3I72A 2QUBA 2H4HA 3IELA 2B9VA 3MGBA 4BLRA 2IXDA 2Y2VA 1T0HB 2PTHA 2IEBA 1ZI6A 4BRSA 2ODNA 3O5AA 3QI2A 3GIWA 4KUHA 5SV2A 4UM7A 3EXFB 4KBFA 4XGQA 5ALOA 1XX6A 3CLHA 5GZ1A 2VPXA 2EFDB 4LZNA 1PX2A 4BVEA 4U0KA 1Z8HA 3ENKA 3WNZA 4A6EA 2P0AA 3IRVA 5A1TA 3WR5A 3THYB 1ZWKA 3DTTA 1HRKA 3LLMA 4R3NA 3KUDA 1IM8A 2GOYA 2EQ5A 4DV3B 2BGGA 3MT7A 1J0CA 3D8SA 2EV9A 1OIXA 4QFMA 3DAGA 3O75A 5TSDA 3SR3A 3PNKA 4NU5A 4PONA 1YQQA 4YJKA 1E3IA 5E7IA 5EP2A 4C1NA 3OAAD 1D2EA 2YWRA 1UMDB 4LDPA 3M3HA 5HGXA 4G63A 2C83A 3G7SA 3PEVA 3VDNB 3FHCB 3AUYA 3FA2A 4NK5A 2AL7A 2G1KA 3PUKA 4URZR 4BQRA 4A8JB 2FUNB 4BAZA 1ISPA 1GUBA 3QKSA 2N0SA 1WSDA 1JIKA 4R2IA 4TZ0A 1VJDA 1IZYA 3SC2B 3DDZX 1CR2A 4FFLA 3HBLA 4QG7A 2CNDA 4NSNA 4O33A 2HC9A 3W1EA 5EXPA 5KUTA 4RHTA 3BGVA 1EK6A 1Y1QA 4L8VA 5IKEA 3TW6A 2C9OA 3GNQA 4PU0A 3DDSA 2GVNA 3FCSB 2AQHA 3PIDA 3WYBA 2WV9A 1GFZA 4KTTE 5DH9A 3W6PA 3NBXX 4TLBA 1Q6ZA 4RZ3A 3E5MA 3X1JA 5A0VA 1JFVA 2NTVA 2PL1A 1ZRMA 5HMMA 3R7AA 5E9JA 2EEPA 3RABA 3W3AH 1QU2A 2PQMA 3RREA 3CZ5A 5FBZA 2OD9A 4H7KA 2VTBA 2V4UA 2MYTA 3P4UA 4FS3A 2FWNA 4MJLA 5K2OA 4YLEA 4MRMA 2F43B 3KQKA 4HXFB 4HAOA 4C7JA 2ONJA 1JKFA 1MAUA 4ESHA 2ZBGA 2Z6QA 3B2EA 3KLOA 4N5LA 3TUJC 1VE9A 3S8YA 4WL0A 3SQXA 3R6WA 5LQNA 3ENWA 3BCSA 2QTTA 5CVJA 3KDPA 2YWGA 4F2WA 5DT2A 3SXJA 2IIBA 5FP0A 1NAIA 2FWRA 2XTMA 3OX1A 4G0MA 3KLMX 2XHEA 3SZUA 2ZRQA 4E94A 2YDXA 3B70A 4UMEA 1RBZA 3WNDA 4BO4A 3AVUA 1YXMA 1ECBA 1TYZA 2DULA 2VT7A 2VN8A 2C5BA 4JKYA 1E64A 3TW0A 5LZ7A 1LD3A 1Y9ZA 4AZ0B 1CQIA 1ODSA 4J3FA 3V1MA 2FPUA 3WKDA 4FNOA 2OB1A 5B58C 5JD6A 3GBPA 5B3JA 1SG6A 2NZXA 1OYOA 4IRXA 4E5MA 1K9VF 2BEKA 4NK4A 4WLUA 4JBNA 5HHTA 2XVXA 3IUMA 3PDUA 2XNSA 4GPD1 1SELA 3FKJA 4JKIA 1ZD8A 3N8HA 3U26A 1V2HE 5IJAA 2PSDA 3WIUA 1AKVA 3OCVA 3EVFA 1DKMA 2B25A 1UJ6A 4GXRA 2ORED 4N0QA 5IMSA 2VYQA 2IU6A 4JJAA 5DTMA 4NEQA 1REQA 2IXGA 4IHJA 4RZUA 2W6OA 4ZAWA 1BE1A 3E7FA 3BD7A 3HJCA 5ALWA 2NACA 3PHHA 5DXJA 3PLRA 1UBEA 2PKWA 1LU9A 5JANA 2JGRA 4QYSA 1N0WA 1TF5A 5BP7A 1L6IA 3QIAA 3ZX4A 2XADA 2H4ZA 3JX9A 4K86A 4EM6A 3NMUF 1W0JA 1M8FA 2BGRA 2ZYVX 1RD4A 1GZSA 1IJFA 1TYBE 4TV9A 1R27A 4A0SA 1CKEA 4B09A 4MKGA 3VKFA 5CT8A 2H5LA 3P9KA 4INPA 4KWTA 4TXHA 4XFDA 5TGZA 1QFYA 1T34A 4RVNA 5FWYB 3WJ7A 5F9HA 1UT6A 4QL3A 4O59O 4BP9A 1VL6A 3A4YA 2QX7A 4DM7A 3OZVA 4GP7A 5EQTA 1MH1A 4C2UA 1D09A 5A9TA 2TMGA 2FH5B 2CHEA 1PG5A 4TM7A 2GM3A 3DNFA 1ZONA 4EMBA 3EZ9A 2XYPA 4RMGA 2I5PO 3GNLA 1UKEA 3UJ8A 3V4ZA 4FYHA 821PA 4MJ7A 2MINA 1RKQA 3SDSA 3COZA 1HWYA 2HSGA 4C6TA 5BPHA 1M0SA 1WUKS 2C2OA 4N3BA 2R6GA 4U7FA 4JOSA 5EHIA 1WUJS 2JBAA 4R9SA 3WK7A 2RJOA 4BTEA 3ZLJA 3FKSA 4LMBA 4ZYUA 4HDMB 3STHA 4F6LA 4M53A 4YAGA 1KERA 4D46A 1CQJA 4NYIQ 4P86A 4UEWA 1H3FA 2B4YA 1IXKA 1XDUA 1R12A 3FZNA 1RJ9B 2ZJAA 3L0DA 2WKPA 4L73A 4M7WA 2PLNA 1K6XA 2RGEA 3I0ZA 1NJ6A 2VWPA 3AW9A 3RYIB 4CXMA 4CLRB 5E4TA 3IBSA 1NT2A 2R6HA 1BMFA 1XTZA 3EA4A 2NXCA 4GRDA 4L3WA 4YALA 3T9FA 1N5RA 4G81A 2OHIA 1P4HA 4ZZ3A 2GCIA 1UK6A 2WE8A 3CF4G 4YRDA 4D0GA 4KIGA 2J0QA 2ZYWX 3SX4A 1CZLA 2OILA 3D4LA 1NA5A 2FEXA 3CRRA 2GN4A 4WNYA 1PS0A 2ZKLA 4V0RA 4ARVA 4F2GA 3WYEA 2VP6A 1TKAA 1RPZA 4KXNA 1AK2A 5JJCA 4HAUA 3DE2X 4P2GA 2VQFB 3B6MA 2ECOA 3DDOA 4OXIA 2NYUA 4GOJA 3DWGA 4QRDA 4RLFA 1M34B 1Z33A 3R7WA 4A6PA 2VSFA 4ZALA 5BN3B 3LCUA 5LZ5A 4EJ2A 1I2AA 1UM8A 1Y4DE 3LY7A 4NPAA 4UPVA 5B1DA 4GFDA 1Z28A 2Z95A 3TZBA 3DA8A 2I2BA 3T4XA 5E6SA 4UM5A 4EGSA 4LDZA 1D9XA 1E9SA 2O07A 2X6RA 1HURA 2YASA 3GPIA 1XL1A 3AF0A 3D2BA 3QVSA 2YMPA 2GBPA 3DBHB 4GR9A 4KGXA 2C95A 5LZ8A 5KYXA 2B9EA 5AK4A 3WKBA 3EVTA 4IJKA 1GKIA 1YVDA 4HX9A 1DSSG 3ETGA 3GEIA 1T0PA 3NUZA 4OSPA 2H07A 2X0NA 5KKCA 2FDRA 4L8FA 4AJLA 2AKAB 2J7KA 3I4FA 4L5YA 3ROEA 2QTVB 4DEVA 3GFFA 3WQSB 1KAMA 2DVMA 2BD0A 2ZRAA 2XJ4A 3KOUA 3RJTA 4GKKB 1M83A 5JMOA 1IATA 1ZO8A 3CV3A 4GX0A 3TAUA 2Z9CA 3RQSA 3BD6A 3OPYI 4B3MB 4XM0A 4E6EA 1RNLA 5A3VA 1C9KA 5IWAB 2Y6VA 4QM6A 1FYFA 2OO5C 5LIPA 1Q7RA 4QOIA 4Y2QA 5CVEA 4IV0A 1QDEA 2CFIA 2CDAA 2J9FB 3PRKE 4IG9A 4UEOA 5LP6F 5K0ZA 4B71A 1MNAA 2J3LA 3IT1A 4Y1EA 7MDHA 4IZIA 4HY3A 3DV0A 3Q2OA 3OMXA 2PMWB 2XNDA 4AULA 4YS6A 1IM2A 5ALXA 3QEOA 4LYHA 5CBPB 1FRZA 2ZATA 1VMDA 4HRVA 1PK7A 2PLAA 3MMNA 3DDCA 4B6OA 2MT9A 3CUKA 2VA8A 1NRJB 3QSYA 3FKQA 3T7DA 4A36A 1EQAA 4CL0A 3O9ZA 4UU7A 1GTL1 4DPMA 5I7HA 2XTAA 3RVKA 2Q5CA 1E9VA 2B69A 1E2UA 3PUWA 3FFWA 1PKEA 2R751 4DN6A 5KU1A 3IOEA 1KDVA 3PF8A 1GARA 1UZLA 4KPUB 1ZJWA 2G28A 1K4MA 2LCIA 1CU1A 1DRKA 4R1MA 4ZRMA 2E3JA 2NZ2A 3O2QB 1L1EA 1U1FA 5D5QA 3WO1A 4BBAA 2PH5A 1E2KA 4H1UA 3G2PA 1DAPA 2EFYA 1DKRA 3TG8A 1RQ7A 1EJBA 1CK4A 1LK0A 5FQOA 5JCJA 4YMSA 3J7AC 2RGAA 4EA7A 4F3CA 4IIXA 3RC3A 5LD2C 2PMDA 1RJGA 1C7RA 1ZCFA 2E49A 3T9EA 5BYJA 1DAIA 1DG3A 1OI4A 4OYLA 1ZJ4A 3PR1A 1J0XO 1YZVA 2WWTA 2C94A 1IEWA 5AW1A 5IJ0B 4KQMA 3ZYZA 3LU1A 1ORWA 5DEIA 3RVLA 2O2EA 1BVYF 3HUDA 3LQ1A 1CF2O 2VJQA 1N3LA 2XRMA 2IXAA 2GH1A 3II6X 4M8SA 5IJXA 5LB2A 2X0EA 1UWLA 3TLKA 4XGNA 3LT1A 1ZX1A 2P65A 3JQPA 4QUGA 1XMSA 3WB2A 2G1AA 5KI6A 1ZD4A 3CZ9A 2UZAA 3QI7A 4C05A 1NVTA 3JQRA 2QMYA 1I5OA 2FWPA 4Q4JB 1BG6A 1LLUA 1OC2A 1UAGA 3IFSA 2E4AA 3U7JA 4AWXA 2Q46A 1VQ1A 1Q7EA 3SYNA 1ENYA 1FS6A 1WB5A 1HC7A 4MZDA 3U81A 1G9TA 1E96A 2V7GA 3EEFA 5IM4F 3U31A 2H8GA 4I8DA 2P4UA 1M1UA 1EX1A 3Q1LA 4O4LA 3AI7A 3EULA 5K99A 2GJKA 3VX4A 3ND8A 4BMNA 1MC5A 1DEAA 1KJWA 4OHWA 5H9VA 1I3CA 4NNPA 1UZUA 4PY2A 4MLCA 2J0UB 3COJA 4X20A 4CUJA 1D0SA 1NV9A 5CW1A 5AFSA 2YMLA 1N7IA 4KBGA 4P0PB 3OMWA 3UWPA 1Z5OA 5LDHA 2JLXA 2F1KA 2QVXX 3DOEA 2Z9BA 3BSYA 4LRXA 1E69A 4DDMA 5IHPA 5AIBA 5IBRA 1FRNA 4ND8A 1F38A 2BKEA 2F3RA 4KUEA 1O3YA 2QUAA 2HBZA 1CPYA 2Y0BA 1ZD1A 4ZOEA 2FRVA 2SICE 1OQAA 3KQMA 1ZVJA 2JKVA 3T9DA 3AYZB 3GCDA 1QSGA 2OLEA 5DO9A 5E7QA 1I7LA 5K3DA 1ZIXA 1C1DB 4Z2AA 5FL7D 5D2CA 2QU7A 1J24A 1FFGA 2NOAA 1T2DA 4OJYA 1T36B 3JQGA 5HSGA 3FFBA 1V7CA 1TU3A 4QLAA 3RIGA 1E2DA 1LTQA 1H8ED 1Z17A 1BXGB 4INOA 3T5GA 1RM5A 3TQOA 3UV3A 5TPZA 3V7UA 4H1WA 3L92A 4KQ2A 1P1BA 5EYPB 5JY1A 1H66A 2GN9A 4P3OA 3P9CA 5I9SA 2AMFA 3KTDA 4FYXA 4OK3A 3VR3D 5MFPA 5F76A 4CQMD 3EVNA 5K7SA 2VDNB 4ER5A 3RHSA 2QVGA 3PQCA 3PXCX 1S3SA 1EWVA 3HM2A 2DMRA 1EM8B 3KXPA 4WPGA 5FA8A 4BNVA 1QIFA 2JHFA 4LW8A 2D7JA 1PUJA 3O7MA 3ZNQA 4AIIA 2PZMA 2P9GA 1KSFX 5JHGB 1O6CA 3N3AC 4M21A 3VU9A 4XCQA 1Z6ZA 4E21A 1RPTA 5IASA 1D2HA 1VXRA 1DWPA 1XVTA 3SEZA 3COYA 5BMVF 4QDOA 2R7KA 2ZSAA 3VNBA 6NULA 2O8FB 4UDNA 1SVIA 2O6LA 3Q3JB 5C9ZA 3I3OA 2OKCA 3NT4A 3FPSA 2BZGA 2ZI5A 4ZZ0A 1P1FA 1ST3A 3KZMA 4PG5A 1NN1A 1R6AA 1ZGZA 2XDAA 3LXUX 4QQFA 2OE2A 1MBZA 5C2JB 1J0DA 1KK0A 1KY2A 3GAFA 3TKLA 3U48A 4WFQA 4N41A 3C45A 1XVVA 3DWFA 1SEVA 2IOYA 5TQ2A 1SVOA 3SQDA 3E8MA 4TTJA 4OHRA 1PDOA 2AUMA 2C0QA 1WCIB 3NJ4A 1WTCA 2J0VA 2IHYA 5EE1A 2QN3A 2VAVA 1COWA 2C61A 2NV2B 1IXSB 3HZHA 3OJXA 5AVRA 1FDOA 1YL5A 3M4JA 3O92A 4MLPA 1TD9A 3GVHA 2GEBA 3NBYC 1Y98A 2Q2QA 1KA9H 3LL7A 1I80A 1NI4A 1XCJA 3A4LA 2CHVA 4JI5B 1P7ZA 2MSCB 3G89A 2I0FA 2JW5A 4A03A 4ZRNA 5ADHA 2Y71A 2X2PA 3EF0A 1KR5A 4WNAB 3G0HA 5TVGA 4U7JA 3QPVA 4H4DA 4BMXA 2PM8A 1U3WA 3GRYA 5HFNA 4B3TB 3K3PA 5EJGA 5GJCA 1DAOA 3FNFA 1J07A 3DE5X 5TEWA 5BURA 3JVEA 4M0DA 1E3SA 1YJXA 1FUKA 2RAVA 4P58A 3WWCA 5AVUA 5FOQA 1J9GA 4DNQA 1YBVA 3R0VA 5KC8A 3SEAA 3VTZA 4GQIA 5H4HA 4DZRA 4PICA 1RBYA 2ZW9A 3HLTA 5D3ZA 2IWRA 4I3FA 3BIJA 4JEIA 1V9CA 4Y2YA 2YV2A 3ECAA 4D9NA 1T1SA 3OZIA 4RHYA 3F49S 1J2EA 4ENSA 1N2CB 3UFXA 1KPGA 3EWNA 3Q8XB 3TSZA 4UTNA 1QLWA 4HLQB 4KAJA 1L5HA 1AQYA 4UJ5A 3AR4A 3QJ5A 3S70A 2Q6LA 2W4QA 3HKDA 4C0XA 4RV4A 1P2UA 5CDGA 2ZYGA 4KSCA 2EWWA 2VPQA 2ZUWA 4GMGA 1U3TA 4DLRA 1CP3A 4JJ6A 2FJ0A 1T0JB 2BEJA 4LZWA 3ILVA 1YRHA 4GU5A 4MW7A 4CUZA 2B83A 2Z1MA 2E21A 1TKBA 1TC2A 1CS0A 4BO2A 5KDDA 3PD1A 3RHFA 2VLBA 4DC9A 4NYMQ 2FCAA 3EX7C 4M38A 5G0WA 1G5TA 1BS9A 4FMPA 3ZE9A 2XKBA 1RKBA 4ZOAA 1XOIA 1VG9B 3MLEA 4DIDA 1Y4AE 4KN6A 3AR6A 1QGUA 3R6LA 4UMVA 4JWKA 4TXLA 5JDIC 3PCXA 1Z6PA 3FPKA 4LBYA 3UAYA 2WILA 5AM2A 5IS2A 3KJNA 1O8CA 3D0QA 4WFKA 3C1OA 3T5CA 1Z2EA 3ZU2A 4UD2A 2BHRA 1K86A 1GV0A 1GQ2A 4EABA 2IOQA 3N8GA 1F2UA 4KMRA 2FPGA 4R8VA 4V0QA 1O5TA 1DOZA 1F51E 2IOFK 3KYDB 4G24A 3O8DA 4ZREA 1G20E 2NQTA 4NBWA 4B2PA 1HX7A 3OD5A 4IGAA 3R24A 3FVVA 3MWDA 2VQ6A 3REQB 4DRXB 3LMKA 1U81A 3HGMA 4BASA 5L4SA 3EC7A 3WYGA 3ZV7A 4BQQA 1ZWLA 3HR8A 2WJJA 4HDRB 2Q49A 3C3MA 2W2LD 2EKBA 2BY4A 3FUTA 2GTPA 1FUUA 2HU8A 3WDKA 5E0KB 3HB7A 3IEIA 4JB3A 5IVDA 3IIMA 2VDPB 2IPNA 4FI3C 1MXHA 1G5QA 1EVKA 1XHEA 4BFVA 4F4DA 4JLBA 1YJBA 3QLVA 1JLKA 2VPTA 1KBOA 2IA5A 1ZK0A 3DB1A 2DJ5A 3KKPA 4P7JA 1M2NA 3PEEA 3ASVA 2QG6A 4CM7A 5IJ9A 3T9BA 2VBGA 3G9TA 4EFMA 4ETMA 2C9CA 1XTSA 1N5LA 4MUFA 4DDTA 5E6SB 5EHXA 1DC8A 4BU1A 2G0TA 4EJ0A 2XA2A 3Q3VA 3H7IA 4EGFA 1H8HD 4FX2A 4IGIA 1JLMA 2I4IA 3DE4X 1I0LA 3ZJUA 3OIFA 3ER8A 4XDYA 1A5AB 5M04A 1GGKA 1IZ7A 2AUNA 4J0HA 1IBKB 4DA7A 3RG8A 1Q1BA 1LY1A 5PNTA 4A1OA 2GJ4A 1I4EB 4G9BA 3N2GA 1UDWA 4TYPA 4EOGA 3N0XA 1E9DA 4XM2A 5FULA 2FUKA 1RHRA 1S2LA 4IINA 4NX2A 1M2HA 3EPJA 3ZJ4A 3KQYA 1N2JA 2QPOA 4M0KA 4OYRA 4MMXB 2VYFA 4BZPA 4QJ3A 2AQ8A 3PXXA 1JTFA 3HKEB 3WGIA 1JJ7A 2BGIA 3GAMA 4EA8A 1H9AA 1VCNA 3QX3A 4UBIA 2C4KA 4DLNA 1DV1A 3RYCA 1II8B 4XVCA 4R3UC 4KVFA 4JQZA 1UAYA 2O0HA 4HFJA 2HSWA 2DUWA 3PFFA 5C7YA 3I04M 2V5AA 2BWJA 4Z4IA 3KJFA 1EA7A 3CLTC 3VR3A 2LR0A 1LUAA 5IDXA 2HGSA 3K1TA 4CDNA 2K2QB 4OLAA 3OEHA 4I55B 1Z0DA 5BSRA 2VYVD 4IDDA 3PICA 3D81A 2XVMA 1E4EB 1CVLA 1EESA 2AOWA 3DAOA 3VPXA 1TMKA 4EAAA 3UT5B 4WJLA 1OYVA 1J1IA 3HRKA 2V45A 4WEOA 2IYXA 1J0BA 4LISA 1E3TA 1H94A 3RS2A 1QPBA 2CHGA 1SC1A 3S2EA 3T3GA 2G08A 2J4DA 2O8NA 3NAZA 1EK0A 5KTSA 1FX1A 1TKRA 1ZK4A 3UPUA 5DLYA 1R4NA 3GNSA 3P2IA 4X0EA 2DH5A 4K9MA 2F3TA 2NTJA 1FMJA 1YT5A 3EXIB 2R60A 1P5RA 3KT6A 4KK4A 2PIAA 1SXPA 1EK2A 1VMIA 1MOSA 1RS0A 2ZK7A 1P5FA 1FDSA 2QMZA 4TXMA 3LBAA 3U4AA 2PO5A 1CUIA 4XLLA 2IPAB 2WTUA 2Q5HA 3ZE1B 5DNVA 1Q0PA 1XTIA 5CFLA 3L0YA 2DQZA 5ICMA 3ESAA 4M7OA 4Z1OA 2QYTA 4O1MA 5BWNA 2IE8A 3PJFA 5REQB 1KOFA 4XXHA 1YL7A 2ZPAA 3QVOA 1EAMA 2YHSA 1GZVA 4IYRA 2J3DA 4U9HS 3WIOA 3A8TA 3QPUA 5C37A 2Q1XA 1HY3A 2GHTA 1QS0B 4EAQA 4JYAB 2UXBB 4PG8A 1XEWY 2HHJA 3LZCA 2HK6A 1GGNA 3CGGA 4X93A 3P9ZA 3DYBA 3RVQA 1X3LA 3EZNA 1D8TA 1BJRE 2M1XA 2QZZA 4M1KA 4PAWA 3GVPA 1KO8A 4XAQA 4QGHA 2ONYA 3U56A 5EPOA 2CLKB 2FQXA 2OAGA 5LYJB 1P7WA 5T57A 1R9MA 1CJCA 2ZT8A 3GZ4A 5FUVA 3ZY2A 2WIGA 4FD2A 1UPBA 1VSTA 4NJOA 1L7NA 4ZO4A 1IB6A 3ZE8A 4TV8A 2XWSA 3OTWA 4OJQA 1NVGA 2NUTA 2NNWB 2WT4A 2Y92A 4Y6SA 2IPLA 1DRUA 4L02A 1MO5A 1QIDA 4YP5A 3V7NA 1C7QA 2NGRA 2BSAA 2Z8YM 4R05A 4CQMB 3GF4A 3B8HA 4P08A 3W4KA 1VE1A 3CZAA 1DGQA 5JAHA 2V6MA 1SIWA 1U9IA 2AOTB 1D4FA 1LI4A 4QQ8A 3G2HA 4GPTA 4R54A 4D2IA 3E18A 3O8NA 4DPLA 1QR6A 3NDPA 3O4HA 2Z5LA 2IU3A 3BHJA 1U94A 1AO3A 2HO4A 4PLCA 1KOJA 4CV0A 4O4IF 3OFNA 1BCRB 4TYNA 2G82A 4MA5A 3SEQA 4A23A 1OR8A 1FJXA 1TIBA 3I6YA 4GL2A 1M8PA 3QKUA 1KETA 5B5SA 2OG2A 5LA6A 2VJOA 1KFEB 5JEEA 4ARCA 5K6AC 1FFEA 1MQSA 2FSVC 4EEXA 1X13A 2PRYA 3ZK8A 2DBRA 1HEYA 4QGAA 2DP4E 4L9RA 3PQ7A 3EODA 2PT9A 3HBFA 3QQ5A 2HYIC 3IJRA 4CM1A 4LHVA 3GV0A 4QJ4A 1V1MB 4FONA 5GZ3A 5FBRB 3SF0A 3JWGA 1NIPA 5T41A 5HFAA 5EESA 4C2AA 3S29A 2XA9A 3DMYA 5EEGA 3LUCA 5BVGA 2BEWB 4YRQA 3BWCA 3V9AA 3KPUA 5B1YA 1EVLA 3TB6A 3F5DA 5FTLA 2WZQA 2BI7A 1G8KA 2JG3A 1GA4A 4RORA 4Y6RA 2POCA 5LZ2A 4BO8A 3B9PA 3GG9A 4I6EA 3GLGE 1SMKA 4W7SA 4KKVA 2GXUA 4S0XA 1WDTA 2YHUA 5JYDA 1KDRA 3K20A 5HKKA 1CY4A 2FMXA 5IF9A 3IDAA 2QPTA 4XGIA 2W8ZA 1UBRS 2ISCA 1X0VA 1BJKA 4ZDJA 1I10A 3FJYA 1I3OA 2VBIA 1U31A 4R41A 2YOGA 4H0FA 1J5EB 3AJ8A 3A4TA 1G42A 1YR6A 4RSGA 2J3JA 2Z1NA 2AJTA 3BOSA 2BGNA 2OAEA 1YJAA 2W43A 3ED1A 3PLAE 2QD1A 4RPCA 4RM2A 5BN4B 2O3RA 2ATVA 1NVBA 4LHZA 1UDBA 3H87A 4EPVA 1Y8QA 1DJNA 1QYVA 4ZFNA 3E0XA 4JASB 2VUHB 4ZDIA 2R86A 3FSGA 4L85A 1K63A 1CZOA 5EJAA 3Q4GA 5KYNA 1WG8A 1LLCA 3LHKA 3JTEA 4X7BA 5LXTB 1OH7A 4F92B 5KNBD 2DOKA 3I2FA 4M89A 5EJEA 2RHGB 3M4ZA 4EATA 3TKYA 4CTMA 1CNMA 2DETA 3M2TA 3TPCA 4BRZA 1KYQA 3QV2A 4LJKA 5HWSA 1GTRA 4C7OB 4H3KB 4OYHA 2DTXA 2JS7A 4JS0A 3I0MA 3IAEA 4M46A 1PR6A 5TF4A 2BEVA 4Y1GA 4RTMA 4B2LA 4B1FA 3ZBPA 3A32A 4C87A 5CIQA 1JWAB 5BW5A 3BT7A 3V48A 4IDQA 4MDYA 5CXSA 3EPHA 5KVSA 4HAYA 3KVVA 3IJEB 2GZ2A 4QWMA 1TECE 4KQGA 3MSCA 4ND4A 4KQ6A 3U7RA 4OXXA 4R1UA 4CTNA 3AF5A 2OCKA 1AA6A