1SBTA

Atomic coordinates for subtilisin bpn (or novo)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
275
Chain Sequence
AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETPNFQDDNSHGTHVAGTVAALNNSIGVLGVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGSTGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDSFYYGKGLINVQAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic coordinates for subtilisin BPN' (or Novo).
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase (serine proteinase)
molecule keywords SUBTILISIN BPN'
total genus 81
structure length 275
sequence length 275
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1972-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1sbtA00
1BFKA 1GA6A 3DE1X 1BJRE 3F7MA 4NE9A 1NLUA 1C9NA 1YU6A 1MPTA 2E1PA 2XTJA 3VTAA 1GCIA 1Y3DE 3GT4A 4FONA 5FBZA 4MZDA 1V5IA 1PJ8A 1R6VA 4ZOQI 1TK2A 3VV2A 1JEAA 3DE5X 5B1EA 1R64A 3WIVA 1ST3A 3LPCA 5AQEA 1WMFA 3VHQA 1SUPA 1YJCA 3LPAA 3DYBA 1EA7A 2PRKA 1SCJA 4DJ5X 4GI3A 1KDYA 1EGQA 1XF1A 1GNSA 1TO1E 1TECE 1SPBS 3D9QX 3WIUA 4B5LA 3D43A 1NDQA 1S02A 3DDZX 2IXTA 3PRKE 1BE8A 1SUBA 1Y3CE 1SCDA 1TMGE 5JMOA 3L1KA 5JXIA 1A2QA 1C9JA 3P5BA 4H6VA 2W2NA 1SCBA 4YN3A 1ST2A 1Y34E 3I37X 1OT5A 3Q5GA 2SBTA 2SECE 2P4EA 1WMDA 3EIFA 1SCAA 2GKOA 1VSBA 4H6XA 1SELA 2Z56A 4WOBA 3LPDA 1SBIA 1T1EA 2B6NA 1SBNE 3Q40A 5ARDA 5FFNA 4Z2AA 4I0WB 1CNMA 3LXUX 3F49S 4OMDA 1S01A 1PFGA 1Y3FE 1Y4AE 1YJBA 1LW6E 2WUVA 1GTG1 1THMA 1P7VA 1TM7E 2PYZA 3WHIA 1SBTA 1SCNE 2QTWB 4NMXB 4OMCA 5FAXA 3SICE 3VSBA 2G4VA 1S2NA 2IY9A 1BH6A 1ZVKA 4ZARA 3A3NA 2ID8A 1CSEE 2WUWE 3T41A 2W2MA 2PQ2A 3GCWA 3VYVA 5JXHA 1AK9A 1P8JA 1OYOA 1Y4DE 3DE2X 3QTLA 3EE6A 1IAVA 1PTKA 1SUEA 1Q5PA 4C3VA 1AF4A 2SICE 1SIBE 1SBCA 1HT3A 3AFGA 2PKCA 3I34X 4HVLA 3UNXA 1WVMA 4H6WA 4K8RB 3A3PA 1KE2A 1SUCA 1TM5E 2W2OA 3DWEX 3TI9A 3AJ8A 2W2QA 4LVNA 1TM4E 1GT91 2W2PA 4LVOA 5AMXA 2ZWOA 2ST1A 3VV3A 4AKSA 2HD4A 1AQNA 2WV7A 1YJAA 1BE6A 1DBIA 2V8BA 3CO0S 3A3OA 1R0RE 2Z58A 3EDYA 1Y9ZA 3I2YX 5ARCA 5SICE 5B1DA 4CFZA 3PTLA 1AH2A 3SQOA 1UBNA 1V6CA 1KE1A 2DUJA 2DQKA 1DUIA 3ZXXA 1WMEA 2Z2ZA 2X8JB 2HPZA 2ZRQA 3OSZA 1TM1E 4KB5A 4NE7A 1AU9A 3DVSX 3I30X 3QMPA 2ID4A 4DZTA 4CFYA 1OYVA 1SBHA 1KDVA 3BX1A 4DWWA 1IC6A 2PMWB 3ZXYA 1BFUA 2X8JA 3WQBA 3DW3X 2TECE 2DP4E 4RYDA 3HJRA 4C3UA 2ZWPA 1NDUA 3DE3X 1GTL1 1MEEA 1SIOA 2XRMA 3DVQX 4M1ZA 4BWGA 1T1GA 1ZVJA 3DW1X 3DE7X 1GA1A 1TM3E 1SUDA 2WWTA 1KDZA 3QFHA 3TI7A 1SN7A 2Z57A 3GT3A 1SUAA 5CW1A 3GCXA 2PWAA 5I9SA 1GNVA 4AKTA 5AVKA 1GTJ1 1C9MA 4J94A 5JXGA 4HX2A 4KPGA 5JXJA 3DE6X 1Y48E 1SH7A 1WSDA 1AVTA 2Z2XA 3AJ9A 3BGOS 3DE4X 3TECE 4WOCA 4OV6B 1SIUA 1T1IA 4KG7A 1TO2E 3BPSA 3F7OA 5K7SA 1Y33E 1SVNA 2PWBA 3H42B 1Y1KE 1P7WA 1AV7A 2Z30A 3CNQS 2SNIE 5AVJA 4JP8A 5ARBA 4CG0A 1PEKE 2Z2YA 3DVRX 3DE0X 1Y3BE 1C3LA 1GA4A
chains in the Genus database with same CATH superfamily
4B3CA 4UTRA 1E20A 5L8VA 4X84A 3MCTA 5AJTA 1QYVA 4OQEA 1TF2A 3CZRA 2H2AA 2Q4RA 3OC6A 4FR5A 4G5SA 4GXNA 4KV9A 2WPDD 3OIYA 1MQ9A 2HNAA 4MITA 2YIVX 1VHQA 1JEAA 3VV2A 1Z4PX 4M1YA 1C81A 4RNCA 4ZEVA 5B1EA 1PT5A 1L0BA 3VC2A 3LPCA 2ASVA 5B58C 3I8SA 4BE4A 3P4YA 1A9RA 5D7NA 1YMVA 2W2KB 4YRZA 2CBXA 1GYQA 1GPLA 3TQTA 5E0OA 2C78A 2NYVA 1GNQA 3LS2A 4ZTBA 2XUOA 3FPBA 3DBHA 1BEEA 2X1LA 4ZTUB 2VWQA 1SUFA 2LDXA 5AD1A 4LF9B 4XZ3A 2VPQA 3HYRA 4GI2A 4LV5B 2ZAYA 4WK2B 1TQ6A 1NVVQ 1U3VA 5ILOA 1WP9A 4EUSA 3QBVA 1E2HA 2NSHA 3R5KA 4QJ3A 2JHFA 1XNGA 2M32A 3CLKA 3BH7A 2D74A 2NO7A 4A2WA 3AZPA 4E0BA 1VP9A 1VYHA 1LPBB 1O6CA 1W59A 4AKIA 4YRBA 2C5LA 3HKCA 1TI7A 1JHRA 2B0CA 2VNHA 4ARBA 1QCZA 3HBFA 2WJ4A 5IMSA 5SYAA 1U7XA 1I9CA 3WGYA 3RC8A 4MW9A 1OJ7A 5LCXA 2H1CA 3KPJA 4D6XA 1XNRB 3GCWA 1BFDA 4HNRA 1TUEA 3CH4B 1UPAA 4J3FA 4OQNA 3IOMA 1OH8A 1PTKA 3T4PA 3WE7A 2WWWA 3RLIA 1UANA 3CPJB 1YB2A 1Z08A 3UCEA 1FS5A 3PQ8A 2G1UA 3OQBA 2GEVA 3BG5A 1P1HA 4RF4A 2PT5A 1XU7A 3O8OB 1H22A 3IVMA 3HEAA 4JCCA 2A35A 1K3FA 4C0HA 1L5MA 1KPIA 3E84A 5IJ0B 1RI2A 5LJLA 1SU6A 3HYCA 2HM7A 4P34A 1MOSA 1PT6A 1Q6YA 3LH5A 2X1HA 3LUBA 5ALYA 4QFBA 4AP9A 3BGIA 2HTEA 4LN1A 4Y18A 2EP7A 1P2DA 4JAVC 3OWXA 3WAKA 5EYPA 1FRVA 1N0UA 1Q50A 1X42A 3IC5A 5E38A 2OORC 4Y0VA 5JSQA 3HKCB 4C0JA 4DR1B 4DMHA 5IAAA 3E8MA 3UOAB 5KJ1A 1JR2A 1G5TA 5CHEA 3RIXA 3QXGA 4U5XA 4JVLA 5K3SA 3U5ZB 4HWGA 4M99A 5HKKD 4QATA 1U9IC 1BHJA 1U9ZA 1H2EA 2AFRA 2YV1A 5G3ZA 4YX9A 5BMVA 4ZVOA 1TEHA 1Z6TA 1Z88A 3AC0A 3ZCPA 3M4NA 4CW7A 1GPKA 3HV2A 2BHLA 4K6FA 5EUQB 2CFCA 1XQ6A 2XB8A 1VE5A 1MO2A 4H15A 4BNKA 3WIDA 3JATB 2DPGA 1AQ6A 1U0FA 1DQYA 1HTBA 1W35A 3PHBE 121PA 5CLLA 3M7IA 3I04M 3HCBA 3P5SA 4PAMA 4NQRA 3ZWXA 4G0VA 5LQRA 2CF5A 3HJUA 4BDTA 1AK1A 2PQ6A 1E4EA 4PLGA 3BE8A 3VYRB 3MOIA 4W5WA 1W5AA 3OJFA 1AQLA 3A27A 4IGEA 2F55A 2FZEA 1PZXA 3LUPA 1ZNQO 2WKRA 5AUOB 2H9IA 3DAPA 4JP8A 2WWIA 3LY5A 4L1KA 2XOXA 3RS2A 4F3NA 5KMGB 1Y1QA 4L08A 1IATA 1EGVB 1Q7EA 4FNMA 4TYPA 4WZAB 2NW6A 4RZ3A 1LD3A 1KQFA 1HFJA 3IQDB 4PO8A 3GT4A 2CGEA 5K01A 4R0MA 1RPJA 1F8YA 2XNHA 1T2UA 3DL0A 1PG0A 1N5DA 4DA7A 1VM6A 5KYYB 5MN5A 2F1IA 3LY8A 1M2WA 1DOZA 3TZBA 1W581 2HMSA 4IUYA 4TQ9A 3JAWB 4WUTA 3UWDA 3CEAA 4I5GA 3MWEA 1KYYA 1M75A 1NHGA 1OI2A 3SE0A 2RHBA 4GXRA 2KE5A 4RKWA 1L7BA 1KYZA 1THZA 5AOAA 3MNFA 4UU0A 1IK6A 1DC8A 2QP4A 3E48A 2P6OA 4D0NA 2Q5HA 1L5VA 2BSAA 2CXTA 3I4LA 5TQ2B 1GUBA 1OBVA 2CBZA 3C3YA 3PFKA 5EJMA 1RKUA 3U4AA 1ZM7A 2YRFA 2CCGA 4QGHA 1Z4NA 3UQZA 1U1GA 4MQFA 4B40A 5JCPA 4DV4B 5E4TA 2OHHA 4NDNE 3QPUA 5B7NA 2PCLA 2WJJA 3ZG6A 5CEFA 1NBOA 2IXDA 1Q74A 1ZIPA 3S2YA 3LXUX 4MVJE 1H1LA 2WJWA 4QYXA 1QS0A 1P9RA 2AG0A 3VKUA 2Q5IA 2CB9A 4OMCA 2Y9PB 2LZ0A 5G0TA 2R85A 4DPLA 3FTFA 4Q4LA 4D8UA 4ZZIA 2OBBA 1M2VB 1H05A 2CHGA 3CRRA 5E6UB 4D6PA 2ISSD 2D1SA 4LJ9A 3Q85A 1GQSA 2EKLA 1YVRA 2QL6A 2YYZA 4IEFB 3RUFA 3FZEA 2NT4A 1N2HA 3AXSA 3DZ8A 3PNSA 4G67A 2R1VA 2BP7A 3KETA 3HBAA 1C0PA 521PA 3LHIA 3WWCA 1PZMA 3WTBA 1JDJA 2WE7A 3BD7A 4BASA 5KOYA 1QRTA 5L3RA 3QSYA 3NDRA 1S3GA 4X41A 3HKEB 1VMAA 4G0OA 4J0GA 3TLXA 2O2CA 3R6TA 4HPXB 3SHQA 4ECEA 3AVXA 2QGNA 3A3OA 3S40A 2ZSFA 3VZRA 1AH2A 3PI7A 1XTSA 2JBHA 3G0CA 3PTLA 4N49A 5C4IA 2GBPA 4KLAA 2IS1A 3T34A 2CLOB 1VIYA 3GAZA 3TX6A 2XCLA 1VI6A 2R84A 1HGXA 3AF6A 3CVXA 2HK8A 5EJ6A 2DQZA 1V41E 4L3WA 2PBRA 2NG1A 5J47A 2EW1A 5AKLA 1FOEB 3ID6C 3H11B 2PMWB 4GKBA 4ES6A 3RODA 3WDKA 3OLXA 3ZIAA 5CNIA 1PIWA 1QTRA 3MD9A 2ORIA 4O08A 4R1MA 3TLMA 2GK7A 2GEBA 3HCDA 3VU8A 2CBGA 4XVUA 3KJHA 4QUAA 1DBWA 3DW1X 4K9LA 1CJTC 3GFVA 4ME6A 3SZ3A 4DMMA 4OHVA 3BMQA 1VCIA 1LFAA 4K2AA 3MGKA 3U9LA 4BNMA 4CQJA 4X66B 1HYEA 3AUYA 3GCXA 1K89A 3ETHA 4QULA 4RVFA 1NC3A 3AETB 3RFFA 3TFWA 2N42A 5EJ4A 3THYB 4HNQA 2RI6A 5BSKA 5BV2P 2C3UA 4A73A 1WCV1 1RXEA 3PNPA 5I7OA 3Q5DA 4O5AA 1GNPA 3WHKA 3CUUA 3L0IB 5EHIA 3WLTA 1ZR4A 4MDYA 3OT4A 3RSLA 5TB5A 1GRVA 5CD1A 4S04A 1OTHA 1BU8A 1J97A 2H65A 2QMUA 2ZSEA 1KC1A 2Q0HA 3RSCA 3WYGA 5BSFA 1PF7E 1GA6A 4FEEA 5HDBB 4L9AA 3R7AA 3X1ZA 5KQRA 4AB1A 5CB4F 3JZIA 1FYWA 1D8TA 1WUJS 1X7GA 2QTMA 2R97A 1MW9X 4FS3A 4FU0A 1QVVA 2VVTA 3WAJA 1XKTA 1RABA 1I2CA 3U4HA 1EB9A 3TCXB 2B7CA 2PCJA 2IDJA 1TM2A 4Z7QB 2IPXA 4XASA 3LC1O 3WI7A 2QZJA 5JPCA 1EX1A 2PEYA 4PZ9A 4LZZA 2ZSDA 1RFGE 3L4BA 4C6RA 3SEAA 3FI9A 4LJKA 2J30A 3EZ9A 3W7AA 1XCGB 1FFXA 2DBYA 1MH1A 2WSIA 1T36A 4HS4A 1BE8A 1A9PA 1R0WA 5E1MA 4BE7B 2HA0A 1FIUA 2XGJA 4DCUA 1CY8A 1TT5A 5L40A 1UBCA 3QYAA 4X3CA 3G89A 4EG5A 5JAQA 3MTAA 1F7VA 3SR0A 4H7EA 1BD3A 1PS8A 2C0QA 1R2QA 2VK4A 4WFJA 1LZLA 2UZ1B 4EA6A 4YRKA 5IHXA 2AZMA 4FNGA 3WWPA 3NB0A 2ZR9A 2ATEA 1R6DA 3OKFA 4F3RA 4JL5A 4RK0A 1DARA 3NHWA 3X3HA 1NW4A 3D6HA 3PIIA 1TZKA 5ICFA 4K7JA 3GVPA 4ENRA 4I2VA 4QYIA 1J21A 2FVXA 5FAXA 3AM1A 1TEXA 3OHPA 4Y7CA 4DRZA 1A50B 2CD7A 5IZ4A 1WF6A 3IO5A 4H4EA 3T41A 3K1AA 1A3CA 1M2FA 1P1CA 2CJFA 1KEEB 3ZWDA 3JYNA 3NATA 1EBFA 2JFUA 5HGXA 5LMUB 1ZRSA 2YXLA 4KODA 4EHBA 3AYZB 2BEUA 2VI5A 3M6UA 4AICA 3OQHA 5ILGA 2JIDA 4D2IA 5KNBD 1QLWA 4OB7A 1VCNA 3Q88A 4CM8A 4LC9A 4WBXC 5BWNA 1QIJA 3OFKA 5FO1A 5B4TA 5JI2E 1XAJA 3RFXA 3M4JA 2BMJA 3EZ2A 2O14A 2BFDB 1BXZA 1Z16A 3N2IA 3NJ8A 4JOCA 4LE0A 2J3DA 4U39A 5SYNA 2A1UB 2QX9A 4QX6A 1F8GA 3WYFA 3R5SA 1XEWY 1Z45A 1E1CA 4CJXA 1ZD5A 5GQSA 2QPTA 3FHCB 2P6PA 3MGGA 1Z3CA 4IV5A 1KP3A 2JAQA 3EVFA 1ESDA 1P17A 3INGA 2VH5R 2ZRLA 5CIYA 2HFKA 3T5DA 3LXXA 4EJ0A 1H2XA 1YU9A 3GNLA 1T5OA 1QLHA 1UM9A 4DA8A 2ZWPA 1ZA1A 2QTBA 4NBSA 4C01A 5H1YA 3T3EA 5HFJA 4E51A 1VMKA 1WUTA 2J08A 2C4VA 2RGUA 4TKUA 1YB6A 4KEAA 1OZAA 4V0NA 1C3EA 4WXPA 4DT1A 1I7NA 3EMDA 5H3HA 2F8TA 1BHSA 1C8LA 2AUNA 2H5JA 3DEZA 4NU5A 4OQDA 3CTPA 4QEKA 4EY3A 3ETCA 4EF5A 3DAYA 3DJYA 4PINA 2JLZA 3DEKA 3I53A 1KARA 4OLFA 1W52X 3S7TA 1VLMA 1RZVA 4BV3A 1Z06A 3LKZA 4LJRA 4WKPA 4NCAA 3R5TA 5DGHA 1CIPA 4HTFB 4BJ1A 1JSCA 5LN1A 1JH9A 1JA9A 4LRSB 4K0KB 4W5JA 4G1BA 1BDJA 3W6UA 3HY3A 4QQ8A 3DJFA 5C18A 3F6SA 4QXPA 2F67A 2C1XA 4N7MA 2IZ0A 3CKYA 4UATA 4EHAA 1N5IA 2I33A 2W2XA 4Y0AA 3SC2A 1PJSA 2Z5LA 3LZDA 4MS3B 2OCPA 3DF7A 3RUCA 2E1PA 4FBMA 4QEZA 5DOZA 1T4GA 3AF2A 3C16C 1GQ2A 3FNEA 3NNNA 3G8BA 4O4JB 2Y66A 5IN5A 4JFRA 3KQKA 4WPGA 1IIRA 3Q7SA 4OU5A 1NIJA 3PJEA 3PGMA 4KLNA 3MFYA 3EOZA 4UVDA 4FQ5A 1F0PA 2B5VA 2VSOA 4B5LA 3CRQA 3U3XA 1KYIA 1L3IA 2VDLB 2YASA 4WZAE 1R8SA 3HJTA 3T1TA 4K5QA 4NCXA 4Y1RA 3WJ2A 2R1UA 1UPUA 1LLUA 3TTWA 1JBKA 2HMWA 3P0EA 3KPUA 2YXPX 4L74A 3F98A 3ZDRA 1J20A 1JHDA 2ODPA 5IJ0A 3EGEA 4YRJA 3KYCA 4LDPA 2CV2A 2O0KA 4LY6A 3HFGA 1VRWA 3WY9A 3VU9B 3W06A 2OO3A 2ICAA 4RDIA 2PH3A 3WK4A 4AWBA 1ZM3A 3USZA 1NLZA 5BVGA 5KKCA 4KOEC 3PZBA 5FIUA 2JG3A 4YP1A 3B60A 3ZCXA 3PUHA 3HMKA 3K0HA 4O4LB 1CJUC 2QR5A 4M38A 2HSEA 5ECWA 1MB3A 3CLSD 3V4PB 1FTGA 1XVUA 2ZR0A 1FXUA 1EEHA 1KY3A 4MHOA 1ZDMA 2CLCX 4MXDA 1DEKA 1CSEE 2ZB8A 2P5UA 2G8LA 5HE8A 4CKEA 3NHFA 1OFHA 2EOAA 5BVHB 3RUHA 2ZULA 3I4FA 1CLEA 4MICA 3FPEA 2GRJA 1R0KA 4TV8A 3RYIA 4PRLA 4YMGA 1U0BB 4YMTA 1F1BA 3WJAA 2YJ4A 2KBFA 2YV4A 5LBIA 1N2BA 4DEVA 1Z38A 1DNPA 1E3QA 1Z0IA 4XUEA 1AUXA 5K8CA 1Z36A 4P7JA 2Q1XA 2XNDD 1UODA 2GN6A 5K0GA 1Z2AA 4GI7A 1G8YA 4XYEA 2QIOA 2QW1A 5IBPA 2B8JA 2P69A 3BCUA 3JAMA 3DDHA 5AW4A 4LSGA 1MQAA 4K6MA 5H9VA 1UBFA 2JIPA 4FWBA 3VU9A 4CHGA 4E2XA 3P0RA 2EGUA 2OCXA 1XHEA 4U9IS 2OHVA 2BGUA 1ZK1A 3NBFA 2BF4A 1JEDA 3IUMA 3AF3A 4YS6A 4UFPA 2BDEA 3FJOA 5T41A 2QTVA 3EFHA 3VHXB 1F8XA 3T3DA 4BIIA 3U9SA 2X0FA 1G5HA 1QG4A 2OB2A 3G5LA 1D0SA 1EDZA 1Z8FA 3QOYA 5H16A 5LOVB 1HPLA 3I45A 1L7QA 3EWNA 3OTHA 4C6HA 1OI7A 3JQGB 3MLEA 1NSFA 4GEGA 2D5LA 2QAGA 4FDLA 1GUYA 1M74A 3O4VA 4DR5B 2D6FA 4R81A 4KREA 2LPMA 5DWVA 2ZLBA 5JS8A 4P0PB 1QHNA 1LNZA 2QQ5A 1NYQA 4GOJA 4DCCA 3QWAA 3ZCUA 1A8IA 2DERA 1GVNB 3ZHVA 2FXIA 1NZDA 3EQ9A 1I4TD 3JW8A 4U4AA 5T64A 4B83A 2FFHA 3STXA 4E5UA 5FJIA 1XNHA 1BYUA 1N2ZA 2R6ZA 5ESRA 4UNRA 1TO2E 2HIHA 2DRIA 4KO3S 5JQGF 2A4MA 2WTXA 4RF2A 1AV7A 4B7UA 4WXYB 3FIJA 3PC7A 2CLEB 2B82A 3CWZA 3DE0X 3EEFA 1CY6A 1CJVC 1R5JA 2FPMA 2CXQA 3AHGA 3EW7A 4MZDA 2Z5FA 1T2EA 2QW8A 5DNAA 1XXHB 2FSSA 1QS0B 3AEXA 4RE5A 1YDWA 4GSYA 5F7JA 1CYDA 3KE8A 2G08A 4RQUA 5AW0A 4LYFA 3FNIA 3N6RA 2YVQA 1A8SA 3IQXA 1HLFA 1MBZA 3NXSA 3DQZA 1KDYA 4W8GA 1AO0A 4HX9A 4ZREA 2UZAA 5IS2A 2X86A 1S2LA 3LHDA 3R5JA 4ZQFA 1FYDA 1OFUX 2NU9B 4AURA 4QHSA 4OPMA 4CDRA 1KI9A 4HHEA 1ZEJA 3LG2A 3VR5D 3M8KA 1BVYF 3HL4A 1TQ8A 4KI0A 3TJMA 4FGKA 4KYVA 5SY9A 2FPPB 2GHTA 3RVDA 1U7TA 3WMXA 4D9CA 4AS2A 1Q7BA 1V9CA 3KKKA 4NK4A 2PL5A 2XNCA 2M1XA 1Z07A 3EF1A 5FA5A 3UH0A 4P8RA 2ZTLA 3V00A 3WX0A 2DKNA 1OI3A 4NU6A 1WUHS 3IQZA 2E4YA 2Y1LA 1T9BA 1R0SA 4IJWA 1NUHA 2IY9A 1SOUA 2DFPA 3PUYA 4TLCA 4KL8S 5ES3A 2AXPA 4M87A 3RVNA 4PQFA 4CF5A 2WJVA 3MB8A 4FSDA 5IFKA 3STVA 2BDUA 2PUCA 3NW9A 1L4MA 1ATIA 4FQ8A 5EP1A 8MHTA 4YJ3A 3OEEA 3MWLA 5BQPA 1T9CA 2V97A 1JKJB 1LTHR 4A3SA 3TTSA 1DG3A 4EB8A 5FPSA 2FUG6 1HZZC 2A5FA 2OBLA 1PR9A 3KHKA 4Q1BA 3T3HA 4EFMA 4A2PA 1KAOA 1INLA 3HP1A 1QF9A 2KB0A 4EKGA 5JJ5A 4N7JA 4ER5A 4YC7A 4WN3A 4Z7NB 3HJFA 1QOZA 2P2SA 3DDSA 5L4LA 3G6WA 3QXXA 4XR4A 2IHZA 2PUEA 4RENA 2C59A 4LEIA 3M4YA 1IPEA 2RGNC 1K7SN 3JQQA 3PPWA 1JG3A 4JVSB 4OG2A 5CGQB 3SM3A 4CETA 5JQWA 5JYDA 3F6CA 4PONA 1Y5MA 4J4BA 3ZHRA 3DTVD 4A2QA 1Y8RB 4RY2A 5AJXA 3DW3X 2HWKA 2X0DA 4J8PA 5COBA 1E9RA 1C1XB 1YRHA 2G09A 1YCDA 4UXJA 2GYYA 5SZKB 3H8VA 4M1ZA 2FFQA 1MG5A 4JUCA 3F5MA 1NHWA 2BFCA 3MJFA 5GM1A 2AEJA 3RIYA 4Z4FA 1KDZA 2C88A 2YS7A 4XUDA 3K4PA 3B1XA 3EGVA 1NY5A 5AKJA 1L4GA 2Y9MB 3NM4A 3QVLA 4QGBA 1Y1PA 3ROZA 3KKZA 1TQ4A 1ZONA 3D31A 3T4XA 1K9SA 2BT4A 4XIFA 2IYUA 1YS6A 3DHEA 4LQLA 4AWAA 4AF8A 2A30A 1OVGA 4RV9A 1DC6A 1W96A 1WKBA 2EZ4A 4G65A 1I2ZA 2IT1A 3FCXA 3GFBA 2O1XA 1RAEA 5HG0A 1MT3A 3TIGA 3U40A 1Q0UA 5C8YF 4ETIA 3V8BA 2YVLA 1LXCA 3Q4GA 4EYGA 3L1UA 1QIFA 4CKWA 1VG8A 4RJIA 3D6TB 2P9JA 4OHYA 5EKDA 1TVEA 5JASA 1K0FA 3E2MA 4FFOA 1U7ZA 2ZRMA 2CUZA 3NYIA 1HG1A 2GDJA 1JE0A 3K6JA 4GH5A 4XSGA 3CW2A 3WMEA 3AR4A 5D84A 1PHPA 1F8FA 2OP0A 1YVDA 2HIGA 4WA7A 3ZHBA 1U1CA 4RL4A 4DCJA 1Z6AA 3K20A 4EMBA 3RB8A 2I3DA 1EA7A 4H59A 3FRIA 3UH1A 2WZQA 3W3ZB 3GLHE 3T12A 4MTCA 4FSXA 5B2ZA 3PXCX 4LOKA 5B30A 2BEWA 2J3JA 2C4KA 3Q9UA 2BUBA 5I4BA 1EXWA 2ZOSA 3MQFA 4FUTA 4HOYA 4JZYA 3EIOA 4D4JA 3KZVA 1WP4A 4O2RA 2NPFA 4W8OA 1GTZA 4A5OA 5HCUA 3MWDA 4M7PA 1Y9DA 2OSVA 2H18A 2GEFA 5F64A 2C7GA 3QV2A 1Y1LA 3B9RA 1EQUA 1RIFA 3GJ5A 2GCIA 4O4HA 3CUYA 1F6WA 4KXUA 4IIJB 2YJGA 4MPTA 3L0PA 1DBQA 1FBTA 3A37A 5C8VA 5ES4B 4OLAA 4OHUA 2CVPA 2Q6LA 2ZUUA 5BXYA 4DJDC 3W8RA 1SVUA 3IMGA 1V39A 1ZN7A 4EG1A 3WLKX 3WNBA 5KC9A 5DTJA 3K0FA 5IKOA 1N2GA 4AJIA 1ZOSA 5FFMA 4M0EA 1MNAA 3Q0IA 4C78A 1IL0A 1FRZA 1MX3A 2HIMA 2ZBRA 4I8XA 3PK0A 4MS3A 3B2NA 4TMVA 3MS7A 4BO1A 1FTYA 1U2DC 4E3WA 3DFUA 1O94C 4O4IB 1DINA 5CEJA 2CYBA 1SUCA 4TT3A 3ADOA 3QPWA 2OLKA 4HWOA 1Z6XA 4JJZA 2OCYC 2B1RA 4P3OA 4NENB 5I7RA 3H5IA 3RRNA 4MKHA 2P9YA 4Z9FA 3SC3A 3OEYA 3DKPA 4FFBA 2O5RA 4FYXA 1V3UA 1ZH2A 2B83A 4TMKA 1V6CA 4RYLA 1YASA 4AY2A 1DBPA 3B13B 1TIPA 2MSKA 4L8WB 4YCNA 4KLCA 5CDFA 1FLAA 1BX3A 4LZJA 4ZC8A 1H5QA 1GZUA 1BXKA 3EIHA 4MS1B 4JK3A 4W63A 4YRCA 4AJNA 4NE2A 2GEJA 4GBGA 5IDYA 4OP2A 4DC9A 3UAVA 3D7LA 5TSDA 3DR3A 3N7TA 4RD0A 1GPYA 3R7BA 3PGA1 2YVAA 3WYNA 1APBA 1ODCA 2OOKA 4BWGA 2DT5A 2QT9A 4UFNA 2PZJA 2DQ4A 5DNYB 4GWKA 2VJMA 1YR2A 1TZCA 2WWTA 3A2NA 3MA0A 4OBWA 3RLFA 3U3KA 3ZDQA 4R69A 1CS0B 3CWQA 1UPBA 2HPAA 1ZNWA 3ESXA 1UC5B 2VZ9A 3ESRA 4OO3A 4RFSA 2O7QA 1V1RA 4RVOA 5BWCA 2ZBGA 5CYGA 1VPEA 1UT5A 3G9ZA 4Q4JB 5DBOA 3FNGA 3NTOA 3RD5A 1BS9A 1NVXQ 4F5WA 5C5CA 5K09A 3GU3A 1RJDA 2ZANA 2UUPA 1QIEA 3T15A 5F51A 2GFQA 2XIQA 4NEGA 1CUWA 2RB4A 2XE4A 3BS4A 3EA5A 1N8TA 2P2LA 3CUTA 4DRYA 1UEIA 5GONA 2DE0X 5T6MA 1I4LD 3SLRA 1MVLA 3AIOA 3E35A 1Z74A 3WYDA 3QELB 1M2EA 3HXPA 4PZZA 5IHPA 3BZBA 5I3ZA 2IOQA 3RQIA 3UICA 5T6BA 4J49A 4BDSA 1WO8A 2OBFA 4MQEB 2A9RA 2XXJA 1P4HA 1AHPA 2ATCA 3V2UA 5BVHA 3TL2A 1N9ZA 1U8YA 1VA4A 1QHYA 3GI1A 4S1PA 2XQKA 2UYQA 3AB3A 4ARVA 4JXXA 1FP1D 3ZHOA 3RC1A 3OZGA 3NYRA 3ZV3A 1BS2A 1H6CA 2X2PA 3CCBA 1J0EA 1ZPDA 1VYVA 2JGFA 1C9JA 4MWGA 3JQ6A 1UK9A 3ME5A 3RR2A 4ML3A 5GJCA 3ZWPA 3FKJA 3PD0A 1VTKA 2X5OA 3DC2A 1XCLA 2PA0A 3KEFA 3UHJA 4AZTA 2X3YA 3OZVA 2IHNA 2YZKA 5JVDF 4QPPA 2B9VA 3COPA 4KOAA 1L5HA 1QM5A 2DTXA 4DV5B 4DNOA 5TQJA 5KHOC 1XK7A 3CMCO 4L9RA 2W7TA 5GTDA 2EJWA 1E1YA 1F5NA 4DG9A 2RCNA 5DEOA 4FOLA 3JD2A 3ZY5A 1BH2A 4HAXA 4RMGA 3GGCA 3A0UA 5GONF 1I94B 3NHZA 1M67A 4JP3A 2G70A 3QE3A 2HSGA 4P0TA 2AWOA 3BE4A 3NBAA 4JU8A 3GEHA 3UW1A 4OP3A 1H85A 1R6TA 3NT5A 5AVTA 1S89A 1Z5VA 2WT8A 4YQZA 4QC2A 2FLKA 3CRMA 1O96A 5L53A 1QYCA 1WCXA 3SZOA 5JPIA 3LRPA 2C92A 2VJMB 4KNWA 1M5UA 2B4YA 1BRMA 1DRUA 4TXHA 1A77A 5C46F 5IYZB 3T5BA 4BLRA 3A1CA 4BPBA 3FVVA 3MWGA 1QB7A 4QXAA 1Z5ZA 5F52A 1DE0A 1N5LA 1W46A 2HF7A 4QXRA 2D8MA 4DNQA 2RAPA 1II0A 3KWJA 3GEIA 4LHYA 2FA9A 1EXDA 2VSFA 4D4GA 2OYSA 3IULA 5HS6A 1CPYA 3DM5A 3P9IA 4YH1A 1XVVA 3R9IA 3OJ0A 4LJSA 1GEEA 4JJIA 3VTZA 1TIBA 2WKSA 2IZ1A 3EYAA 1P5ZB 4DMLA 4PTZA 4EQZA 4M0PA 1B15A 1YONA 2XMQA 4CN9A 4TV9A 2B20A 2HU2A 3AXTA 2QI9C 3CLVA 5JAIA 4OSPA 1ECGA 3I23A 3ICCA 5KX5F 3I6QA 4AKGA 1R18A 1QIGA 3PEVA 1XZMA 3JZMA 3A4VA 5DIZA 2OZLA 2JVJA 3G5AA 1X0VA 3PXBA 4XIIA 3RFVA 1T3TA 4YAWA 1C7FA 2AA3A 2N0SA 4F5ZA 4U1RA 4YJFA 2AQ8A 1MO4A 1OBCA 2F1HA 2A84A 3L7YA 2REQA 3O95A 4P4TA 4DQVA 1BMFD 1KVUA 4QXQA 1N0VC 2XTMA 1P4SA 3LBAA 2VDUE 1EP1B 2OZPA 3TOVA 5IDVA 4I50F 5FOTA 5FR1A 1P75A 2NUPA 2IYTA 2FE4A 5DWQA 3V2GA 2DTDA 1X7ZA 2O0HA 5SYMA 1W49A 1XXHE 4HYEA 3TSZA 1XWFA 4K9OA 5ARBA 5CG1A 1SC9A 1U8FO 3ECSA 3I2KA 4R2LA 1KK2A 5EMHA 1ESNA 1KH1A 3A1NA 3TQCA 4JD5A 2CL0X 1YR9A 3LVBA 1Z3IX 2JLSA 5FP0A 3MPOA 3ZYCA 3EIUA 4BXOB 5CYOA 5FBWB 2WF8A 3ETDA 2O8EB 5CCEA 3I83A 4QOSA 4WV3A 5JR3A 2CSXA 4N41A 2D0PB 3GA5A 1JDBB 2R79A 3PPXA 2WU1A 3IP9A 4BAZA 2DEUA 3N70A 1JQLB 3EB9A 1E1LA 2CXPA 2PT7A 4HADA 4FXOA 5CFLA 2DCMA 1TJ5A 4I1VA 1GIAA 4REQA 1JR3E 3HU1A 4AMBA 4TUYF 1FUUA 2VAPA 1YZKA 3QW2A 5JCJA 1ORRA 4DSOA 3O1JC 4QELA 2D1RA 3DMPA 3H2ZA 2X14A 1C0EA 2IRWA 4IHJB 4RMJA 3SXPA 4BV2A 5BSWA 4YMWA 1J00A 3K05A 1TYZA 4RKRA 5FHRA 5JBNA 4GWGA 1UF9A 5K0CA 1YAHA 1BMTA 4OIMA 1X1CA 4BP8A 3HUTA 5DBGA 2QNBA 2Z56A 3CX6A 1KGSA 1KZ1A 1CD5A 1Q1AA 3H97A 2LP4Y 4XX0B 3NOXA 5AK0A 3EVBA 3L43A 2XITA 4RPHA 5FWNA 1CVRA 3PHHA 1XRLA 1VKOA 4AO7A 1ODJA 3AV0B 4NMXB 4W9MC 2GN9A 3X2SA 3PNKA 3VOSA 1AXGA 2BEKA 2B4QA 1GY8A 3BZUA 2W9XA 4N12A 3LPMA 1KR5A 4L0MA 4EVQA 5BUCA 4JYPA 4X1YA 3U7GA 1W25A 2JIMA 1Z7EA 1T1SA 1YGPA 1RWXA 1FTSA 2VPPA 4FLFA 4D8YA 1JHYA 1B23P 2D54A 2NYUA 1E2BA 2FWIA 1P80A 3TSYA 3G2JA 2MYNA 2IPNA 2CHQA 3ZY4A 2HGSA 2PBFA 3ZLJA 4QOFA 4URFA 2J9FB 4M0LA 5AUQA 5KHAA 1A2BA 3H9BA 1CJBA 2H57A 4Q24A 3C14C 1NR7A 3E8SA 4NEHB 4MYDA 4RC9A 4QUBA 5KTRA 4CV2A 5JYEA 2WM2A 3DZKA 3F4LA 4IJQA 5JDCC 1UXGA 2CNNA 2ZRKA 2QRLA 3NS7A 4O33A 2JAHA 4E03A 3QUQA 4TTAA 3L7LA 1DS6A 4X1KA 1GAJA 1HNWB 221PA 4IIBA 4DIFA 5GMOA 1KJYA 3PFFA 2NZ8A 3T9BA 3ZHZA 4XD2A 4DDVA 2GAOA 2H48A 1RRMA 4UHCA 1QGUB 4XKJA 2QJTA 4I14A 4Q3KA 4LDNA 1ULSA 2PD6A 4X94A 3IP3A 3ZTWA 2WW8A 2YW9A 3E27A 1JILA 4MUAA 4FOOA 4NABA 4IJVA 1GEGA 4A23A 4ZZ0A 3FWKA 1GNVA 3EZXA 1NI3A 4FGWA 7ABPA 2VUIB 1HYBA 2XDQA 3EBOA 1GTMA 1LCIA 1NXTA 1RMQA 2B1QA 1LTKA 4IMRA 4KI7A 2WHXA 4EG4A 5CDUA 5IC4A 3C98A 5KX5B 4JBWA 3AGQA 3GMSA 3MS4A 5EIWA 4LV8B 1MJ5A 4EB6A 2PWBA 5EZQA 1GGHA 1HDZA 5I5GA 3GVHA 1XF9A 1A76A 1PHRA 1R0CA 1XUOA 4GR4A 4UKDA 3QUSA 4JQZA 1W5SA 4H08A 4WRRA 4DIMA 3WL8A 2JA1A 4I99A 4Q3BA 3LUHA 3ZBTA 4E5NA 1DJMA 4K6OA 5K03A 2BP7B 1Q2XA 4PX2A 1ZM4A 2XQVA 4QKQA 4DB4A 3IYLW 4QVIA 5IT5A 1YZ3A 2V7QD 4J1NA 4LWZA 1N2SA 1GFWA 5GIOE 2A0UA 4ENQA 5FYDA 1OWOA 2PS9A 4Y6RA 3URKA 3K0EA 2GZRA 4KQ6A 1XRJA 3WYBA 1GQRA 1D9ZA 1V26A 1W4AA 3IQIX 3SBXA 4C7KA 2VDNB 2ODTX 4V2UA 2QZ4A 2ZE6A 3TM4A 3UM9A 1QX3A 5B3JA 5CT9A 1F6BA 1QH8A 1TCVA 1VBMA 1RXWA 1AKNA 2Y6VA 5ALGA 5LYJA 2CLSA 2Q3FA 3R76A 1LLDA 1A9ZA 1RMYA 4XM0A 3PRHA 1Y9AA 2G1KA 2RGAA 3D1JA 3H17A 3RS9A 4DDHA 5IBRA 3S1AB 1XA4A 2V59A 2QDXA 4D8TA 2AK3A 1HR0B 1V1RB 4J16C 3GP5A 2DPXA 3EODA 4L8FA 1AMNA 2PZGA 1J0XO 3NANA 3R5FA 4QU0A 5D87A 4CLXA 3KXLA 4I0WB 4FDAA 3PDIB 4A8HA 2XBUA 1QBGA 3GY0A 4WBSA 5KYVA 2Z8YM 1HE4A 2IEYA 1QVZA 2HF2A 1PUJA 2ZYIA 5KI6A 4NBKA 4BVLA 1SXJE 1NLFA 1J8VA 2GVNA 1WXDA 3FR7A 4KJZA 4Q4AA 4C03A 4DC1A 4EI8A 4EZIA 4XGNA 1A2OA 4S1WA 4Y2PA 2Y4NA 2R8PA 1AK9A 2NOAA 1DXOA 1ULHA 3GLGE 3AY7A 5A0VA 1NPDA 1O58A 1U4OA 1IOLA 3E5HA 3I1YA 4XFKA 2PGDA 4UUQA 2YKGA 3BFVA 3OJLA 3PQ6A 1CUAA 1GR1A 1DRWA 3TO5A 4I6GA 2EGHA 3MJCA 1Y3HA 2ATVA 1MN6A 3OEWA 3SNHA 1E1KA 1J99A 3GD7A 4JY7A 5IC6A 4RKQA 1I5OA 1GQOA 4QFMA 3S2GA 3W4KA 5AW6A 3LT2A 4LDQA 4IIJF 1LF0A 2P2DA 2DAPA 2JKYA 3JARB 3BSWA 4NC9A 3IJ5A 3HKBB 2AS0A 3WDLA 5LZ7A 4BC0A 5B6IA 4P6VF 1OTYA 4GMKA 1N6HA 1EWYA 1H2FA 4RPLA 2FUG1 5C1BA 3JR7A 1E0DA 3NHJA 4GBED 1CUGA 1PQWA 3JAKB 3ZY6A 4A10A 1ZGHA 4N7RA 4RY0A 3OPYI 2QYTA 4BPRA 1UFKA 2LW7A 2B1IA 1PK9A 2L82A 2IHYA 3E0XA 1NVAA 3RASA 1EX9A 2WABA 4HL6A 2DH5A 1TYBE 1HTTA 1W1WA 2O1SA 2RHRA 2ZJ4A 1UXJA 3AJRA 4B87A 2Z57A 3OE4A 2ZBFA 4R54A 5HIMA 1ESCA 2HQ1A 4DJTA 1K7YA 4DLTA 1JXAA 2P6MA 1O9BA 3GP3A 1T4BA 5NLLA 3FTNA 5A62A 3MUEA 3A1VA 4ENWA 3COSA 1YACA 5ALKA 4CKEB 1RXYA 2W71A 4NZ9A 3C6BA 4V0MA 3UXEA 3UYKA 4F3KA 3GLFE 5EQJB 1G63A 2BCGY 1IBCA 3EA0A 3PC8C 5TMBA 1Y1TA 2X0NA 3AFIA 3S27A 3DO5A 3AY0A 4YQEA 1L5HB 2A86A 3BTSA 2D3WA 1B7GO 2D00A 5BYJA 5JUWA 2O2ZA 3KL2A 3PXAA 4I5EA 5EZYA 2WI8A 3MT7A 5G4LA 1E7SA 2CE7A 6GPBA 1KORA 2JFVA 3F7MA 1T6XA 1NLUA 4IQ0A 4KACA 4G9EA 1ECPA 4CMEC 1DQNA 4ZGGA 1KZ6A 3T8YA 1VMDA 5EHNA 4BNVA 3FFBA 3WLHA 4UOEA 5A3QA 1XD2B 3Q2OA 3EZYA 1VHLA 1N1MA 2AOUA 1UJCA 4D56A 1CWUA 2JFHA 5IVIA 1L5ZA 2FQYA 1XRSB 2FP4B 3JQAA 5THQA 2KX7A 3W5VA 5AUPB 5KO2A 1T8PA 4CR7A 2A9QA 3T7AA 4YRLA 1FFBA 3UOGA 3ZJ5A 2XZLA 4NCJA 1UBHS 2E6KA 5AJWA 2NU6A 1Q1GA 1QYIA 4R9SA 1DOAA 5J5VA 1C1HA 1R3UA 2QRMA 2H2DA 4JVMA 2DXIA 3DQPA 2OHGA 5FA8A 1IZYA 4L4UA 5BN4A 1XAGA 3KZ1E 2XE6A 1HETA 2CHVA 3HP4A 1DFGA 4HGPA 3QBTA 1CE8B 2ZUDA 3EVDA 3JQBC 4F84A 1C3JA 2CE2X 1FDUA 3ORQA 1BCSB 3VKGA 3TD2A 2A5GA 3KV3O 4IFBA 3CJQA 4Z6KA 3ZWMA 1UWVA 2OBYA 3ETJA 2I7TA 4FPXA 4D9EA 3ULKA 2PLNA 1NC1A 2X7XA 2DFKB 1OFVA 4QASA 1T9GS 4KSCA 4PHTA 3UT0A 2PKYX 4JB2A 4RK7A 4K6HA 1K5PA 5TDHA 3LSTA 1CUJA 1BDMA 3PC4A 4FEGA 3WLFA 2F7SA 2RBKA 1JWAB 3I32A 1N9GB 4U7WA 1NUQA 3QBDA 4TRJA 3RVLA 4U7TB 3TE6A 2HRZA 2ZR8A 4A16A 3BB1A 3BE6A 3UMCA 1FDOA 1KO8A 5K2OA 4CM8B 5JAPA 1E2LA 2YWBA 1UZLA 4RGBA 3TSOA 3OFSA 3CS3A 2AVNA 1M1YE 3CISA 2BMVA 3PE3A 2G72A 3VPAA 1J1ZA 2GEDA 3FBTA 5AMXA 1DAHA 1TADA 3R23A 2HMYB 1M9NA 4OQMA 4MA5A 4BP1A 4EELA 1NDHA 2VUSA 2DPLA 1JUDA 1ZD1A 4GLLA 4U7FA 4LWOA 4BQPA 2I87A 4UOQA 1N7IA 2G71A 1O97D 2WSSA 1UBNA 4KZPA 3QVOA 3VQTA 1RXUA 1SQFA 1LSSA 3FUVA 4G2NA 3AVOA 1FTQA 3MLAA 3GFFA 4B2YA 2NZYA 4UU7A 2VHQA 3IQGX 5DNVA 3RO7A 5EZYB 4PU0A 5CA0A 2H1RA 3L6DA 3TX2A 4NMMA 4B3DA 1E9EA 5AVZA 2J0VA 5FWXB 3QJGA 3AEQA 4R31A 3EWIA 3KR9A 3L7MA 4D26A 1G21B 3BFXA 1UMKA 3OAAA 2H2WA 4NZPA 4Z0TA 5GY7A 4BLSA 2XECA 3A9VA 2BBOA 3BWDD 3KHTA 1DKMA 4I4NA 2VHZA 4GMXA 3P9PA 1N7GA 3V7NA 5CDSA 1YA8A 1QGZA 1V8BA 4CODB 4E13A 1NWHA 3T1OA 2I0FA 4NCHA 1YZHA 2ZBQA 3STWA 4M9SA 1GAWA 1UBSB 1WZNA 3I4CA 3LPNA 3VJMA 3PPYA 1NRJB 2FRDC 3P9SA 4KQWA 1NPTO 1Y82A 3KVNA 3SU8A 3W8EA 3I6IA 1DX9A 3R44A 3F3YA 4F6RA 1B6TA 3VPGA 1T1IA 2C9MA 5FTNA 5ADVA 5BQXA 1UKBA 1QZZA 2IZ6A 4LWQA 4NCKA 1A95A 1A88A 3JTEA 4JITA 4JLAA 3OQIA 2FQQA 3VZDA 4CL2A 2CJWA 5AVXA 3AILA 1Z63A 4HN2A 1WX1A 3THXA 4YJ2F 1SR8A 4F9EA 3D2BA 1YZFA 2G06A 5A9RA 5GIPE 1V9LA 2QN3A 4UNNA 4BCCA 1O9HA 2D7DA 1OU4A 1SULA 1VLLA 1LFDB 3G2OA 1GCIA 1N1DA 1X2EA 3EUEA 1JF8A 4FJ1A 1S8FA 4O4HF 4ZOQI 3TR0A 3PBKA 3R1IA 3TXAA 1GZ5A 1WM1A 5K9ZA 4QDZA 3QFCA 4IJUA 3R7SA 3W78A 1D07A 4Y6LA 4H77A 3IH5A 2BKLA 5EHGA 5P8WA 3LWZA 1NQXA 5HX7A 1RJ9B 4AYTA 2A9FA 4O3FA 1XN4A 4G4GA 4CKYA 3HNOA 5EYPB 3L92A 4P7KA 3HBMA 4XARA 3DNFA 3E22A 1NMEA 1K9VF 4CF6A 1BA3A 1GKUB 3ED1A 4RCZA 2WUGA 3KQOA 3C97A 4HQ0A 2J4DA 4ZI5A 3RBZA 3NHBA 4DIBA 4K9KA 1K1EA 3L8HA 5I9TA 3H86A 2C7VA 1HEUA 3ZVKA 4F9FA 2Q46A 1LI7A 3V8VA 1DADA 2E4XA 3DMGA 1PJQA 1QJCA 5KNDH 2OM2A 4KWTA 3C3KA 1JDPA 3BHIA 3KOZA 3M6VA 5DV9A 1DCKA 4IHQA 4KKVA 2R68A 1RAFA 4AROA 4X8OA 2WSMA 4NRDA 3EVNA 4CM9D 3I5YA 4CEJA 1VHTA 2HU5A 3K8YA 3PUWA 5G02A 4BCBA 1DO0A 3UWSA 1V35A 5LYJB 4BO4A 3AKEA 3EWSA 1T0IA 1RLIA 1KE2A 1HSOA 1AS2A 3UPUA 5KMGA 5F2NA 4L5YA 4TTIA 2FWBA 1A5TA 1M76A 2FN9A 3N2KA 3EXAA 1SC4A 4ILKA 3OA0A 4R7GA 3S5UA 1WXHA 3CO0S 1NSTA 2XY4A 1ORIA 1Y9ZA 3WKCA 1FPMA 2WQZA 2V9ZA 2QVLA 3OZWA 1W87A 4NV0A 1SIWA 2O50A 4II3A 2J9ZB 3CRVA 1K6JA 3X43A 1EFHA 4OXXA 5J2UB 4PNZA 3HABA 3FLEA 1HKUA 5J2TA 3G8DA 2ACEA 1G20E 7GPBA 5ALJA 3DO8A 3AVPA 2WHPB 3Q8MA 2YW2A 2MU1A 4V0QA 2I4MA 2OQIA 2PFGA 2OTCA 4WKNA 1KP2A 1QE5A 4LTDA 5I7EA 2GCOB 1WW3A 2P4SA 4JOQA 5HE9A 4XEHA 2VJYA 1NFQA 1YV9A 1UZUA 4DUPA 3K4QA 2H08A 2V6BA 4QO8A 3PTZA 4Q19A 1L7DA 3S28A 4E5SA 3Q8LA 1GCAA 1ZISA 4WNIA 1UFQA 2CL6X 4J7XA 1Y7LA 2QV0A 4M1SA 5ALIA 1J1UA 2OBXA 2R6AA 5JZVA 4GZLA 4R7ZA 2AMLA 2NUTB 3WGOA 2ID9A 3OUZA 3OI7A 2A88A 2XGOA 4ISCA 3GPLA 5FX2A 1E3LA 2AI1A 2R9VA 1N6OA 3QHPA 1ZU4A 1YZUA 2O07A 2WB2A 3ZJUA 2GZMA 1ORTA 2E9SA 4AMYA 3LO8A 3RW9A 5IM4A 4GKAA 3IELA 4EAAA 1C3LA 4BFUA 2I1LA 2LVBA 4HLUA 3QP9A 4PRKA 4B76A 3ND6A 4PVDA 1ZN2A 3DBLA 1HDYA 1EVKA 3FSGA 5JSFA 1NI4A 3R40A 4K6CA 4CFSA 1SKYB 3ANSA 1I51A 4DJEC 5AW9A 3B48A 1KJ9A 1MB4A 1Z0UA 3P9RA 3HDHA 5DLYA 4D9FA 4E33A 3J7TA 4ZJYA 3Q8XB 1EFVA 1S0UA 3A6KA 2Q5LA 1N7JA 1ISFA 4ZT2A 1OREA 1KQPA 3SS9X 1ID1A 1IY1A 1PLKA 2QSYA 3KZOA 4JI8B 1SM4A 4B7ZA 1U4SA 4JNCA 2DFNA 4GOKA 4RORA 4CG1A 4DEYA 1W36B 4G97A 4YCJA 4EEKA 3ZH2A 4ALJA 1YWGO 3JAWA 5T3UA 3RU3A 4DWVA 2OVBA 3F6YA 2RK3A 2QLNA 4L7QA 3U56A 4CDMA 1K8ZB 1CU1A 2ZAGA 2OP1A 4R8KA 1H2BA 3K8QA 2Z1MA 3SC6A 4GOOD 1X9IA 1HYQA 4HR7A 1EUDB 4QU5A 3T5GA 3AB8A 3DNMA 4X8HA 1RQRA 3LOPA 5M2QA 4RULA 1YKSA 2I4OA 4P93A 4Q5IA 5T4EA 5FFNA 3DB1A 1P72A 3H05A 4EGSA 3F49S 3P2YA 2BISA 3G9XA 1NVGA 2IDMA 4K3VA 2X4LA 4OUDA 1WBDA 4YJGA 4PSUA 5F9HA 2IP2A 4LSZA 2F59A 2DWPA 5FWYB 2QVZX 3AI7A 3TQOA 1HDCA 3HUDA 4IJ6A 2ZWMA 4XYGA 8AT1A 4EVIA 5C32A 1RE0A 1ENOA 2PSDA 2WF9A 1WABA 3GRAA 4WK0B 4AY5A 5A05A 2A1TS 3WLLA 1IHPA 1ZN9A 1FDWA 2PS3A 4FKZA 1QTNA 1D5WA 3IT2A 3Q15C 3U4QA 4CT4B 2BY4A 3ABZA 3GRYA 3ZE0B 3C7KA 4BJ6A 1HQCA 3FLMA 5BR7A 1XTQA 3DHYA 3BD6A 1QKIA 4H7PA 1Y6RA 3VR6H 2K7FA 4OAOA 3ELYA 5HF9A 1E2NA 1RBYA 3LQYA 3G2LA 3TK1A 5H02A 4W7IA 5IC5A 1DTEA 1JHPA 4JX8A 1V6AA 3K6RA 1PSZA 4TVKA 4CMGA 4Y7DA 1CQIA 3S5JA 3IIEA 4D0SA 2H1LA 3SVLA 3EXIB 5EUBA 1SU7A 5D5HA 1JHAA 4NYJR 1FMLA 2Z04A 4QECA 4EKIA 2QQEA 2WD8A 3CR3C 4U6QA 2XDAA 1WPGA 4NFHA 4UDOA 3MINB 3O0DA 3GFTA 1SK9A 5CH3A 5FI3A 4URWR 3U80A 4XTCS 4MVXA 5HUJA 3QE9Y 4JBLA 3EMBA 2ZCJA 3O8RA 3ZKAA 7REQA 1I3KA 3KOWA 1TT5B 3AB7A 4WCFC 3UY4A 4DSUA 2MSLA 4OX9Y 2KBEA 4X64B 4GICA 4CRWB 2A7QA 1DJPA 4BLOA 3BZWA 4DCOA 1YCGA 3AJEA 2G17A 2ZRPA 1J5XA 1SUAA 2EL9A 4M9CA 5B2FA 2DX7A 1CFZA 1G8AA 2X23A 4F2HA 2QL5A 3PYLA 4NATA 2WMNB 1G8MA 2C5GA 2Z0MA 3TIXB 3SQMA 4ARAA 2X6TA 4IVQA 3BXEA 5E9AA 2K4MA 1Y33E 1PWXA 4KHZA 1DQZA 5F12A 1G5QA 2O3UA 2DFTA 2Z30A 5BRJA 1EUCA 3BWBA 3KSRA 4DNFA 1B0ZA 3CTMA 1NBMA 4KSBA 5EIHA 1U6IA 1PD1A 1U8XX 3W1VA 3FOZA 3GZNB 2D5BA 1D5CA 1DIHA 2WFLB 4JJ7A 1J2JA 2HCBA 3BHMA 1U0LA 4OXQA 5AJHA 1OLSA 2ECKA 1C30A 3MTGA 3L6UA 1Q16A 1OWLA 1SHKA 4B74A 5LB4A 4WUVA 1NG9A 2P2GA 4FDMA 5DYNA 4OL0A 1KEPA 2Q6TA 1JV2B 1AA6A 1Z33A 2HCTA 2P2YA 5CA0B 3H8SA 2O8VA 4UEOA 3HLKA 5D51S 4C29A 2W6NA 4EW1A 1QIIA 1F60A 4HB3A 1M2OA 4XX1A 4GGMX 4KUEA 4U9HS 4WBNB 4PC6A 4DSNA 4ED9A 1NVBA 1EJ2A 1PBTA 3U26A 2JFPA 4HYQA 2PPLA 1NUPA 3RTCA 1AS0A 3OVMA 3TOCA 2C7RA 1UBGA 1R4MA 3E3NA 3V2HA 2ZT5A 3THXB 4LXXA 5EFOA 2ZVPX 2BSQA 1SCAA 1P7ZA 1C8BA 3E7WA 1H6AA 4PIMA 5FUQA 3E7DA 1F2UB 2GF9A 3IB6A 1GRQA 3IUSA 1HDIA 2HTFA 2TRSB 1DDIA 1U65A 4LISA 5LUBA 2HOQA 2CNWD 2E37A 1C1YA 1F2DA 1HL3A 1T0BA 4KIFA 1XJ0A 3CRNA 3B20A 1AS3A 4NTZA 1S2NA 4D4HA 3HDTA 2RHOA 4Q4JA 1P3JA 3A1EA 4YO8A 2PANA 4IMJB 4LGCA 1JW9B 2BDTA 5GGYA 4BGVA 5IF3A 2SHKA 1PZNA 1ECLA 1H4SA 1FMFA 4OBEA 2R6GA 3FUWA 3K1TA 4WBNA 1Y4UA 4MUKA 4AZ3A 1CDZA 4ZQHA 3NIFB 1NN5A 4QTYA 2IITA 1TK9A 2BELA 1JIUA 1XZ8A 2WV7A 4INPA 4BMOB 4CM4B 4BUZA 3PICA 3UOWA 3ICQB 3NBXX 5JEEA 1RHKA 3IERA 2AMFA 2YS6A 1HY3A 2PQMA 3ACDA 2IA5A 3K73O 3O26A 5EZYF 3TOXA 1VHJA 4BX3A 4LFAB 3AUJB 1Z5OA 1QQ6A 4ZT5A 1YB4A 3L8DA 1RRVA 4C7BA 4JBNA 4RPGA 1YI1A 2ZI6A 4LHZA 1N3BA 1EXNA 3LUFA 1SZPA 1YOVB 1EFUA 2FQWA 3F5FA 5A3RA 2LKDA 3OLVA 4JC0A 5IU6A 5AXCA 1Z6GA 4ZO9A 4IJMA 2WRZA 1UXOA 2UYYA 2PVSA 3DL2A 3M81A 3LL7A 3P0HA 2PWPA 1OY1A 4OHFA 5E3HA 3R3YA 1KJNA 5CA1A 4B45A 1M1NA 2VHXA 4S1NA 1K7XB 5TEVA 3PJGA 3LFUA 4N3NA 1EVYA 2C2MA 2OWDA 2I6FA 1EWTA 2QRVA 3DLPX 3KYDB 3P8ZA 3H84A 4ZO6A 3E03A 4MCHA 1XMXA 1QIMA 1ZI8A 1JLHA 2H92A 4BKQA 4DR4B 2BH2A 2P0YA 3IMFA 5I6DA 3F74A 3E7PA 3EVZA 5K99A 1XXLA 4ZOBA 3KLOA 5EMMA 2J6IA 1Y89A 2BKXA 3QJYA 1B73A 1WDWB 5KNCH 4E1BA 1PGJA 3KT0A 3M5PA 4KC0A 2BMWA 4X7RA 1KY4A 4YLEA 3GLQA 3WGVA 2VSNA 3DM9B 4KXWA 2BGIA 5IAKA 5IT9A 3NTXA 5I7VA 4YAJA 1H4VB 1O96B 1OW3B 2QTRA 5DK4A 4ZC1A 2GTPA 1KQGA 3U7FB 2ECPA 4YO7A 3UFXB 2D3TA 3LSYA 3GPBA 1QTQA 1CYEA 1DQSA 2RKOA 1G20A 3RREA 3VPDA 4Z4IA 3D0KA 4RA6B 4NJEA 4OHOA 1IRIA 4EYSA 3EF3A 4IXNA 3INRA 4ZI7B 3AQIA 3WAGA 2W83A 4S35A 2HDOA 4HZUB 1G7SA 4MCIA 2AFHB 2BGKA 2XTZA 3ADPA 3FDFA 1Q44A 3MMNA 4MZXA 2GPYA 2VBCA 2DR2A 4INAA 5F98A 3OZCA 3WQSB 3B9PA 4V0OA 1FTWA 4V0KA 4ZQGA 1GXSB 3BKXA 1QIHA 6NULA 5KKNB 3ZJVA 2Y1OA 3A14A 4NU8X 4AJOA 4DR2B 3SKVA 4KR3A 5F21A 3VO2A 2RFLA 1ZESA 4ZHQB 5I3CA 1KK3A 1GVHA 4IS3A 3MD0A 5EZ6B 2FPOA 1G2PA 3L6RA 4JB8A 1G98A 2H0RA 2PLRA 1G0NA 2IY7A 3OD5A 3KYCB 2VP6A 4GDMA 4R2MA 1L4YA 1EE1A 1LW6E 2AXEA 2HPVA 1D1TA 2QQ0A 5FFFA 3FX2A 4CTOA 3N8GA 1O9GA 4N39A 4BO9A 1N2EA 3QX3A 3QEMA 4ERNA 3PUKA 5BVGB 3OBIA 3MILA 1PLLA 2AEEA 3MXTA 1H9AA 3HM2A 5KTNA 5JXHA 3KXDA 3F47A 1JDVA 1GPUA 1N3IA 1QFYA 3T35A 4JLWA 4CWAA 3QUAA 4YR7A 4FCWA 2ZJ1A 4FYKA 4D80A 5BOSA 1CEQA 4BWFB 1TPYA 3BL5A 1SBCA 3G0BA 3ND7A 5JWOA 4TVBA 3A6PC 1C41A 3AWDA 3H4MA 3MCUA 4Q4HB 4QYWA 4RCYA 5TMPA 5REQA 3ZI7A 2R96A 3J80A 2CNKA 5CB8A 1GYRA 3JD0A 5B58T 3FF1A 5H9WA 4YT5A 3IESA 1FNCA 3REQB 1HA3A 3WGQA 2PH7A 3CXUA 3O9VA 4W5HA 4JC4A 5D8DA 4RDHA 2V6MA 5IXJA 2HJHA 2YV3A 1UXKA 1XPOA 1PL7A 3PLRA 4BWVA 1OYVA 2HU8A 5DCLA 3RK4A 4ZAFA 3NDBB 3RBVA 3QLEA 2X0KA 2XNSA 3DBRB 4XDGA 1ORHA 3A6JA 4WK6A 2EZUA 3CB4A 2O5VA 2P11A 1DAKA 4LHXA 1KBOA 4MW1A 3DB2A 3LGAA 2O2HA 3DCYA 1G20B 3QV1A 4GC9A 3WK6A 4UTNA 1ZJWA 1K4YA 1NJSA 4A7PA 3ZWKA 2YYSA 2VCHA 1CR0A 4PGMA 1M72A 4Z8XA 5HZKA 5B55A 2C84A 2XBLA 1IFXA 4QU9A 5J4KA 3B1JA 2VJKA 1XMQB 5AM4A 4G6ZA 2CZQA 3W4JA 1IE3A 4AG6A 5AVVA 1ADBA 5CVEA 1FQKA 2C0CA 3U0BA 2QXUA 3INNA 4BO7A 4O2AA 3KU4A 3KKNA 3T9EA 5LFAA 2C20A 3EVEA 3K32A 1HFWA 2Q29A 1MO6A 4DM3A 2Q8PA 3BD8A 2FZWA 1EMDA 4F2GA 1RCTE 5DGXA 4TRNA 4DNXA 4EUHA 2VQFB 3VJKA 4YK7A 1H2HA 4IXTA 5CLGA 3L4JA 1WXGA 4E3ZA 4H2DA 4HDKB 1TCCA 4GIBA 2IH2A 5DYYA 1KKUA 5HKAA 1J4AA 1ZGGA 4HK4A 5K4AA 1SQ0A 3MBIA 3ER6A 2XUZA 3VR6D 5IMBA 1XZGA 2P8JA 3RS4A 4C88A 3SQWA 4MEBA 2XVXA 2VDKB 1EWQA 1B0UA 1E98A 1I5RA 1OKKA 2LIVA 3G0OA 1NBEA 3MWEB 1A2QA 5HILA 1IM8A 1P7YA 2WWXA 3HACA 4QOGA 3WZMA 1CNFA 1A2KC 1O8BA 5DW3A 4JBXA 2ZAMA 3EGOA 3KTFA 3MJEA 4PZLA 2FTKE 4IWNA 3ZCRA 4B85A 1UP7A 1J6UA 2COKA 1M2GA 4COKA 3AKCA 4YMUA 4HC4A 8ABPA 3OC0A 2V0NA 4J2HA 4J6EA 2V96A 5DO9A 3UA4A 5JAUA 2QYOA 4YAEA 1KETA 1Q0HA 4NS1A 2UYCA 3RG8A 4RZUA 1MVNA 4Q7EA 4HAWA 4KAXA 4L3OA 4UREA 4XVQA 4OXIA 2RGGA 3PSHA 4KQHA 1IHDA 3KKOA 4TPKA 4D98A 4E5PA 3W8NA 2HQOA 4MI9A 4MW7A 2QX4A 4OGLA 5ED0A 1NBHA 5DYIA 2J3HA 4DBLE 2VCYA 1L1FA 1JYFA 2OV2A 1A8QA 2IYRA 4L78A 1Z8HA 3VPXA 1UBEA 4QDTA 3QEKA 5FTMA 1I1OA 3DZBA 3L06A 1JIIA 5FPTA 3FCEA 2DJIA 1VJGA 3ZWWA 2PUJA 5EE3A 2ST1A 4NARA 3C3PA 4G25A 1XO1A 4ZANA 1FJ2A 4GD3Q 4V0SA 4HTFA 4Q7JB 1E3WA 5K20A 1AE1A 4P80A 4HH0A 3SEZA 3MG9A 2R8XA 1MAWA 2DBQA 3OSZA 3EMVA 5EE0A 4IRMA 3TG8A 2GZAA 3LL4A 3A4NA 5T8KC 2FEAA 1LDYA 1JU4A 2DM6A 4PV7A 3WMGA 3LP6A 4P0QB 5CNKA 2QN9A 4Y98A 4J7AA 1WXWA 4JZKA 2XADA 2BZ1A 3ZEAA 4ZK6A 1XTUA 1GNRA 3AF1A 5E6RA 3WP1B 5A6VA 5AW2A 2JHCA 2ZI4A 5IXSA 1UJMA 2OFFA 4OXYA 1UJ4A 1LRJA 2VUHB 3E70C 2I03A 1L8OA 3C7TA 4HMPA 1A9YA 4AZ3B 4OAPA 4UM9B 5KOJB 2ZM5A 1F0NA 2BEVB 2IZ7A 5D86A 2ZRGA 2GRUA 4WESB 1C7QA 2VYCA 3AOEC 4TT3D 1NXSA 1NXOA 2W48A 1OAKA 4C6TB 3TOZA 2VYVA 4N6OA 4GT1A 2TYSB 2H63A 2OD7A 1Y1KE 4BX9A 5D5PA 2GETA 2E5FA 3O83A 4GR5A 2WMDA 1H2ZA 4H1VA 1SKUA 1QG2A 1DKLA 1I2AA 3ZD9A 3OCCA 4OLBA 1U7PA 1QF7A 2Q1UA 4KH1A 2PKQO 2GQ0A 3CU5A 4II7A 3ZWOA 3UV7A 3KD2A 5ALQA 3LECA 1QHIA 3PFCA 1I6LA 2G4LA 2HY7A 3LVQE 4YJ2B 1M34A 5HEKA 1AGRA 4WEOA 1IOVA 1XVIA 2PJUA 4PGAA 2QLBA 2X0JA 4J76A 4XDZA 5KQLA 3NRCA 3D5TA 4MX8A 5CK4A 1QRDA 1YUMA 4OK5A 1UBRS 2HDHA 1JVBA 4IDHA 5JJIA 4E94A 4ENTA 4KSYA 1I4EB 3AKDA 3VU3A 3HKBA 4D25A 1JRLA 2Y1WA 5IBCA 3AESA 1XVLA 4KMMA 3JAKA 1DSSG 4LGVA 4BGUA 2LR0A 2WKWA 4GMHA 4IXMA 3TAXA 4CBVA 1NUSA 2AD5A 2Z3WA 3AKYA 4GX1A 2C54A 4L9SA 2W6IA 4XJSA 1WHTB 2LRHA 3HFSA 3SZGA 4N0QA 5JZBA 2FN8A 2JCSA 3GUZA 4J0FA 3T1QA 4NV1A 2EAUA 1E1CB 3DV2A 2GM5A 3OECA 3QYFA 1NMZA 5JSZA 2XGGA 4RX1A 2WYHA 5DM60 2C7QA 5IVKA 3K0SA 3ZCVA 2X19A 4OQZA 3HWX1 3O31A 3EGWA 3SDSA 1D2EA 1KNQA 3OEHD 2J3EA 4ZXPA 5A9TA 1IVNA 4LHEA 1MRZA 1NRWA 1JNXX 4YJDA 2JAPA 4IIYA 3VPSA 4BHTA 1U28C 3C3AA 1P4RA 4Q1FA 1NONA 2HHJA 3H2HA 3V5NA 4EWLA 1ZHHA 3AH8A 2W6PA 3I34X 3PX3A 2L18A 4MKRA 2IZ5A 2W00A 3CF4A 4FMCF 1XZBA 2I22A 5MFPA 4ESEA 2YV2A 2ZPUA 4M6WB 4MIEA 2E87A 4BBPA 1TQHA 5BN3A 4RESA 1XMJA 1SVMA 2VSXA 4URVR 1K75A 4U2CA 3U3OA 3KFXA 1JG2A 4GMGA 1T3ZA 4EJMA 4KB5A 1BMQA 1SG6A 4CT0A 1IZ7A 2CMFA 3PUJA 5LD2B 2VPXA 5JJLA 1T5SA 2H1HA 2GBLA 1SBHA 4HP8A 3DBIA 2IE0A 3BD9A 3V97A 1DELA 3UHPA 2J0QA 5D7BA 5KREA 2G9ZA 3LP5A 4MI6A 3DTYA 4RJ2A 5A6SB 1GD1O 3KPYA 3H3FA 2P1DA 2YBDA 4LK3A 3T9AA 1L5FA 2VDOB 1N6RA 2Q6OA 3C1AA 1KDOA 1NDUA 3LCVB 3BFKA 3SFZA 1OGJA 3BF7A 3GK3A 3B5IA 3K0CC 3MIIA 4KQ2A 3H1GA 4LQ4A 4AJ4A 2FPUA 2JGDA 1EJ6A 2JGEA 5JATA 3K5IA 4Q7KA 2PWAA 4YQYA 3RFTA 1VSVA 3Q3JB 2I9KA 5G0VA 5E3IA 4YT2A 4BQSA 4IDGA 3ENWA 4DCTA 2NZUG 5FV4A 6AT1A 2CCKA 3GBSA 3A4IA 1UBJS 3W3AH 3WRVA 1J9ZA 1OAAA 1OXVA 3R5HA 2XKAA 4GZ3A 3HUEA 2FDXA 1ZK0A 2X77A 1NMSA 1KKLA 4X9XA 3E3LA 5AHWA 4AJPA 1EDOA 3TYXA 2V0CA 4M4SA 3LDFA 1CUYA 3ABIA 3MWJA 1GKIA 3F6PA 4DUGD 4DUYB 1Z0KA 3D5EA 3QHAA 3M6IA 1USWA 1XA0A 3QVSA 4YRIA 5AH0A 1IXSB 1VLZA 4PIPA 1U7HA 5TGDA 1KMQA 1U8UA 1TMOA 3GRCA 4IKPA 1U5BB 2XUHA 2X76A 3OZDA 4TMZA 3KK0A 3P2JA 4LZNA 3GDHA 5EJ9A 3V33A 1RKBA 3D9QX 4M8IA 2FU5C 3VSDA 4J1TA 5I8WA 1NW8A 4AJHA 3WB0A 5J2TB 1S8OA 1X6VA 5JBQA 2ZTVA 1ELOA 3RAGA 1M1UA 1F6DA 2F48A 3E81A 3I8OA 4L8YA 5C31A 4Z7JA 2FUKA 3MJ4A 1IXYA 4OH7A 3TH5A 5B4VA 3VNSA 3SBOA 2CKMA 2BN4A 4IAOA 2UZ3A 4MV8A 5G3YA 2N1MA 1C4KA 1IUPA 1LLQA 1QV9A 4MS4B 3EX7C 2BKVA 5JQGA 1SXJC 4A92A 1E4VA 2WNHA 2DTEA 4OJMX 3BOSA 1NUTA 4EZEA 5CVJA 4KMOA 1EHCA 1CDOA 1A4RA 4RLQA 3IEVA 4Z9BA 1ECJA 1TKCA 4M53A 2FW9A 2YWRA 4FBLA 4ZARA 1RYDA 4ZT4A 2Q8QA 3TF5A 4HMQA 5JECA 1SXJB 1ZUIA 2X0RA 2CV0A 2HB6A 3JWPA 2X42A 2OBMA 1ADGA 1QWSA 2YWCA 3KQPA 3ZE1B 3PT5A 2I78A 4G36A 3PA8A 5FR2A 3AFGA 4KRGA 1A8HA 3TFQA 3V1NA 5CPFA 2MOKA 4BAGA 3IAS6 1LA2A 3QQ5A 3QJ5A 4TV8B 3RYIB 3GJSA 3RKUA 2ZRBA 2VNIA 3SS8A 1HKHA 1P0PA 1XDSA 1KPGA 4YACA 4YRPA 1Q1BA 4NMWA 4AZWA 3D0QA 3WQRA 1TTHA 2E4AA 1EP2B 4N7BA 3IX7A 1YFJA 2P40A 1NRIA 2I1WA 4GOLD 3GN1A 5LZ5A 4HUQA 1I24A 4TV9B 4WHMA 1EPUA 1P2UA 4OLHA 2BGRA 2ZJFA 5A7HA 3RYFA 4B2IA 4DG5A 4BQNA 3WMWA 3N0TA 4LYAA 4Z9YA 2W70A 5BV8A 2PE5A 1PFKA 1AT1A 3EA4A 4JEIA 3BXGA 1G42A 3KJFA 4I66A 4URYR 621PA 3DVQX 1HE3A 3F8WA 4O4IF 1T2AA 2BTOA 4F72A 3VYWA 4RS4A 3N2YA 4F11A 1XKXA 1K27A 1B2LA 3IOBA 3OLZA 1D4OA 2VA9A 2WJIA 2VSQA 4O25A 5KPJA 4CEHA 4UJ5A 3VAYA 1G7RA 4JELA 2FMUA 3L8YA 4TKMA 2XR1A 2ZB4A 4REQB 2Y6UA 1S1CA 2WM8A 5JXJA 3IMKA 1EFRA 1S3IA 2C96A 4YMHA 2XYHA 2F64A 3L49A 4MDHA 3ZNPA 5I7WA 4RD6A 5H81A 3H1PA 4I1OA 4WCFA 4B43A 3K1YA 4JBHA 5KSWB 1C9EA 5NULA 3WWOA 3WGTA 1KI2A 4CLHA 2NPOA 1FNDA 3A3KA 1GZHB 2GESA 3NG1A 1KS2A 3OTWA 4KNVA 1XP5A 1E2IA 5C51B 1Q15A 3NM6B 4JR1A 1NXPA 2ZP1A 4P58A 4TV8F 4ADSG 1QFXA 4WZBB 4XIGS 4YP6A 2WWFA 5MDHA 1YR1A 2H4XA 1Z26A 4FFRA 4LNUA 3AIMA 3ZGOA 1DTSA 1KOJA 4ZA2A 3TOSA 3R0JA 5PGMA 4CQNA 3QFSA 2YCLA 4B3FX 3MSXA 1DT3A 5LZ8A 4KN9S 3GLTA 4BZPA 2V54A 4ZCQA 3VZQA 2PBLA 2ZS8A 4H4DA 1XPJA 2IV3A 1MJGM 1U3DA 1GRNA 1KI4A 3N2LA 4HH4A 1I7DA 3U6KA 4DLYA 2A2ZA 3ZZUA 2H5EA 5AM3A 3FSJX 4GO1A 2FFJA 5JOQA 4G37A 4U7DA 1MOQA 3COZA 1OC2A 1X7XA 2YFQA 4FNAA 1EM8B 3HCRA 1URPA 4KTVE 4YFVA 1XJQA 2Q6VA 4INOA 3LXMA 1A1SA 3UXYA 4EJSC 1VMEA 3QGMA 4FJ2A 4EY7A 3QZUA 5DDIP 4FYIA 3OX3A 4HUQB 5J4VA 4YRGA 2EARA 3TXYA 3LTNC 2C7OA 3TW8A 2F9MA 5IJAA 3OIGA 1JGTA 2QW0X 1SA0B 3HI6A 4KUHA 3GT7A 3L1JA 1LK7A 1PVVA 3AZQA 1UJNA 4FZRA 2XMBA 2X0EA 4U5QA 5F3WB 2RGBA 2CDRA 1ZWLA 5HKLA 1GFIA 4RGQA 3GVCA 3EUFA 1IYZA 3GQVA 4NBVA 1AF4A 4NZOA 5K0JA 2AL7A 1DAPA 2QRZA 2DF8A 1VL2A 3F3KA 2R5WA 4YCMA 4IZHA 1VRCA 1IN6A 1N36B 3IDSA 4CE6A 2P8SA 3M70A 4EY6A 4Z0HO 4F4IA 3W1EA 4O63O 2Z6AA 1GGMA 1COWA 3QF4B 2WA1A 1JYEA 4NYIR 4DLPA 3VJRA 3N86A 3CINA 4R2XA 5GV7A 3TTXA 3VDQA 2AT1A 1QR6A 3VR3D 4BECA 3O3NB 4L4YA 5IJ9B 4NYMR 2XF8A 4MRPA 3RAJA 4E4YA 5EIFA 5IDQA 2P78A 3V7WA 1Y6FA 1X1EA 2IBTA 3VR4A 4KQMA 3NP7A 2BKUA 2XHEA 3LIIA 4WMLA 4UPEA 3LUCA 1IWOA 1Y80A 4ARIA 3SPXA 1E18A 2Q3LA 4FYPA 1F3OA 4MRNA 3ENNA 2QTCA 5FUBA 4BEJA 1T0HB 3AVQA 4TTPA 3DCIA 3T3NA 2WAAA 2JJ2D 3F3SA 2AYZA 3K31A 5K05A 4Z4EA 1W76A 3R3VA 3GA7A 1OQAA 3TGPA 4I1SA 3DXYA 2Q0SA 4OREX 1ZJ4A 2R8YA 1XDUA 5GZ6A 1ZC3A 3VX3A 2BI4A 3CZAA 2FSVC 1CF9A 3CT4A 2HCJB 3RKSA 1D04A 4LBWA 5FBQB 5CFMA 4LF5B 3OIWA 2VP2A 2GNOA 2ZW9A 3IDOA 3L01A 5IW8A 3EZ6A 4WOJA 4AKTA 1BW9B 1W0JA 2FPXA 1L1QA 4PC2A 3W77A 3HEBA 3AHJA 3BMNB 4HDAA 2J9XB 5FWYA 2CSUA 3C70A 5DLDA 4GE3A 1C3OB 1ULZA 1IQUA 4G9GA 2A57A 4Y9DA 4KR9A 4CMIA 4NZNA 1NA5A 4LNAA 1OMOA 3A28A 4DXAA 1FFHA 4RQBA 1CUSA 1U9JA 2YJ6A 2HT6A 1TU4A 5I7HA 3KAQA 2WV9A 3JYHA 4QODA 1ZH6A 3ANNA 3C7CB 4OAQA 1XE3A 4M9XA 3K0AA 3NCTA 2QM0A 2YFHA 1N2OA 2JGKA 4I4TB 4KW7A 5ADWA 2MSEB 5LZ2A 3IQFA 1SA0A 1UKYA 1SOVA 2NGRA 3VC7A 3EUAA 2UZ0A 3O8QB 1GO2A 4A27A 2ORWA 1MRNA 2H4JA 2F4VB 1YA4A 3QXJA 1CZLA 2YXDA 3VBCA 5A5VA 1HQYE 4S0ZA 3U4GA 1UUFA 4G5OA 4BZQA 2QN2A 1Z6QA 2F3TA 3EXIA 4F6LA 5JSUA 1KHHA 1PUXA 2HA3A 3D3KA 2QGZA 1LS1A 1Q1EA 2W6JD 3AG5A 3A4YA 3H6HA 2NNWB 3N8NA 3NNSA 4G5RA 1NVVR 4NG4A 4P2GA 5B7GA 3OOEA 3M89A 3Q87B 5T57A 1B41A 2QRVB 4AM8A 4WXMA 3QOFA 4PBSA 3R7FA 3REGA 1YUNA 4UAVA 3C5WP 3ZY3A 3PWTA 1WY7A 3DNPA 3C85A 1SB9A 2BI8A 3F7TA 4J0KA 1V1MA 2J0SA 5DLQC 4LXHA 1DDGA 2QTWB 3K0AB 3TPZA 4CI9A 2QXYA 2PKEA 3DUFA 2DUNA 4G1VA 4AO6A 4DSZA 1EXMA 4CR6A 4BJ3A 4ZALA 1XZJA 4HXYA 4TGLA 5E3JA 1DKOA 3NTUA 4Q3EA 4BKMA 1UP6A 1VE7A 1EYZA 3W9BA 2DSNA 3BCHA 3LY7A 1KWGA 4ZI2A 4DYVA 2GHRA 1GG2A 4L76A 4X0EA 1MIHA 2JCYA 1ML4A 2G40A 2YVKA 2JFOA 2FFBA 4JOSA 4JVNA 3H2JA 1WDMA 4C1BA 1RBMA 4P5EA 1BN6A 3VPCA 3TZQA 1JQJC 5D3QA 1B26A 3U31A 1EFLA 3X1JA 5IULC 1JHVA 3R3SA 1A5AB 3I2YX 3WGNA 1G2OA 2UVDA 4CFZA 5CVDA 4FYMA 4F7DA 5DJ5A 2YDYA 5BN5A 1WHSB 3AR6A 1Z73A 2OO7A 4KPYA 2WICA 1V16B 2PMCA 4AN0A 4L51A 2IYEA 2BW0A 1PRYA 2JCGA 4MKXA 4F6CA 2QF7A 3ST7A 1SVSA 4RUKA 4B6GA 5IVHA 5FUWA 4KV7A 1ISMA 3D8TA 1YGYA 3SLGA 3WQBA 1QU3A 2TECE 4EQ6B 2I6QA 3WNDA 4DQUA 3HYTA 5FAKA 1IN8A 3OM1A 4IIHA 1PJTA 3KUCA 1JFVA 2CVZA 4OJYA 5LQNA 2AQHA 2R7NA 4YB8A 1MX9A 3CCCA 4BOYA 1JVNA 3RKRA 4CHTA 3VR5H 1GAXA 2IK8A 3CT6A 1MEOA 1OLXA 2B34A 2QVXX 4N0EA 3C6KA 1XD8A 2W2LA 3ZWQA 1A9OA 2Q6IA 4US1R 2OD2A 1YRLA 1H9CA 4EGFA 1XEFA 4JDPA 4Q6WA 1CUEA 1SIUA 2ZEJA 3JASA 4GXQA 4O4LF 1F9EA 5CRIA 1OLUA 3GGDA 4M46A 3WA6A 4BU0A 2F9FA 4D99A 1FSGA 2H5IA 2Y1FA 4D9JA 2SNIE 3GDOA 5REQB 1TJNA 4JJFA 2Y4OA 1OIXA 3HJAA 2IPAB 3KWLA 1RW4A 1GU0A 4J4TA 4Z2YA 2H2GA 4EA7A 1DO8A 4RNDB 4EBFA 2P6RA 1E3MA 1JSZA 4JC8A 4NHEA 2AOVA 5DSXA 3REQA 1XLTA 2DR0A 3L04A 3QI7A 1CZNA 1UPXA 4X7PA 5AM2A 3R7LA 2LCFA 2PX5A 4LF4B 2H59A 1P3Y1 5G0SA 3OQOA 5BR4A 1DEHA 1FXWA 4Q05A 3MIZA 5FLYA 2AIRA 2WMOB 4IVRA 1E77A 4AP5A 1A9XB 2VYNA 2C29D 1VPDA 5A3SA 5JWRA 3MXOA 5A4FS 2AUTA 1MP0A 4NI5A 2FDCA 1PJ2A 5ALWA 2P7HA 3BL8A 3LYHA 3U4DA 3WXMA 5A4DA 1D6NA 2EX1A 2O57A 4OBXA 1ODLA 2CXUA 1DMRA 4Q6BA 4MR7A 1DAIA 4NAVA 3RJTA 1P61B 1CZOA 2P5SA 3GYGA 3K15A 4IUDS 5LXTF 3TLCA 2A9JA 2WIBA 4QLOA 3UAGA 4JBYA 2CFIA 2IF0A 2DQYA 2AC4A 2FN3A 4X3OA 3O4GA 1SXIA 2H29A 3QX8A 4YMIA 4BMXA 3IKLA 3DZGA 3I3OA 4PWZA 3VR2D 2G3YA 3SWWA 3EPJA 3VZCA 5LZ4A 2DSTA 4UU1A 2GZ1A 4DHEA 4EARA 1FNBA 3MMZA 4V3CA 4LNUB 4BTVA 1OYWA 3ZLUA 3MRXA 4TSFA 3W2EA 4ZMBA 3PFHA 5BPHA 2MWMA 1AN0A 1TUGA 3A3YA 4N54A 4OGKA 3G8YA 4CCAA 1YS2X 2AFIB 4Q4DA 4C0WA 2JD1A 2GX6A 3JD4A 3BK1A 4JB0A 1TVMA 5KVSA 5FBLB 2DFLA 2XQIA 3RIEA 4ZV9A 5KEIA 3Q7TA 1A9XA 1I9GA 2IGTA 4DKXA 3K9WA 4M1EA 3KRTA 3UHFA 5C52B 2BM9A 4YCSA 4I7EA 1PFQA 5EJ8A 1U0JA 1XU4A 3JR3A 3JQCA 2BKAA 1NFFA 5EIAA 2EJCA 1LSJA 3RRYA 1XDGA 4RM2A 4K9SA 3SQDA 2FK7A 3NEAA 3U7IA 4I5DA 1C0KA 1H5UA 1ZU5A 1ZYUA 6CHYA 1XZDA 2TMYA 3BBLA 1X1SA 4OL9A 1T5TA 4D41A 2PSFA 5JADA 3OF3A 5JTUA 5E4YA 4I50B 2DJ5A 4MIOA 3R75A 2RJOA 4FE3A 1TM1E 5AK3A 1XEWX 4HX5A 4LYGA 1VCHA 4TS1A 2XD4A 3H75A 3UO8B 4WNAB 3JY6A 2WZDA 3SX2A 2ORED 1PN3A 3HP7A 4O59O 1E9CA 1M1NB 3SN6A 2PX8A 2XXBA 1BDIA 3V6LA 2ZYGA 2FMTA 2PGJA 3KXKA 2RH4A 5AKHA 4C0LA 3EZ7A 5CM9C 1OASA 1VKRA 3ZV7A 4YIHA 5IUNC 3TIFA 4PLWA 2QVCA 1LGYA 2ZTMA 2FX2A 4OQFA 2CNBA 3RTGA 3PHCA 3EXHB 1DHRA 3TZEA 3G0IA 2ZRHA 4UVGA 4ZYVA 1BZYA 4XWKA 2UZIR 5J4HA 1CUDA 1P7PA 2KLHA 2NO5A 2WWGA 1RI3A 3OD1A 1JQBA 2CL5A 4K9MA 1IHYA 4MV3A 3ABSB 4URZR 1HSZA 1M1YA 1Q77A 2OLJA 2XYVA 3NALA 3WGZA 1DC4A 2Z8YA 2Z2XA 5LLSA 1WOYA 2H51A 4EHKA 3E7FA 1W85B 3O9ZA 4MRAA 2ZJ2A 3DO6A 1P1JA 4QRHA 1Y7PA 3FYDA 2W6QA 2HSWA 5K7SA 5HKKA 1QONA 2EQBA 2VT2A 3E82A 4BATA 2H7XA 1PFUA 5EJIA 1ZLXA 4HXEB 3GH3A 3PSAA 3QXCA 4KIUA 4C7VA 2NTEA 3NASA 2ACVA 2VPIA 3L7OA 1G9SA 2RAVA 3RYTC 3S2ZA 5CD9A 2ON6A 3B53X 1SD5A 2CVHA 3DOIA 3OQIB 4LCEA 4XX0A 3CQ9A 4DG8A 4E09A 1MEJA 2GXUA 4ZVRA 3BN3A 2HX1A 1O0CA 1YCFA 4Q4AB 3UT5A 4DA9A 2IW3A 1LQTA 2D06A 3OHMA 5B57C 3FTDA 2ZJZA 3NDIA 5BW8A 3WLPA 2A0FA 2QE7D 2XZDA 4UMDA 3S99A 3I2GA 2JFWA 4HRAA 1GV0A 1KI6A 3FH0A 4LCBA 4RMNA 1NJGA 3H1FA 6YASA 5JTTA 3T5AA 4K03A 5CT4A 3OZAA 3IMCA 1GUAA 3BMNA 3FRHA 4I6JA 2OORA 3IV7A 3WKEA 4I3GA 3TCKA 1BWPA 4HZGA 1XCBA 4JWTA 1KZHA 3JYQA 4UCQA 1NNI1 4QHTA