2CSXA

Crystal structure of aquifex aeolicus methionyl-trna synthetase complexed with trna(met)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
497
structure length
464
Chain Sequence
MTLMKKFYVTTPIYYVNDVPHLGHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKLWEFLKIEYTKFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVTRPRSRVKWGIPVPFDPEHTIYVWFDALFNYISALEDKVEIYWPADLHLVGKDILRFHTVYWPAFLMSLGYELPKKVFAHGWWTVEGKKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRINGELANEIGNLYSRVVNMAHKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLNKYVDEKQPWALNKERKKEELQKVLYALVDGLFVLTHLLYPITPNKMKEALQMLGEKEFLKELKPYSKNTYKLGERKILFPKREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords RNA (75-MER)
publication title Structural basis for anticodon recognition by methionyl-tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 162
structure length 464
sequence length 497
chains with identical sequence B
ec nomenclature ec 6.1.1.10: Methionine--tRNA ligase.
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08264 Anticodon_1 Anticodon-binding domain of tRNA
A PF09334 tRNA-synt_1g tRNA synthetases class I (M)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.730.10 Mainly Alpha Orthogonal Bundle Isoleucyl-tRNA Synthetase; Domain 1 Isoleucyl-tRNA Synthetase; Domain 1 2csxA03
2.170.220.10 Mainly Beta Beta Complex Methionyl-trna Synthetase; domain 2 Methionyl-trna Synthetase; domain 2 2csxA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2csxA01
3LE8A 4G5FA 3Q10A 4NAHA 1KAMA 1O94D 2WQ7A 1ZUNA 1NUSA 1GN8A 4ZCSA 5FO1A 3K9WA 4MWEA 1OWOA 2IP1A 1Q77A 4F3RA 1KORA 2YY5A 2V0CA 4R0NA 1MC1A 4DLPA 2PIDA 1COZA 4MUIA 1GTSA 4U7JA 5HG0A 1B6TA 1EFVA 4MW7A 4ZT5A 2QUJA 2R5WA 2YWCA 4ZT6A 4MQ6A 3P0JA 5KWVA 1OBCA 1WXIA 2J5BA 5HUHA 1NUQA 2DLCX 2QUKA 3PRHA 3IODA 5JBNA 4RUKA 1LI5A 4EG3A 1JECA 3FI0A 4MW9A 3IOBA 4QRDA 3KT3A 2QUIA 2EL7A 3P52A 3NBAA 3AIIA 1JEDA 1M8FA 2X1LA 4ARCA 2AG6A 3TS1A 5IHXA 1I2DA 1T9GR 1KQPA 3PNVA 3KT6A 1PG0A 3COYA 4R2MA 1F7VA 4EF6A 5BNZA 1VL2A 4EG5A 1Q15A 3IVGA 4ZCQA 2AZXA 1IVSA 1K97A 5IJXA 2CV0A 4A91A 1NUPA 1YIDA 2JA2A 4NDAA 1JMVA 4Q93A 4XFJA 3FH0A 1U0BB 2VTBB 3SDBA 1DNPA 2CYCA 3IOCA 3COVA 1WOYA 1H3FA 2J07A 4S1OA 2JANA 1OWMA 2Z3VA 3Q4GA 1JIJA 2DPLA 1O95D 5F23A 2J08A 2D54A 2A84A 3FG9A 1RQGA 3QTBA 5FO0A 5DASA 2CYAA 1T6YA 2PZ8A 2ZUFA 3OP1A 1O94C 2ZUEA 1KH2A 3TZEA 3X1JA 3NV7A 2IELA 3H97A 2CFOA 3RBAA 3KT0A 3CVWA 4MVYA 4EG6A 1MAUA 1N2HA 2VXOA 3ND5A 1WZ2A 5H7XA 3HV0A 1KAQA 4DDMA 3GMIA 1F7UA 1EFVB 3ISJA 2ZP1A 1KP3A 4I6JA 4GU5A 4PBSA 1J70A 2Z08A 3COZA 1K4MA 3CLUD 3TZLA 2RE8A 1J09A 1IRXA 3ZXSA 5TS2A 4NX2A 1T9GS 1IQUA 1M8GA 5J59A 3M5WA 2HGZA 2EJCA 3FDXA 4HJRA 1QRSA 4CQNA 2WSIA 4KR9A 3CR8A 4BWVA 1WY5A 2QUHA 3FETA 1GTRA 2TS1A 1EXDA 3P0IA 2A7XA 3AG6A 3SYTA 3L92A 3SEQA 1OWLA 2BYTA 4YMIA 1N78A 4MUHA 2XRYA 5LFAA 4K0RA 4L2IA 5EKDA 1VBMA 2QJTA 1UFVA 3JXEA 1I6KA 1VBNA 1N2BA 3H05A 3G5AA 1EUQA 4ZCRA 2BTEA 1OD6A 1YULA 2JAXA 5K0SA 4KR7A 2J09A 1ZH0A 3L93A 2GM3A 1MB9A 4FZJA 3N9IA 5K0TA 3IUBA 4MUNA 4HJXA 4DDHA 2QJFA 1JHDA 5AHWA 2RD2A 2GOYA 1N2JA 3H99A 2PG3A 1IQRA 1PFUA 3CLSC 3AKZA 2CSXA 3UK2A 3ND6A 2G36A 3A2KA 3P0HA 1IHOA 4MUGA 3VGJA 1OWPA 1V8FA 2E89A 1TQ8A 1SURA 5TEWA 3FHJA 1QRTA 1O97C 1VBKA 5DB4A 4PBRA 1OBHA 4MULA 4X0EA 4PBTA 1KQNA 2E0IA 3SZ3A 3N2YA 3CLRD 1O6BA 3QTTA 1G8GA 1YI8A 4DJAA 1FFYA 1QU3A 3BL5A 1ILEA 3Q12A 3X1KA 1H3EA 4EG4A 1YIAA 3D6VA 2PFSA 1F9AA 1N2GA 3C8ZA 3E27A 4OJMX 3HFJA 4H3SA 3NBKA 4GRIA 4OUDA 2PZBA 2AKEA 3ZJUA 1T6XA 4P2BA 1JGTA 3TNJA 3IDFA 3VRHA 1MRZA 2DXIA 1G59A 2B7LA 4QBTA 2DEUA 1PFWA 4G5YA 1YUMA 4ZT7A 1NP7A 2Z09A 3CVXA 1D2RA 3G59A 3AL0C 1J1ZA 4AQ7A 3DLAA 4L2IB 4R2LA 3CVYA 1JIKA 1LI7A 1U7DA 1U7XA 2DERA 3IH5A 1KH3A 3DPIA 4MW5A 4ZT2A 4JYZA 3QE4A 2I1LA 4G6ZA 4KKVA 1K4KA 1GPMA 3K32A 3CVVA 1N3LA 4ZCPA 2WQ6A 4DE5A 4DNXA 3RK1A 2PXHA 2A4MA 2NSYA 1MAWA 4YP5A 5DK4A 3LOQA 1IH8A 2CUZA 3FWKA 3HGMA 4RPIA 1N2EA 1XNHA 4XFDA 1HYBA 2H29A 3GUZA 3OTWA 3CVUA 1P7PA 3UY4A 1KR2A 2DUMA 1LW7A 3IMCA 1N2IA 3U1VA 1KKUA 2DR2A 4E1AA 1U3DA 2A88A 2X3FA 1M8KA 3IUEA 1WJGA 4ZT4A 2J4DA 4MVXA 5J5AA 1KQOA 2DETA 3N05A 1S4MA 3UC5A 3DO8A 3ILVA 1TEZA 4CDMA 1H1TA 3SEZA 1M8PA 2O8VA 4MUKA 1G8FA 3ZXIA 1NYLA 3RJZA 3ZUGA 1K92A 4KPUA 2O5RA 2QTMA 2IJGX 2OQ2A 5LM3A 2PZAA 4XSVA 1X8XA 3KFLA 1GLNA 4YBRA 2CYBA 1N1DA 3SZGA 4PY2A 3TQOA 1TFUA 4OUDB 1O0CA 3IVXA 3N8HA 1EFPA 1GZUA 1WXEA 3F3MA 4WSOA 4MVCA 1O95C 1OWNA 2HMAA 4MW1A 1U3CA 3D6UA 1ZJWA 1MOPA 4HK4A 3RK0A 4MUEA 4MWBA 1T6ZA 2GKSA 4KR6A 1R6XA 3A04A 3GLVA 3G6KA 4K03A 4EGAA 1QJCA 2A1TR 5HUJA 3MXTA 1M1ZA 1H3NA 1X6VA 4MW4A 1PG2A 1A8HA 2WB2A 1NI5A 5LLTA 3HZRA 3UMVA 1TYBE 2QTNA 5TEVA 1Y42X 4MWDA 3CLUC 3KT8A 1XNGA 4WNYA 3SP1A 1JIIA 4MWCA 3CA8A 3I05A 2A86A 1EJ2A 4U8HA 1WXFA 1QRUA 3IOEA 3MUEA 1Q19A 4NATA 3AFHA 3FNRA 4Q16A 3ELBA 5J58A 4F4HA 2CT8A 1V47A 4ARIA 1IFXA 1ULHA 2E21A 3RHSA 4ZCTA 1PFYA 4MVWA 1KH1A 1IQ0A 3LCJA 3A4IA 4I6EA 1VLHA 4ND7A 3AG5A 3ZGZA 3HL4A 1R6UA 1KP2A 2D5BA 5KHAA 4EFKA 1J1UA 1J20A 1G8HA 4JXZA 1MB2A 3FOCA 3INNA 1JZQA 3CLTD 4NZPA 1J21A 1QU2A 3IMEA 4MW6A 1R6TA 1WQ3A 3TQIA 1O0BA 4KPUB 1BS2A 2OV4A 1TYCA 5KCMA 4AS1A 1N2OA 1XNJA 3PNYA 1QQTA 1NUTA 1WXGA 2A1UB 3MLBA 3IMGA 1WKBA 1I6MA 4ND6A 1N77A 1JZSA 1EFPB 3FY4A 1YUNA 4YP6A 2QJOA 3VU8A 3H9CA 3ZIUA 1M83A 1O96B 2A1TS 3PNBA 3PXUA 4MW0A 1O5TA 3ND7A 1MBZA 4HPWA 3CLSD 4QREA 1NSYA 2X0KA 2YXNA 2YWBA 2QTRA 4JZYA 1NZJA 1WXHA 2V0GA 3MLAA 3DV2A 2XRZA 4JXXA 3IVCA 1PFVA 2H2AA 4CDNA 4U63A 2CV1A 1NURA 1QNFA 1O97D 4ZT3A 1TYAE 1NUUA 5FNZA 3MMXA 1N75A 1GAXA 1ZH6A 4JFAA 2CV2A 2E18A 3ZJTA 3HMQA 4MUFA 3COWA 5H16A 4J76A 1WQ4A 3H9BA 1JILA 3X1MA 4EG1A 1EUYA 1F4LA 3CLRC 3A05A 4I6GA 3ZJVA 4CT0A 4EG7A 2VTBA 5DEOA 3RFFA 2C5SA 1XJQA 4YP7A 4MUJA 2A1UA 4UZFA 4DDKA 3S3TA 4EG8A 1I6LA 1M8JA 4MW2A 4UZEA 1TYDE 1FYDA 1MJHA 1Q11A 4MLPA 3UOWA 4NAUA 2D13A 5TGTA 1JEEA 2HZ7A 1O96A 1CT9A 3CLTC 4J75A 4MAFA 1QTQA 4TS1A 1EE1A 2NZ2A 2X1MA 3FIUA
chains in the Genus database with same CATH superfamily
1HQYE 1BIFA 5BN3A 5KB3A 3PC7A 2YS7A 5HFJA 3VNQA 3KQMA 3EMVA 4LFBB 2DQZA 4AJNA 3EULA 2QRMA 3IBYA 1JQBA 4MRVA 1CFZA 4JKYA 3BKWA 1HZJA 3UPUA 1UBKS 2GCOA 2UZ3A 2AFRA 5HG0A 1GR0A 3ETGA 3K70C 2QUJA 2W43A 4MR7A 5GM2A 1C80A 3WFIA 1USUA 1W88A 2DQ4A 3B48A 3KD2A 4PR3A 3UAOA 4DNFA 5HUHA 1RQNA 1FSSA 1JN0A 4RIGA 2AG8A 4PGFA 4ETIA 5H5JA 3UT5A 3K30A 3REOA 4G8JA 2N1MA 5TIIA 1RYFA 2RJ3A 3C7DB 1Y9JA 1Z08A 3OIFA 1HNNA 4HEJA 3SEFA 5AD1A 2F8SA 5AVXA 2AUMA 4GBED 1XZKA 2Y1WA 4ZTBA 2JI4A 4CRWB 2Z57A 4X60A 4CLRA 2DHDA 3WJ1A 1UP6A 3EXHA 5H8WA 3R1IA 5FLYA 1AHNA 4G1MB 4PLGA 2O07A 1ZJZA 1GHTA 4Y2SA 3UQYS 2WSLA 1Q6YA 2RAVA 4KH0A 2H2IA 4DV2B 1JXQA 2LE0A 2WHQA 1K7XB 2N42A 4FC7A 1NTRA 2NO1A 2WA1A 2AIRA 2Y0PA 5E8JA 1ATIA 2CFRA 4GBMA 1DT5A 3KQHA 2FWIA 2EJUA 1P2GA 3CG0A 2FPMA 3ANLA 3HP1A 5DM1A 4E12A 1PJZA 4LBVA 4MUYA 5D7NA 4OF4A 4OXIA 4A91A 1YIDA 3FROA 1TECE 2CMDA 1RXSA 3WK5A 5HZGA 3MOGA 5J1SB 4WD3A 3W90A 2GCEA 3H4VA 1YR3A 3MT8A 5LQDA 3PNQA 2AE2A 2OM6A 3KUCA 3PHHA 5DLYA 2W4IA 3GZTB 5IARA 1CJMA 3C4VA 1DX9A 1MXFA 1NVAA 1FSZA 2CFIA 4MUAA 3SHWA 3OEED 4BNWA 3LRXA 4D8VA 1G17A 1WB4A 1S7CA 1NA5A 2B20A 1I4OA 2VJCA 3PA8A 4OOEA 2R44A 2QR2A 4R01A 3VV2A 1PJBA 4G56A 5JS7A 1GITA 3TZ6A 1O95D 3RJTA 4KQGA 3TBHA 3DFMA 4ZOBA 2BHRA 1I3CA 2ECOA 2J3QA 1VMKA 1H69A 1WB5A 2QY6A 3NTOA 4F6LA 1GPH1 2JEZA 3QLTA 3E2IA 5K9ZA 1ZVJA 2WWGA 2JF0A 3L0SA 2GN2A 4DG9A 1NLMA 5COQA 4QYIB 4B4WA 1SQ6A 1KJ8A 1PUIA 1QAQA 1XTZA 1EYZA 2IS2A 2X2OA 4FS8A 3CMCO 4JLDA 4O2AB 2B8JA 5H7XA 2V1XA 4HQ6A 1KYIA 1VL1A 4JBYA 5ALIA 5HK8A 1GUBA 4BHTA 4NMXB 4NMHA 2F8TA 1Q6ZA 1JKJB 1XF1A 1B42A 2PMKA 1NQAO 4OTZA 5IJ0A 3J80A 4AJJA 2RHGB 4NENA 1QZ3A 4H08A 1QR2A 1UZUA 3Q98A 4Q3BA 2ZAIA 4AKIA 3EY9A 4MYDA 4FP9A 1BXKA 1AQ6A 3B6KA 1KAGA 2FUCA 1Z6QA 4QNNA 5DYTA 5EMJA 5LA6A 3ZDRA 3W4IA 2CJPA 3QX7A 1IQUA 7ADHA 2X14A 4MLZA 4HJRA 4KXLA 4OHMA 3OZFA 4P4LA 2JDID 2I87A 2V74B 1Q12A 5A7HA 1HDXA 3ROMA 1UBTS 2VP9A 3QXJA 4URFA 1WR8A 1CX9B 4HPXB 4XQCA 1JQ5A 1FJGB 4QWMA 1Y80A 1XAHA 4PINA 4KO1S 5AW2A 2OR3A 4UVGA 2MCFA 1ZXXA 4X20A 2HWWA 2A58A 1GTRA 1DUVG 1JLMA 1D8AA 2HEGA 4ZK2A 5DI9A 2ZBUA 4EENA 2XMGA 3HM2A 5LA6F 5HJ2A 3S4YA 3JQAA 1IXZA 4CMIA 3RROA 4MV6A 3WV5A 3EC1A 5G3ZA 2EFDB 3IAS6 1J0XO 3DAPA 4KXVA 3S2UA 3S99A 1KQGA 5K2OA 3NVAA 1JDBB 5KIAA 3LLUA 3P9SA 3V9PA 4M88A 4HXYA 2C83A 4TMZA 4R69A 1QFZA 4XD7D 1L4MA 4F5EA 1SXJD 5F73A 4ACBA 4FFBB 4C3VA 4HGRA 3PX2A 1HKHA 2WWYA 1J5XA 4I14A 4EL0A 2PQ0A 3TTTA 1XZIA 4D3YA 3E5HA 2UZ4A 2OUIA 4W5QA 1AV7A 2GARA 2SCUA 2ODTX 2CDNA 1XK6A 3BREA 3RS5A 3IUBA 4HQ0A 4CLHA 3Q8KA 2NV6A 3QVJA 5FTWA 1J5PA 4UDXX 1W48A 4H2DA 4DPKA 4EDHA 2RIPA 4B43A 3CRRA 2BBSA 1QP8A 2W22A 4MAAA 1QOPB 2O2XA 1IPFA 5SZJA 1BW9A 2D2IA 3BN3A 3FCUB 3GRRA 3LUAA 4NLLA 2Z95A 3AKZA 1ZM9A 4J90A 4O59O 4DM3A 2E1RA 4NU5A 2OCXA 5H70A 1KI2A 1NJ5A 2FN4A 4NH4A 2X8WA 1HR0B 2NU9A 3DCIA 4JBXA 1ZMXA 2OB1A 5EKXA 2LWIA 1U2GA 2MSWA 5AVJA 5DXFA 1E6CA 3F98A 5AJWA 1EGVB 4HNUA 5BRJA 3ZYCA 1OVMA 3NLLA 3SIXA 1O97C 3BRSA 3HP7A 4PSDA 3BFPA 4RPHA 5BSHA 1XMQB 3O9MA 2FYTA 3M5DA 4HFNA 1ZRHA 1DO0A 1D6JA 1XAGA 2WLTA 3ECAA 3DAFA 2D7DA 1M6NA 4JUBA 1DKRA 3FSGA 3B6EA 3Q40A 4G4JA 2PX6A 4HH3C 5L3ZA 4LC1A 5EXXA 1QH1A 1X7WA 2QZSA 3IERA 3CPEA 3H16A 5C35A 5EP1A 1SUCA 1RYMA 2KJQA 4KITB 3OC6A 4JHXA 4A0HA 3DEIA 3U4GA 3RTCA 2AXNA 5DBEX 1A88A 1HDGO 4FB5A 4IGAA 4D3FA 2FPGB 2CUTA 3P71T 3P9YA 4N7MA 5P21A 2DWQA 3MOSA 3TE6A 3PQ4A 1OGIA 1NQVA 3TAHA 4DIDA 2PFSA 1DQYA 2ERYA 1QH8B 2XTAA 3AB3A 3JWJA 4TVKA 2PRYA 3AW9A 4YRQA 3I5XA 4KMSA 2PNFA 1PV2A 2ZIEA 1TA9A 5DMHA 5EZSA 4V0LA 2YN0A 3I37X 3LIIA 3MS2A 4YQEA 2C99A 2HKIA 2ZGVA 1W36D 5KVAA 2FMIA 2R6HA 2VSOA 1UBMS 3VJRA 4MEBA 1C0EA 1GLGA 3A9RA 5SYMA 4ZDKA 1PX0A 4CLEA 3C3AA 3KJQA 1LPOA 1O77A 2VK1A 4RE6A 4X00A 4HNTA 4N3CA 4WXEA 4UMFA 5ICSA 1AA6A 2O2IA 1CUEA 1P33A 3TKAA 2P1DA 2HIGA 5UKDA 1SXJC 1JG4A 4PCVA 1EAYA 1PR3A 4B80A 4BMXA 5K8LA 3R76A 2HCTA 1NHWA 1LZLA 4GI3A 1D04A 2QM7A 2VJLA 2JK1A 4DRXA 1TC2A 2PU5A 4O29A 3TCKA 4TTTS 4OHOA 1JDJA 3EAGA 2PKYX 3DZDA 4R05A 521PA 1KGSA 1RABA 2QD4A 3U37A 2V5AA 3KR1A 4MWGA 1TGYA 4MS1B 3R0VA 3R3ZA 1FLDA 5IW8A 2A4MA 3QLVA 1ARZA 2BMFA 5FADA 5FFMA 3R6TA 4HWTA 3T3NA 3T1OA 4YUAA 3M9XA 1JAYA 1EM8A 1P61B 1SWWA 4R1TA 5AKHA 5CDGA 1XNHA 2AOTB 1KEUA 2C9YA 1OLUA 2Q8NA 3OLCX 3TOSA 1V7QA 5A03A 3ZD8A 1TW3A 3IMCA 3NS7A 2FPUA 1S2OA 3QWHA 1JQ3A 4B6FA 4Z7JA 5ICEA 3QF4B 1I51A 1D0IA 5EERA 5LP1A 2HXGA 2Y1EA 5IAKA 2RHJA 3RS4A 4H3HB 2ARKA 2DTDA 3O92A 2RI6A 3PIRA 3OT5A 1ZMOA 1VLJA 3OZGA 2J4DA 3IQFA 1WSAA 4OREX 4R41A 3S2EA 3LY8A 5J2UA 4CEHA 2R7LA 4RHXA 5D2CA 4A2WA 1AQIA 1OFHA 4LJKA 621PA 3DDSA 2QLTA 1IXRC 1EUCB 3NBMA 4MGZR 3GLQA 3FAZA 3I92A 3B3GA 1L4UA 2OZVA 3A06A 3H18A 5AXDA 4D2IA 3OUUA 3BHJA 1DKNA 1JVSA 4L07A 2PUEA 1E3SA 3DBRA 3WQBA 1BFDA 1GLNA 3C41J 1SFRA 3OQIA 3SZGA 5K4GA 3X1XA 2DAPA 3ADKA 1QHHB 4KL8S 1MMFB 5AOCA 2L2QA 2V6GA 3HBFA 4QO8A 4D80A 4YS6A 2X0EA 1C30B 2PPVA 4MVCA 1A72A 1GT6A 3WNBA 1NF9A 1X1AA 1Z13A 3Q3EA 4AJPA 4F4FA 4LHZA 3ACBA 2AN5A 4TLMB 2RHOA 4YJ3A 3DKRA 2FQXA 3HACA 3CO5A 1ZIDA 2ZUUA 2AN4A 4BJ6A 1BRMA 3OZUA 1PR1A 1P7VA 1ISGA 4TWRA 3KTFA 3HS3A 1F14A 2OILA 2B3TA 1Y4ZA 3OQNA 2QRVB 4R83A 1N9ZA 3INRA 1VPTA 4HWRA 4PZ0A 1TUGA 1IONA 4P5EA 5TARA 4UQLA 1ZM7A 3HZRA 1Z7EA 3LA8A 5JEDA 3JRWA 4JVSB 4LVCA 5JBQA 4YJ3F 4W8GA 2WNHA 1W7AA 1WKCA 4FDTA 3V34A 3Q8LA 4BKMA 2XF2A 4JC8A 1OREA 1I14A 1YR8A 4NBRA 4C4AA 3RAPR 4E14A 3MVEA 1Y37A 2YJ6A 1XALA 1WBDA 2A86A 4Q1CA 2FPXA 1EK5A 4PC7A 2YVLA 4LISA 5JSUA 2OBMA 1I1QB 5F7XA 2DSTA 2WWTA 4DLUA 4P53A 5M2QA 2F4VB 3O1LA 1BHQ1 1JEAA 4HZUA 4G5RA 5AKLA 1M74A 3EGOA 4YCJA 4ESEA 1V3VA 3NYQA 4EK9A 5KYXB 1IQ0A 1YE3A 1F1BA 1D2HA 4EGQA 4MP3A 2VT3A 1TYZA 1YVRA 2BEJA 2NYUA 5K8CA 3OKFA 2PPLA 3A6KA 3L1KA 3T7EA 3LY7A 1L7RA 4LECA 5IDYA 3UJDA 5KSWB 1KNXA 1RBQA 2CXPA 2GAJA 2GHQA 4MRMB 1MB2A 1UIRA 3TG2A 1JSZA 1U5CA 2D2FA 4ARUA 3HZHA 1IWBB 3KU1A 3IB6A 5HGXA 3I58A 3ROQA 3EX7C 4NYIQ 4IEFB 3U0BA 4HNVA 1K6JA 4DCUA 1LZKA 2GPWA 1UBLS 3MLBA 4KAJA 5KX5B 3D6FA 3AVYA 2GETA 4TKZA 3P9QA 3DBVO 1NJFA 1A27A 3EF3A 3QQPA 3QVUA 3SEAA 1NQOA 3BRWD 5BURA 2WIKA 4XZ3A 3ICVA 4CF6A 3JALA 4C7VA 5DTQA 1UUFA 2OEPA 3JVDA 4X1KB 3WYDA 4A6PA 2HQSA 1XU9A 3O03A 1Q1GA 2XNHA 1JAIA 1UP4A 1QIDA 2XMBA 5I7HA 2WUGA 1VBFA 2NUTB 2VPZA 1M33A 3NGXA 1O5TA 2GKGA 3IMKA 3ILSA 3VPCA 5FOQA 1EJBA 2IYAA 1MO2A 5F1KA 3KXPA 5ADUS 3EARA 3KWJA 4JX9A 1LVUA 5SV2A 2YBEA 3BXZA 4UKDA 4XWOA 4RVUA 4E15A 5KNCA 3EB9A 1Y6FA 5KNDH 3HMKA 3I42A 2PA0A 2J9YB 4LPKA 4TTQA 3GFQA 5EEGA 5LC1A 1Y6GA 3D4PA 3LYAA 2EGGA 1FSFA 1VL0A 2C2XA 2WUWE 4IOJA 3LXUX 3UV7A 4MIEA 3ZE7A 3ZY4A 1ORVA 3NBFA 3VAYA 2WICA 2N75A 4WUTA 2GRUA 1M9NA 1UDRA 3E5RA 3G17A 4IDHA 1A1VA 1MO5A 3HU1A 3NBQA 4FNAA 1NUUA 5DBHX 4KK4A 4U6NA 3VOBA 3W2GA 3OLXA 4DARA 5KWIA 1MA3A 2DU8A 2E18A 3GGOA 4ZU6X 4BVHA 1LY1A 4FYJA 3DXZA 3EGDB 1O4WA 3QTLA 5DRYA 2JW5A 3H5RA 3L4BC 3GGPA 4WLVA 3N3AC 4JK3A 5TQ0A 3UXMA 2PNJA 1NJ8A 2X1VA 2BHNA 2GFHA 2OP0A 3RVJA 3S55A 1PCXA 4WADA 2HJSA 2R5NA 2J6HA 4H3KB 5J9FA 2H1CA 2HQBA 3DGFC 3ACCA 3U09A 1VMEA 3G0BA 1E1RD 2YCBA 4EI2A 5MN4A 2QVGA 1KQ3A 3UANA 3CLKA 2O19A 3UHPA 3BA1A 4D9FA 5LB2A 1KK1A 3IKMB 2AV6A 1T1GA 2ZBRA 3DEKA 4JX8A 3L6BA 4R2HA 5K3SA 4NG5A 2QLLA 3MILA 1RRKA 4MXDA 3JS5A 5CLJA 2YS6A 4RVCA 1CT9A 2W42A 1QTQA 3U4CA 3UF0A 4C0QC 1SZDA 1LTQA 2NM0A 4TT8A 1BOFA 2Z5GA 3DAGA 3IEMA 1XC7A 3LE8A 1DRJA 4YCMA 3OQBA 4UM9D 1N0HA 1OVGA 5EHGA 1NMEA 5BWOA 1JQAA 4FGLA 3TRKA 3HADA 3MWYW 3LWNA 3A6DA 3NP7A 4LCBA 1FF9A 5ED4A 1EFVA 2J3DA 2FLVA 4WKPA 1E5XA 2J0VA 2Q62A 4AUEA 4E30A 4EPXA 3F3KA 1VRVA 2WWIA 4MQ6A 1Q7CA 2O2ZA 4F1JA 2VJYA 4S24A 5JAQA 5EE9A 4YRAA 3SZOA 5T6BA 2RGCA 2Q99A 3RSOA 1KBOA 2Q4OA 2HUPA 3PXEA 3UZUA 3QKTA 1ZAYA 1U0OC 3A26A 2XJ4A 3HKDA 1RP1A 4C6RA 1PZNA 1Z75A 4EL5A 1ZOOA 3U4QA 1ESNA 1KK2A 3MSCA 4RVOA 3ZU4A 1GDDA 2C2WA 3EG9A 3KHUA 1VI2A 1RI5A 1UMCA 1OQAA 2MINB 2QVXX 1VRWA 3LUJA 1RSZA 3OEHD 4IHJA 4NULA 4E0BA 4UCXA 3N8DA 2QX4A 3EZXA 4QQRA 4MYRA 4YJFA 4YEDA 3UT0A 3KNZA 4ZCRA 4W5WA 1TM7E 2HJRA 4ZPJA 3TIXB 5BV8A 1KQPA 3PNVA 4ZTUB 4MV8A 3P97A 3FTDA 2LXNA 1NJGA 1KEEA 3U1BA 1YF3A 4NIMA 1W93A 4KRYA 3BPSA 2A33A 1Z4OA 1A77A 4FYXA 3NAZA 1SOWA 1USWA 4GC9A 1BGXT 3HQ4O 1FS5A 3I5MA 3X1YA 5CEFA 3NAGA 1OTHA 3KTAA 3THWA 1Z8FA 3OE7D 1XQ1A 5K0CA 1APBA 4J0EA 4NDAA 4IHJF 4G1VA 2B25A 4QECA 1BOOA 1AMUA 3C1OA 3KOOA 1Y63A 4BLSA 5EP3A 3H3JA 1R18A 4HEHA 1QS0B 3C8DA 3I30X 2CYCA 4A0GA 1CD5A 1B2LA 3ZU3A 4EB6B 2R9VA 2V7GA 3NDIA 4I8DA 3VKVA 3G2QA 3F4LA 4PQGA 1XA3A 3TMYA 3EFOA 3SIRA 5A05A 3GIDA 3DMHA 3WIEA 4Z3KA 4DEXA 5BWMA 3STWA 4WZAB 1YDHA 2FSUA 1X74A 1BN7A 1MXHA 2J08A 3H11B 2BEVB 1YL7A 1E4OA 2PEYA 5IDVA 4EJ0A 3I9V1 4LWQA 3IULA 1H8ED 1L7EA 1G4UR 2ZSDA 4DCMA 2EKDA 3EMBA 3VNVA 3SS9X 5HTOA 3RVNA 4YIHA 2B4AA 4RKFA 3O9VA 4MQ4A 1R74A 3R6LA 4AU1A 1I8TA 4DLNA 1VCIA 1LC0A 5A04A 3I04M 4M0EA 4KACA 4TMFA 3SXPA 4NYMR 1L5HA 1ZBQA 3CRQA 3JD3A 4GLFA 2WSYB 1L6IA 5D8DA 4GM1A 4QJ3A 3R7NA 3KAKA 4BTVA 1A7UA 2AW3A 3IDSA 2BFFA 4M37A 2CVPA 2ZRGA 1RC8A 1GTVA 4KREA 4UNPA 3PDHA 1UQRA 3BMQA 4FMDF 5FF9A 4DCGA 3A1EA 1ZGJA 4KUHA 2QMHA 2WJWA 3QU2A 1YR6A 2IIPA 1T9GS 4WOJA 1QAMA 3IQDB 3V4LA 4BAGA 1PR0A 1UP7A 1KXZA 1Q91A 5L3RA 4HEA6 4RL4A 2DFPA 4F3KA 3SQMA 3W8FA 5I7VA 5D5HA 1W9MA 2XEDA 4L5IA 3ZYZA 3OQPA 3VAAA 2NV0A 4EY3A 1QIGA 1FBTA 4C1BA 4DSUA 1PQ4A 3BD7A 5AVWA 4ZOLA 3ZGXA 1XYVA 2QUHA 5DIFA 4DXDA 1M73E 4JI3B 2BHSA 1RWXA 3HA7A 1KI9A 2VNSA 4PRLA 4MRAA 1R6VA 1CNMA 2C9OA 4NKRA 3M3PA 1OIXA 2ERXA 5K0FA 1KAEA 3U3KA 1C8LA 2JFVA 5JJCA 5EIXA 5EYPB 1QP0A 4EUEA 4MHOA 1H6CA 5ICMA 4OB8A 1TM1E 3PGXA 3JYLA 3H05A 1C14A 3GJQA 3MT7A 1PQWA 2PSJA 1Z2AA 2XKBA 4NU6A 3HI4A 4ZOLF 4QQNA 3K2IA 2HRDA 4F9FA 2E49A 1VYHA 4EGCB 3OH8A 3JYPA 2OZLA 5I9LA 1B23P 4EF4A 3FTQA 4X3CA 1NW4A 1E8NA 2GJ8A 2BEKA 1G5RA 4GMDA 1MB3A 2QT1A 5DYNA 4ZCMA 1KL7A 2ZW9A 4UEJA 5EMNA 5A2GA 1T0JB 4KWIA 3DOUA 2Q5QA 2V6IA 1DBRA 3VNBA 1RYDA 3H3XA 4F5WA 3PX7A 2ZZNA 1L3CA 3BAZA 5AHWA 1CUZA 1WVMA 3BIOA 3FZYA 3HCDA 4EGSA 1L8XA 3GR6A 3GX1A 2Z43A 4L5JA 5HSGA 1L9XA 3NZEA 3UK2A 2H4JA 5DISB 3VI3B 5DT2A 3NH6A 4Q01A 1LRKA 1CY1A 2NU7B 2W83A 4UMEA 4RESA 4Z8XA 2FFQA 2LTAA 2QLNA 1VLQA 4CNBA 5C1DA 4Q9IA 2EIHA 2O57A 2ZUTA 4MS3A 4EPYA 2WMNB 2JLBA 1NU8A 4A1OA 2A30A 1NPYA 3JQ9A 2Q5EA 4MVJD 2JAHA 3B2EA 3QVMA 3N2NA 2C5FA 3B8EA 4LJRA 1JHPA 2JPDA 2OB2A 4BMSA 4ER0A 4ON9A 2VSNA 3L7IA 3VKGA 2GNPA 2G63A 5L53A 3C45A 1MX3A 4GXQA 4GEKA 5FQOA 2AI3A 4K6FA 1Z7GA 4CCSA 4DQ0A 1DQSA 4MRRA 4YUWA 4A2QA 1F20A 1STOA 4AVYA 2RBKA 3MRTA 4DIEA 3WNQA 2VJAA 5A5FA 4A92A 1WV0A 1KZYC 3C3CA 3U9LA 2X0IA 3IGFA 1CW2B 3U9SA 1FSGA 1IZYA 1D5CA 2BSXA 1ILEA 3D2CA 4DJAA 1FMCA 2X13A 2W6JA 3D7KA 4KSCA 5AHXA 3RLIA 3RVKA 3SXUA 3TJMA 1DBQA 2QTLA 1G2OA 1TK2A 3H2YA 3HABA 1FZQA 1RBZA 1Q7EA 1VHJA 2JD2A 4LNAA 4PPFA 1CIJA 1FBNA 5HF9A 3RS2A 3FLEA 4X45A 4CLOB 1H5NA 5CLLA 4NNJA 3KZ1E 1U6IA 6Q21A 1LH0A 9ABPA 3FWPA 4YHBA 1KVRA 1ULSA 1OFVA 2DUNA 3PTLA 3P26A 1QYIA 4A2CA 2W2VA 2Y05A 2VPIA 4NSNA 3T7IA 1YUMA 4DUGD 2OLJA 1RMTA 2VF4X 2R7KA 3PDIA 4KQXA 1XVLA 2BPOA 5A6SB 2BCJQ 3RYHA 1H1LB 3W2IA 5JZOA 3HDHA 4HATA 1P2TA 5AOVA 1EFHA 5IHPA 2GBCA 1XDBA 3AWDA 3W2EA 2JFXA 4R3NA 3GPDG 4J2TA 3EVDA 1JQDA 3OCXA 1CUWA 1UXHA 4N82A 4H18A 2YWXA 3U7JA 2Z6AA 1Y82A 4YQFA 4NC9A 2FY8A 2GTHA 3F78A 3LD9A 4R31A 4V24A 2I7DA 3GA5A 4P3KA 5IMBA 4M87A 1Z5NA 3X2EA 3LPLA 1ICEA 3R4CA 5BUZA 4GQBA 2WTXA 4Q02A 2V54A 2P1RA 3AXSA 3P1JA 1EX7A 2BI7A 4DE5A 3GL9A 3H2SA 2WG1A 1N1MA 4KI7A 1ESDA 1P4SA 3BMCB 4ZHQA 4RPIA 4YV7A 1G3MA 1XE3A 2I7VA 2R1TA 2YC4C 3QHPA 2IZ0A 3LAWA 5FTMA 1DB3A 4R3UC 4ZEXA 1P7PA 1OUMA 4K05A 4PAOA 2C29D 3OWHA 4XTCS 3KJFA 4JLMA 1AD2A 1ENOA 2G9RA 2W93A 4RYDA 5KNDD 3N7TA 1PT8A 3G13A 4H35A 5EIFA 2KBEA 4JGBA 1IN4A 4LJ9A 5IXJA 4W5TA 1M72A 3Q5EA 3ZE0B 5KYUB 3BXEA 4N3BA 5JH7F 1WDMA 3B51X 2NO5A 5DWDA 1J2UA 5E1DA 5FPYA 4WINA 3H87A 2PUWA 4Q00A 2JIOA 3I9LA 5B30A 2KW5A 1D1QA 1N1GA 2BTOA 1CJUC 4G1CA 3E7XA 4Y18A 1AQJA 3MHPA 3CZQA 3UC5A 2FMUA 4D0SA 1E7MA 5LZ9A 2PIAA 4CIDA 1KS2A 2WE8A 5DM4A 1E6MA 2DYKA 3AETA 1AQNA 3WGTA 1C9JA 1G8FA 4IKOA 2RC6A 1NYLA 4ZEOA 4ENPA 1RJWA 2C3OA 4IMRA 3UHOA 1N6NA 4JAVC 2FVYA 2CGEA 3P0FA 4PYRA 1YK0A 1PJRA 3C8HA 4I9UA 5ILQA 4F3YA 4NHEA 5KYWB 4DJTA 2ZYAA 3HBAA 4MGYR 4YBRA 4UPVA 4QPJC 4BV9A 1A4IA 4LG1A 4DM7A 4B7UA 2FDCA 1CZLA 2JJ8A 4DLXA 2XGMA 4HUQB 4ZZIA 1CQPA 2VAXA 3QELB 1UZLA 3MZ0A 5IP5A 4JENA 2XW6A 1SQ5A 1Y89A 1Y1TA 2WT9A 2UZIR 4MRSA 4EO4A 1DRVA 2GESA 2R68A 5E1BA 1LBSA 1TMKA 4LE1A 4TSFA 4MQFA 5G0UA 1U3CA 5AVOA 3V2IA 1JX6A 3A4MA 1ID8A 3R5FA 3GJ8A 1T8UA 4NHOA 1K8QA 1N25A 1SCQA 2WYUA 4HK4A 4L7VA 4WLFA 3TGLA 5EL0A 2VA9A 2YHAA 5G53C 1E5QA 4E94A 4ZI7A 4LRQA 4EIWA 4BB5A 1GKIA 3AZOA 3QPVA 3WZLA 4LMAA 2DMRA 2O2SA 4M9ZA 2BELA 1X6VA 4LE0A 1ZIPA 2AMFA 3JZFA 5DHQA 1QR6A 3UJ6A 3HXMA 2UUCB 3ZDXB 1ODJA 4REOA 2J9GA 4H6XA 4A6DA 3VTAA 1T4BA 1I1NA 1TYBE 1JLSA 2WM9B 2CHVA 4C4OA 1QYRA 1PYGA 3TE7A 1WKVA 1GIAA 2PGLA 2ZAGA 4WOPA 3GEDA 1SKYE 5B6PA 1J33A 2ANBA 4GICA 4X95A 4ZI7F 5K8JB 2GN4A 2HRZA 3GRZA 2FKAA 5LMCA 4GL2A 2RHWA 4KO8A 4MQ5A 3I05A 3TNYA 2OECA 2ZBQA 4OH1A 3HFGA 4HS4A 4E31A 3SVLA 1J8MF 1YJAA 2AMVA 2JCYA 4NATA 2JHCA 2EX4A 4LY6A 4Q16A 2V65A 4KXYA 4J0GA 4RMIA 1WP4A 2INGX 4WNAA 3UAGA 2PQ6A 4PPNA 4F4HA 5AW8A 4UFOA 4EJSC 3Q3JB 4AMBA 4A23A 1AK2A 3WMXA 3KL4A 4J1NA 1XLWA 1KH1A 1GKKA 1MAHA 3THOA 1X7ZA 3ACDA 3AINA 1QMPA 2BRUC 2R8XA 4I6EA 4AF8A 4FNOA 4BNDB 4A26A 2X2EA 1E4EB 1E6EA 3AJDA 5K2MA 3AT1A 3UENA 4DJEC 4EWLA 1ORHA 1IM2A 4ZYXA 3RTBA 3GFTA 4A0SA 2VVTA 2VO1A 4S35A 3MXOA 4AP6A 2C94A 3A6LA 3AV0B 3TDMA 2ODNA 4BNNA 2HTEA 4D9EA 5IVHA 1IC6A 4EVRA 4UDYX 1FVHA 2LW7A 2E4XA 1OSNA 1L7QA 2X0NA 4L8LA 4QUHA 4AG5A 3DWEX 3ICWA 3PDJA 4RNCA 4A8TA 4AY3A 2IUEA 1JEQA 1MJGA 2FJ0A 1XJ0A 1XNJA 1ZJ5A 4YDQA 1XP5A 2IDKA 5E3IA 5FYDA 3UAYA 4JI7B 5JBIA 2A1UB 2HLDD 3H7IA 1RYEA 2HADA 3IELA 4XWWA 1UJ6A 4F12A 4AURA 2YASA 2G25A 2ZSBA 3NPMA 4GO1A 3UWMA 1XELA 1UBFA 4NYJQ 2N0SA 5HS4A 3L4KA 4WESB 1M83A 5GONB 5LQKA 1JU4A 4I5GA 1EFKA 3TK1A 1AZTA 4XD2A 3GLGA 2P41A 2ABWA 4HPWA 5AQ1A 5GP1A 3FGNA 2OG1A 5ANRB 1TF7A 3I34X 5FFFA 3IAUA 3ZBUA 7ABPA 1KPGA 1QHXA 4P8RA 2OAQ1 2V4UA 4AJ9A 3K0CA 3RSQA 3SG0A 2CLFB 2GFQA 3KYIB 2V0GA 1ATZA 1CUYA 1LS1A 1P0FA 1OYWA 2VSXA 3DV2A 4KYVA 4P93A 5FFNA 5CX1A 3ZLJA 1GL7A 1R0BA 1V41E 2WZDA 3BMXA 3C5HA 3ET5A 4XGNA 5CA1A 5JAIA 1JHZA 4OHUA 3MWDA 2H52A 3IX7A 4X24A 3FCXA 4ZIRB 1N5KA 3AHDA 4PIVA 1DU4A 4BO1A 3FHTA 3D5TA 3KEMA 1HYEA 4Q4DA 3VHRA 5J23A 1Q3TA 3SHOA 4RK1A 5EN4A 2OV2A 2CXQA 2C58A 5EXSA 4EX6A 3C14C 5L3SB 5COBA 2CHFA 1PSDA 2CL7X 3CT6A 2AC4A 3JR3A 3PFCA 4JR0A 5LXTF 2O54A 4UVHA 4BP1A 5BOSA 2B1QA 2QGNA 2GJSA 3I5UA 4V0RA 4I8XA 5DYIA 3PSHA 2AS0A 2QN9A 5EGNA 5CA1F 3GAFA 1UC9A 1GU1A 2G5TA 5EIEA 4CKYA 3AKYA 3RRMA 2XH8A 1XTJA 3IUPA 4MUJA 5C51B 4G1BA 4UZFA 4ZI2A 3L05A 3ODPA 4J3NA 1C9KA 1QOQB 4ADSG 4R40A 1I6LA 4A5SA 2QN3A 4UZEA 1JHQA 3ESZA 2IBSA 1C4KA 4Z1MA 2V6JA 2Y27A 4JB0A 1C1DB 1WW2A 1ZGHA 3GT7A 1QDLB 3N39C 3O8OB 5IULC 1DWPA 5BV0A 2AXPA 1FVFA 3W9SA 1QPGA 2Z2JA 1M0EA 1IJKA 3JPYA 4TV9B 5BN4A 3AERB 3HB1A 2ACWA 3AP2A 3ZU6A 1XZDA 4FFSA 4RWEA 2VA8A 1Z2OX 3PDUA 4NAHA 4MYUA 5BMVB 2QVCA 1ZUNA 4RCVA 2X4LA 1FNSA 4PZUA 3I5AA 4FEAA 4MWZA 1CVLA 2IP1A 1Q77A 2C95A 2XWJI 1XCBA 1LGYA 3JTMA 3MTGA 4Q21A 1T3LA 2X5KO 2YV5A 3KYCB 3O0TA 4PGAA 3VR4D 2UU9B 4AY5A 4EKNB 1JAHA 5FOWA 4MW7A 4M3NA 1E0SA 1U3FA 1RKQA 2E4YA 2HY7A 3C4JA 1V7CA 2EDCA 3LM8A 3TTSA 2PUBA 1KYVA 4DQXA 1LVHA 4TN1A 1USKA 2CB0A 4D8WA 1C50A 1QIKA 4PO8A 2POCA 4A6EA 2FFRA 5HMMA 4OLBA 1ORDA 4QPZA 3CE6A 4GMHA 2CF6A 1CZNA 1OW3B 1VDZA 3GJSA 3B5JA 2OY0A 2G09A 4MQLA 2P3OA 4BP3A 1C41A 5KTTA 4BRSA 4BX3A 5KTNA 4KHPB 1NSFA 1IAVA 1KU0A 4CL2A 1TQHA 1Z36A 2ZEJA 4IEIA 3WBJA 4FE7A 3T5AA 4ABTA 1KEWA 4LXHA 2VJNA 2G88A 4AZTA 5GIPE 3Q1KA 3QPCA 4KQ9A 3MJFA 5FV7A 5IBQA 3IP8A 4J7CA 4JT2A 1T9GR 3GRFA 2CXHA 2XBUA 3OIYA 3H1BA 4JA0A 4JP5A 4B82A 4KQ6A 3KV3O 2QQEA 1PZEA 4POAA 3BXPA 4PS1A 4F6RA 1UJ2A 2H5LA 3H42B 5LBTA 4Z2YA 3AU9A 3OE5A 3B3JA 4JFRA 2UXBB 4L0MA 3MTQA 1PJ3A 4MO2A 1I80A 3JAMA 3IVGA 1V71A 4GOLD 1JMKC 2PD3A 3NHZA 4KQKA 3F1LA 1QV7A 4HF7A 1OYYA 4MR9B 4N4AA 4QBIA 2CMHA 2JFFA 3TRHA 1KKLA 2CV0A 3IUSA 5DCYA 1JKXA 2ZT8A 2XOEA 5EQFA 3WG9A 1IBMB 1O6ZA 3KKQA 4FMCB 4IO0A 2P2ZA 3IO5A 3VOSA 4PZPA 3Q6NA 5E4TA 4M7OA 1DV2A 2NACA 1FTGA 2VT7A 3AHHA 3NQ41 3M4JA 4XFJA 2BFPA 2WWVD 3T5TA 5BR8B 3MCWA 4YT5A 2HXYA 2BZ0A 1L4KA 4Q6BA 4YJHA 4YLGA 5F1PA 3C4QA 1UBCA 2VDMB 4S1OA 5IT4A 1MD9A 3G23A 4ER6A 1E0KA 2BM0A 3PC4A 2CJFA 4J1TC 5AI6A 2JATA 4QDXA 1OI4A 4ZQIA 4ZRMA 5TX7A 3R7FA 1DDIA 1JJFA 5C46F 4G26A 1WZCA 3E9CA 3OOWA 2OCBA 4YMLA 4F9GA 3IUQA 1HOXA 4F11A 3TW0A 4CMBA 2HA3A 1UBSB 4CQMA 3RODA 2WTUA 1ZR2A 1ILWA 1A9XA 2CB9A 4LYYA 1NVVQ 3EFEA 1AGYA 1EFDN 2AA3A 2UVPA 4I9FA 4M1EA 1UBNA 4L7QA 2G0TA 1G41A 2OENG 3V55A 3T4XA 3ZDYB 4NDZA 1L3IA 2FEWB 4QUGA 3ES9A 3X1JA 3QWBA 3HVRA 5FPHA 2PLFA 3G68A 3QE9Y 3ZH2A 3HJUA 2GZ3A 2II6A 2XA1A 3FPEA 5AKKA 2VNKA 4UM5A 2ZUSA 4HH0A 3BXOA 1KTVA 2GCOB 3I6IA 4G24A 3RO7A 3E4CA 1IZ7A 2ZJ3A 3CRVA 4MP8A 4Y0AA 1PK7A 4DCNA 4DLYA 3N0RA 2QMZA 1W88B 1CPYA 4PXSA 5DWQA 5K3FA 2JIQA 2VZLA 4CETA 1JH9A 3HXLA 3THYA 5DEIA 3WGHA 2J6BA 3DVAA 3CKKA 2AW5A 3H1TA 4N5NA 4D5EA 5JMTA 2DPGA 2FETA 1NVKA 1UFRA 4AUNA 4IV0A 1EK6A 1GG2A 1SVIA 4GF5A 4IOMA 4QXMA 3UT5B 1B0ZA 3H4MA 3K9GA 4CUJA 1ZGAA 2AR0A 2OE2A 5JROA 4H0NA 2YN2A 4ZU1X 3ZCPA 1UL1X 2WUFA 3EPPA 4C78A 2OBYA 5KOJA 2LD4A 2P2DA 1Z2DA 1DBWA 1GUAA 1VSUA 3PPVA 4AZWA 4CLRB 3GP8A 1N34B 4PAMA 2XSZA 5D00A 1PO7A 3JD0A 3CV3A 3EXHB 4PC6A 3WB0A 1P1IA 4OP1A 4CV1A 3ZD6A 1GAJA 1E1DA 1Q0SA 1VP3A 1X1RA 4MQBA 1O4VA 3F5QA 3LKVA 4ZO9A 2OXRA 1KC3A 4IF4A 5JOQA 2F00A 2WUEA 1UJMA 2AEEA 2D7JA 2YWFA 3N8IA 4J3JA 3BMOA 4U02A 5KC8A 1P2BA 3SEQA 4ZZ3A 1LPSA 2Y92A 1HFWA 2FAXA 4ECAA 4MUHA 1YZYA 1TIBA 3NWEA 5LFAA 4B6EA 1XDSA 2PXAA 5CITA 1T3GA 3W7BA 1ZOPA 1FFBA 1LK5A 2DWUA 3WHKA 2WVJA 3PNKA 3PQ8A 1LPBB 2OHXA 4ZXFA 1E2GA 1VBNA 2REQA 3IKLA 4XIGS 4IO1A 4OLJA 1T9BA 2XOXA 3LX8A 1I4EB 3JVIA 3B8HA 3LNTA 4U5XA 1L7XA 4FFWA 3SNKA 3UMGA 2QM0A 5CXXA 1JIUA 1IZ0A 2VQ6A 1U3WA 3SY8A 1EBUA 4DR4B 2QUZA 3LVFO 3CWCA 2VHQA 3SE0A 3WDKA 2JLXA 5K0TA 5HXAA 1R7RA 4TMWA 3D3EA 3GI1A 4YXWA 2QZ4A 4WBNA 2XZOA 2I1WA 4A5OA 1DLIA 4GXTA 5BSMA 2XUZA 1HDYA 5AW1A 1V37A 4FS3A 2VLBA 1LWOA 3GJZA 2GH1A 1IQPA 1N5JA 3KR2A 1QF6A 1KO8A 4BJ3A 4NCKA 4YY3B 1BCRA 3EIUA 4IJQA 1W2HA 2FW9A 1G18A 4QBHA 4Z0NA 2HL6A 2QVZX 3FXAA 1ZNWA 2XODA 1CQWA 1MFZA 2V9CA 3QVVA 1RHMA 5EWJA 3URKA 4ZYTA 3P2OA 2F9MA 1TQ8A 2VN8A 3GRAA 4JJEA 1PZMA 2JARA 4JYCA 1RJ9A 2BONA 3D81A 2IEIA 3WWYA 1II8A 2VUTA 1CUVA 1EFRA 1HBJA 2V98A 1JAXA 3WHLA 4ZD6A 4DLAA 4XQ9A 4EKGA 3O4HA 1HM5A 2IPLA 1DCMA 3H65A 3QV2A 4ZQFA 1C1YA 5I3CA 3FOAA 3FDZA 3WGJA 3FTPA 2VYFA 2H9IA 1XWIA 4M2LA 3QOFA 4MULA 4PV7A 5TR9A 3PCXA 2GT1A 3GOQA 2WYHA 3BE5A 2V7QA 2VZ8A 1NN5A 5LA6B 2W2LD 1A04A 2IP4A 2Q5OA 2W6IA 5F21A 5LVAA 2JJ1A 1OA1A 3H2IA 2FWNA 2WBLC 3DE0X 1YU6A 1JRLA 4UE3S 1GA1A 5GM1A 4UHBA 3PUJA 1XSEA 3DOCA 3OFVA 3TXYA 4YP9A 4D4HA 1FP7A 3GH1A 4QODA 2WIJA 4RSMA 1FVOA 3EDOA 1VECA 4W9RA 4P2BA 4X20B 1HWYA 1LPAB 2PT9A 2QRHA 4G5HA 5AJYA 3KEFA 3RANA 4L0DA 1SD1A 3ENZA 3KJEA 4IEEA 2MJLA 3JQAB 5DM60 4CMIB 1XZPA 3JSXA 1KDPA 2VXBA 4PZCA 4Y1GA 4RZIA 4DQKA 4AECA 4RVFA 1Z8DA 1IBCA 3M5CA 3G2HA 1M2WA 3LBYA 2EYQA 3OOYA 1L9KA 4LOLA 1VMAA 4G84A 3MTAA 3WNVA 3WTBA 3SR3A 2OMKA 3DPIA 4LC9A 1G2QA 2HD4A 2X7XA 2O05A 1R4ZA 3KU4A 2IBTA 2BR3A 3WVNA 3Q2IA 2V6MA 2JI7A 5EJ2A 4U2BA 3ZLBA 4GYYA 4MDEA 2XAUA 3JQ8A 3KKLA 1CBUA 2OZEA 4AWAA 1ISHA 4KQFA 2A67A 3V32A 4RD1A 1R0YA 1PGNA 1EWVA 1WMEA 4L6AA 4G8DA 4OK6A 3R7WB 4HGPA 1M1NA 1RYYA 4IDPA 2BGRA 2QMEA 4FBMA 4FSXA 4UUBA 1NR1A 4ENQA 2Q27A 2YJ5A 4FYWA 2GPYA 3MQFA 2JG3A 4KBGA 4L85A 4OFXA 5HKKD 3ZZMA 5L4NA 1WUYA 3PHCA 4MA5A 4G5OA 1NI4A 5CIWA 3DCYA 3ROGA 4D6YA 3G85A 3NETA 4ZOAA 5HKBA 5C8DA 2NVBA 3T5CA 3R0XA 3AVWA 4S1WA 5CLIA 2NU9B 3O2JA 2O0KA 1YJ8A 5EXPA 1Z47A 3P2JA 2PWBA 4ALJA 2B9EA 2GEJA 2R96A 1HE5A 3HEAA 2VDRB 4LVOA 5ENDA 2G8NA 3DJFA 4MV4A 4AJOA 2GJAA 1QDEA 4Y98A 1KMMA 2YFQA 3AIMA 1Z7WA 3HJRA 3UJ9A 1S4MA 2QG4A 4COOA 4UTVA 1RACA 5ALWA 5DU2A 2H11A 5JZBA 1L4YA 3C3DA 4J4TA 4BO8A 4KFCA 3ER8A 3WGQA 1SCNE 1XAIA 3HPQA 5CJJA 2FGKA 3ZD7A 3SI7A 1QH1B 1X7WB 1E8MA 2RKWA 2WJ6A 4GX2A 2WAYA 4XWYA 1SELA 1W5TA 1LDEA 1YRWA 2OQ2A 3CH5A 4MWOA 4PC3A 4W9NC 1NMQA 4BB0A 5TS3A 2NWQA 4Z4CA 4RK4A 5HBGA 4KSYA 4XSVA 5B2FA 2FSHA 3M2TA 2AG0A 2ANCA 1DJOA 4XDYA 5JI2E 1EVKA 4KTVE 2DFNA 1UQTA 2CXNA 3TQOA 1P0QA 2ATIA 4IDBA 3BQNB 3IBSA 4BNIA 4PHCA 4G3XA 1M2KA 1J25A 2W6ZA 5BNIA 5LIRA 1E7QA 3OM1A 4CR8A 3HVKA 3MJEA 2FTKE 1OXTA 3V4RA 2ORYA 3PGKA 4QTYA 1KJQA 3NX4A 1QHFA 3ASUA 3E8XA 3QXCA 3VO8A 4BWFB 1T9DA 1VFPA 4NONA 1Z6YA 3TVTA 3IUYA 4BMCA 1XLVA 1WS6A 2H85A 1Z38A 2VK2A 4ZZ1A 4BNXA 4D9BA 3IAEA 4WWHA 4EY4A 1N5LA 1G5PA 1QV9A 1ZESA 1ZINA 5E3JA 5A3VA 3II6X 4JJ4A 1JQLB 1W0KA 1XMJA 2DECA 2VHJA 1T5OA 3PJFA 1HOTA 2GHIA 4C4XA 4OU5A 1TGVA 1LUAA 3WRXA 1P4HA 3ABSB 4BVJA 4FEGA 4IMJB 5G1OA 4QQKA 1KI7A 1R8SA 5TF0A 4ARVA 3WADA 3FYTA 4LFCB 3LQFA 1ZD8A 4OP2A 3VH2A 4W7SA 1OFIA 3HA5A 1K2VN 1EM8B 4V0KA 1W1UA 2W00A 3ELUA 3BX1A 3ND8A 2Y1DA 4OYYA 1OLUB 4RY8A 4I4CA 1XVVA 1ACLA 2Q49A 4FD3A 4J3FA 2VDOB 5J58A 3L40A 2J0SA 3BFVA 4I9NA 4M76B 4Z4IA 2D62A 3CZ5A 4LYDA 3ONNA 2C0QA 5L9AA 1DIOB 2E1PA 2RARA 3QBJA 4RL6A 2FE4A 4CMEA 3TLAA 4CWAA 4Z7NB 2PSFA 2FQYA 221PA 2C07A 2GF2A 3I01A 4Y9TA 1UBEA 3IVRA 3U9TA 2QI9F 3U7FB 1YRYE 1WY7A 4CEHB 1YZLA 4D6PA 5GZ1A 3KQWA 2A0XA 3QI2A 4ZQEA 2O48X 2BDEA 2X3YA 5I8ZA 1RQLA 4F45A 2IBMA 1WCWA 2VXYA 3FOCA 4RELA 3FNEA 2SNIE 4AMYA 1NVBA 6YASA 4GKKB 2X8LA 5IT9A 4AO8A 4BZPA 1QU2A 1J21A 3AUTA 5EQDA 3TQIA 4PX2A 1EK1A 3RQIA 1QGED 2F6RA 3MYRA 3OHPA 1EAMA 3BQMB 1SZJG 4EMUA 1WXDA 1CZKA 4ZVRA 1Z26A 3OQIB 3A1VA 3JYOA 3N2KA 1CR4A 5AI9A 4RO0A 5BSTA 5LIPA 3NM4A 1E64A 2E4VA 3OZAA 3D54D 5ALUA 1GPWB 5LKRA 1E3TA 3IPXA 3INGA 2VFAA 1RWBA 2CWWA 2PMBA 2IXBA 5FIUA 1YUNA 4YP6A 4D82A 3G89A 1S2IA 5JCZA 4YUZA 1QOZA 4N3AA 1UPBA 3U13A 4G37A 4B6OA 1UDXA 3OOEA 2FK7A 1I2MA 4UUMA 3FNFA 3VA7A 4YJ3B 4X8MA 3LWZA 3NUQA 4Y2XA 1LBQA 4MQUA 3LKZA 5FBLB 3DDUA 1N8TA 3CLSD 3UNXA 2FZKA 1NN0A 1VA5A 4PSVA 1T0PA 1FMTA 1QF9A 3WDLA 3RRBA 4YRKA 1TIKA 5CH3A 3K9BA 3LRPA 4DR5B 3A4TA 2VJDA 2FJUA 4BKOA 4RDIA 3MJDA 3LTEA 1GG9A 3HDJA 1GU7A 4BPRA 4Q19A 3H8SA 5DYYA 3DEJA 1VTKA 1YU9A 3OEEA 2ASEA 3ASZA 3UN1A 3ZKWA 2B6NA 4F9TA 1TYAE 4HOYA 3NM5A 4EUHA 1UK8A 4LOKA 1ZH6A 5JS8A 1XZJA 2CNDA 1MCZA 4JFAA 1O95A 2GTIA 1ZITA 2Z8XA 4U4AA 1QTNA 2JH3A 3UUEA 3JYHA 3CURA 3PC6A 4MB2A 2O1SA 3RWMB 1CY7A 4FN5A 4NNOA 3U3JA 2Z56A 1V3UA 2FW1A 5E9AA 4I6GA 5B53A 1JBKA 1AE1A 1GFSA 1O9BA 2HYDA 1YWGO 2ZITA 3MW8A 4XGIA 3EZGA 4LOIA 4C4YA 1YOVA 4IMPA 5KQMA 1ZSNA 3B3AA 4HZUB 1G5TA 4AMUA 2EHDA 5HM6A 1L5OA 1H23A 1Z18A 3KSDO 4K9MA 1DTEA 2XWBF 3OCCA 5ARCA 2XNDD 4BMNA 4EKYA 1UJ4A 3DOHA 1FQWA 1NW9B 4NAUA 2D13A 3OQJA 2WU0A 2CFSA 4I1YA 5EESA 5LDDC 1E2JA 2GVNA 1XRRA 4MAFA 1E62A 3OQHA 4C7OA 1GJRA 4OI1A 2X1MA 4XLTA 4FCWA 4GRAA 2J45A 3WLJA 4QYXA 4ARZA 5IMSA 4GXNA 3ISTA 2ZAMA 1VPVA 5K0JA 4RXTA 2EYUA 4BO3A 4B0OA 3JATA 1OWOA 1XEXA 1LPMA 2FE1A 2EATA 2JDIA 3Q5GA 4MJ7A 4PU0A 4PZZA 5KVQA 3UKDA 3RD5A 4PSUA 3TEJA 1M10A 2FW7A 2HHJA 1GTSA 4RANA 5JSYA 3LUKA 3QLEA 5JO9A 1Q5PA 3JALB 1QHGA 3GAMA 2OXEA 1Z2NX 2ZKIA 5A7FA 5I5EA 3G0IA 4CBVA 5IVKA 2Z1MA 3GLHB 1KDTA 2NPIA 1OX6A 3LYHA 1I30A 1FW8A 2C20A 1KDRA 1C2YA 2QUKA 3HVJA 1U9JA 2EGHA 1OC2A 1XLTC 2O7QA 1YC5A 4HQNA 1JVNA 2JCSA 4OYHA 1T0UA 4RUKA 2SKCA 3ZE8A 3FI0A 2BEWB 1ISRA 4UC0A 1Y5NA 3IOBA 3NBZC 1YBHA 2DCUA 1SXJE 3DT9A 2YJNA 3LFUA 1UXOA 3HJAA 2OESA 3NT4A 5I48A 4L72A 4CL8A 1QCZA 5U4QA 4C6SA 4FHGA 4XD7A 2GXSA 4Z1OA 3BL6A 4Q4JA 4UXIA 4R8RA 5IHXA 4Y2YA 2E7ZA 4YI5A 3C3YA 1RHKA 4I1RA 2IYPA 4UD6A 3T1QA 1T26A 1T5TA 1T1EA 1Z5GA 3ZDQA 2AYZA 3KP1A 3WBFA 3UCFA 3I1YA 1MJNA 4DL9A 3MB5A 2ALJA 2PUHA 5AVRA 4H0CA 5BWLA 4DJJA 4EBFA 2NYVA 1Z33A 3WMGA 4RTQA 3PWSA 3QYJA 2RBGA 4M36A 1G21E 3CCCA 1V0JA 2IZ7A 2WAXA 4Q93A 4XFKA 5IFKA 3BTOA 5JAZA 2OBNA 2G9NA 3SQWA 4OBWA 1G21A 1I36A 4P98A 4V2IA 3WYNA 4ASUD 4D9NA 4LI3X 2OLEA 3NHMA 2YXEA 1QJ4A 2D8MA 1Y9ZA 2IYNA 4PLCA 3LVRE 1T2DA 4BE4A 1JNYA 2CD9A 4L3WA 4CMKA 5IF3A 2XPCA 1SBHA 1FFGA 2I62A 4L4UA 3ZLVA 3OCJA 5JJ5A 2Q45A 3IAXA 1Z5PA 3GFRA 1G2PA 3OHMA 4FFNA 5KWJA 1JHXA 2QX6A 1CY6A 1DSSG 1JXMA 2W2KA 2W6QA 3MMZA 3HHEA 3N0XA 2I78A 4S12A 2UZAA 2F43A 5FO0A 5K8IA 1ADGA 4A10A 1TC1A 3IP1A 4RHFA 3VR1A 5CNMA 1NXQA 4HB3A 4XX0A 1F0KA 4K7JA 4B40A 1VSTA 2BGKA 2IE0A 1NQWA 3REQB 2FWPA 1R9GA 3V2GA 3WBBA 1D9ZA 2CHGA 4BFVA 2IYVA 4RF3A 1EX6A 3WY9A 1NAIA 2IRWA 4JLJA 3MIZA 4C0LA 1N1EA 1EHIA 4JT4A 3AEYA 5JNVA 1KWGA 1XMSA 4H1VA 1EFVB 4UJ5A 1ZN7A 1X92A 1YE5A 2F3UA 2NZWA 4MJXA 2ID9A 3T95A 3E84A 4IRUB 1LSOA 3U16A 2AI1A 4NABA 2D4HA 2J0QA 1NOIA 4H16A 5IASA 3R09A 3VSDA 1J56A 4EAQA 2XB6A 4FGWA 2VJPA 3D8UA 4ED9A 4IKEA 5JXHA 2XMZA 2PUVA 5ALRA 5IZCA 1J8QA 3U4QB 1YKGA 4QARA 3TMAA 3L3BA 5J59A 4MLCA 2HGZA 2PT5A 1KWKA 4G0VA 3A1UA 4RY0A 3EG9B 2VYVD 4A7PA 2OCIA 3GJXC 2Z2KA 1NVTA 3K4QA 1BE6A 2PX4A 3CR8A 2ATVA 4IHJB 4JQOA 1WZEA 5ESRA 4YJFB 4HP8A 3S1AA 2PHZA 3R4VA 4IL5A 4MINA 4JB8A 3B1XA 3ZV7A 5JHHB 2DPXA 3STUA 1CVRA 1KEEB 4KODA 4MWTA 5EE0A 4A8PA 4G41A 1BXRA 4OIFA 3LPAA 2Q8QA 4CXMA 1N8KA 4UE2A 4ITVA 4KQJA 1L4FA 4UTNA 3OE4A 1DG1G 2Q4EA 3O82A 3ZZ1A 4BBAA 1D4AA 2XRYA 5BQ3A 5HOQA 1TO2E 4HYYA 1AKVA 5IBCA 3KTAB 3THWB 1E9SA 4KO2S 2QJTA 3ESQA 4F21A 3EA4A 3Q3IA 1VJ0A 1YR1A 1C8BA 3DTVD 4JGIA 3QVOA 2Y1GA 5K8TA 1X7GA 3INTA 4MHSA 2O3SA 4MV0A 1GQ2A 2XTJA 3PF9A 4JB2A 4EYOA 1YULA 3C1UA 1VKNA 2H4FA 2OQRA 2PCLA 4KR7A 5K0GA 2HU2A 3DJYA 1Q7GA 4O4HA 5KYKA 1TJNA 1ZKMA 3EFOB 2NSLA 1HT0A 3HNPA 2B1GA 4BFYA 2IS4A 3ESAA 2EBWA 1AKWA 3EIWA 4OKSA 2ZE6A 4TMYA 1HT2E 1CDZA 2AYXA 3JASA 1HYGA 2VP0A 3OECA 3I2YX 2FCRA 3HO8A 4RVNA 4EF5A 1RM4A 3FGOA 3A0UA 4NE7A 1N2JA 2ZJFA 1M1YE 1GUDA 3PFHA 3M9LA 4X6XA 4FMDB 2O2YA 3U19A 3I3SR 4WDQA 3UHJA 5FCDA 1ECGA 4I50A 3EBOA 1Z28A 1M1YA 1YJBA 1XQWA 2HA0A 3MRSA 4GE3A 1WTAA 2AQ8A 1ZM3A 1WPGA 4GMGA 5EXDA 4O4HF 3RQSA 1AMNA 2WRZA 2QLJA 4ZXPA 5EUMA 3RRXA 4IWXA 4XRRA 3R9XA 5LMNB 4KLNA 4B3RB 2W7TA 1UBOS 3KXIA 3B78A 3ZXUB 1P1BA 2BFFB 2O8BA 3PHLA 4M55A 1E2IA 4EARA 2AXEA 2B7BA 2HW8A 2IYZA 2OHOA 3BMQB 3GT0A 3WB1A 2QXTA 5ERYA 3QKIA 2CUKA 1QV6A 3LZDA 4DSAA 4I50F 3UHAA 4UAUA 1XKQA 4MITA 1E3WA 2DP4E 1NYQA 3FCEA 4LQCA 3M4ZA 4F56A 4BLRA 4NV3A 1V8OA 3GJ5A 4OHXA 4YAIA 1EDEA 3CGGA 2AFVA 4MROA 4BLTA 3C8ZA 2ZT5A 4LNHA 2MOKA 2O2CA 1SEPA 1XYYA 4ZOLB 7REQA 3S7TA 5ADWA 3ZW7A 5T8KC 2W98A 5GVSA 3VRHA 2CLCX 4Z5XA 2FU5C 1Z0DA 1PLKA 1KYQA 2DEUA 4EZEA 1R0KA 4FR2A 2YMPA 3H5WA 1E1YA 1IN5A 1H2BA 4W5OA 3F73A 5H80A 1TKAA 1EEXB 3TD9A 1DJNA 2F8MA 2PRJA 3ZHZA 3D8HA 5MN5A 3AL0C 3ZTTA 4PG5A 3VZQA 1JIKA 2EJBA 2XMSA 4C0JA 5HIJA 2JAPA 3KAQA 4CKXA 3H1GA 1UKAA 3ANXA 2JGLA 1WZIA 4D46A 3K6SA 3OM0A 4JYZA 4YRSA 3L7MA 3TIGA 3TEFA 4EJFA 1DWQA 2A0FA 1HLDA 1L7NA 2XCSB 4M54A 4FXOA 3GJ3A 4WJZA 3O3MB 3PC8A 1OHHD 2ONJA 3GOHA 5BNTA 2WHEA 1VL8A 1H85A 4BO4A 2D5LA 4CN9A 1N3LA 1QVVA 4FCVA 3GD5A 4XM0A 5CH8A 2PXHA 4FLEA 5M3BA 4XWGA 2QLMA 4KPGA 4RCZA 2C7RA 1DJPA 3LPCA 1N5RA 2GJKA 3OMLA 5K3BA 4DCSA 3HUFA 2FZEA 4Y2TA 2O5CA 3MNFA 5IABA 3LNCA 4B3GA 2GPBA 2LV8A 3CS3A 3ZWXA 4LYAA 4FWTA 1FUIA 2JAQA 5JY6A 5F5LA 3U7RA 2GCIA 1MGOA 4CFYA 1Q20A 2B83A 4H4DA 2VAWA 2J9XB 2P2LA 4NG4A 1U3DA 2ZJ4A 4MS3B 4ZVPA 3BGOS 1WTCA 5GINE 3GVXA 2OM2A 1CRQA 5IVIA 4CTJA 1H2FA 4Q1BA 3BRWA 4HR7A 4QOGA 4D41A 1ABFA 2DBQA 2H59A 4LMRA 2OHGA 3DNFA 2G4LA 1S96A 5HDQA 4IDAA 3RUIA 2NADA 5AFSA 4JU8A 1E32A 4CF4A 1U4NA 4AWBA 1ULBA 3OO0A 4WEQA 5EJGA 3TFWA 5JNUA 2GD0A 2YWRA 2PZJA 3P2IA 4X66B 2IS6A 3WLLA 1DINA 1E6WA 1YIOA 3TJZA 2QTMA 1B43A 2R6FA 5LM3A 1QFYA 4LFAB 1S8OA 2WAOA 1YTLA 1CWUA 4LF6B 1JQJC 1TI7A 2D2EA 3EJ6A 5IEJA 5B3KA 2NZXA 1F6BA 3SXUB 1NW6A 1RZRD 1WWKA 2PANA 1GCOA 4C0AC 1LJ8A 2ECPA 3ADPA 2PAFA 5EIBD 1W85A 2CE7A 5BVGA 1V1MB 4AKGA 3ELDA 1VE5A 3WL5A 3NYIA 4URHA 1A0OA 1RIFA 1D2AA 4OJQA 4B4KA 1JWLA 3WHPA 3I4LA 4U0KA 1N2SA 2J3JA 3FRIA 3G5UA 3LYUA 3PDIB 4JJKA 4NFYA 1KRHA 4NZMA 1A96A 2HX1A 3RYHB 2O1WA 3KJZA 2GKSA 3AEQA 3A04A 3PNMA 4DIBA 2OLKA 1G63A 3FNHA 2PZFA 3G6KA 2WJGA 1DC4A 4LJ4A 1QSGA 3OETA 5A4DA 1Y6QA 1OGYA 3TB6A 1T8SA 4TTSA 1UMBB 4XCVA 1NSTA 3CNQS 1CQXA 3DGEC 1E1RA 1K9SA 3TXAA 3WGNA 1RI2A 4QDJA 4GR4A 3ZV6A 3LP6A 2C8KA 2HBYA 4TWJA 2IY9A 5I8PA 3RWBA 5BV2P 1CC1S 3K3PA 1RCFA 1TTHA 1Z25A 2QPTA 4V02A 1MO6A 5JH7B 4Z8YA 1T3SA 4WNYA 1LD3A 3IHTA 1E1KA 1HFEL 1U31A 3MTIA 4HFJA 4EJ6A 4DQVA 4HUTA 4I4TA 3CJTA 3WKCA 9ATCA 2X9LA 4XPZA 4E51A 1G6HA 3VO1A 2FEAA 2I3DA 1C29B 2R1TB 3MS4A 2RHLA 5ELLA 3ON5A 1HTWA 4MGKR 4WA7A 4J16A 3AFHA 4YR9A 4URUR 1PS8A 1J49A 3A70A 3GQVA 4XE5A 5G1NA 1H9BA 3KCNA 3R8CA 4NPCA 4FHEA 1XA4A 3VFDA 1GUYA 1ZUD1 2WAMA 1DXOA 1X70A 3Q8XB 4LKOA 4B8WA 1KEKA 1RJGA 4RMGA 2FNAA 5J2TF 1L5GB 2O5VA 3ENKA 1QGOA 5B3LA 3QW4B 3FCSB 4I4TF 2D5BA 1Q95A 1TVKB 1XA0A 2HA6A 3MS7A 4KMRA 1PZFA 4TSRA 3VR2D 4YT4A 4RHUA 1J1UA 1OAAA 2IODA 3WLRA 4TTVA 1YB1A 3CPHA 3HCFA 5JD3A 1JZQA 4GLBA 5JMPA 3AETB 3DBOB 3ECSA 3MGCA 4FDUA 5IM5A 2FGJA 3BOSA 4KLRA 3IAAA 4L5CA 4P0PB 2W2OA 3WYFA 1TYCA 2EFJA 2PKQP 4IF6A 4C07A 2JHAA 3VPXA 3GHYA 4JUCA 4OQNA 3PEFA 1US8A 1U2ZA 4GQIA 4EFLA 2QL7A 1Z4KA 1XR3A 2OV6A 3NHKA 3OEHA 5DM2A 2ZU0C 1SBIA 5BUCA 3LWDA 1J2RA 2H00A 1M1UA 3FSEA 4WK6A 5EIBC 3ANNA 3OD1A 3RKRA 1MT3A 2I6GA 3VZSA 4B79A 1VCMA 3EGIA 3ZDEA 2G1PA 1Y98A 2A14A 3CCFA 3ZWOA 2QSJA 4REQA 4IGFA 4EYSA 4IQ4A 3CYFA 1WEKA 3L7BA 2AF4C 4MQFB 3VHQA 4BBPA 4INAA 3DH0A 3FMOB 4MW0A 4EVQA 4RHCA 3ITNA 4LV5B 5KJFA 1H0HA 2I7CA 2FR0A 2PLWA 1IHDA 4OQ4A 4F2PA 1YS1X 3R5TA 2IK8A 4OHVA 4ZI7B 3OE7A 1JQEA 3TLJA 4KZKA 3T4PA 1NZJA 4OHRA 4ND1A 4XXHA 1EUDA 2X86A 1LPPA 3F97A 4YK7A 4R5HA 3U26A 4KXQA 2B9VA 3Q87B 5F51A 1W4ZA 1NURA 2QK4A 4HAZA 4NMLA 2H07A 5TGDA 3UAWA 2A0WA 5E0KB 3K15A 4KXNA 4NK4A 2M1XA 3ZWKA 4KKXB 3HPRA 2RGXA 3MFQA 4PHGA 4HLUC 1N8NA 2VZ9A 2IOFA 4PM4A 2ORIA 2H5EA 4R1LA 3ZWWA 4GWKA 1JILA 5IPFA 3BEOA 1H8EA 3CX7A 3P5BA 4LSMA 1DLJA 3HNRA 1F4LA 1GDHA 1SKYB 4TXJA 5FWXA 5I9SA 1JXAA 1YK1A 1ADYA 1WL8A 2FG6C 2Z8YM 1IG3A 1RM3A 2LGJA 3H8WA 1AGRA 2R4UA 4M8NE 1VXRA 3C3JA 4WNAB 1K8RA 1JDNA 2RAFA 1HZZC 4ZVKA 4IDQA 4DDKA 4RDXA 4EG8A 3ILXA 2XUJA 4LOHA 2WNIA 2JCVA 2A0YA 1V1RA 3ANMA 3NTRA 4WK4B 5CPFA 5LU8A 1YACA 1NW7A 1PJ2A 2JASA 1M0SA 1ZL0A 3UATA 1DDOA 2I6QA 5JNTA 1Q11A 3NHSA 2O14A 3EXAA 2YFKA 4Q7QA 1JEEA 3E8SA 1F4PA 5FBQB 3TM4A 5IJZA 5KQSA 4LF8B 3QUSA 3JQDA 4GZ3A 1IUNA 3K5WA 3NATA 1O94D 1GZSA 4R8KA 5C37A 2IXDA 5FO1A 2Q8PA 2DPYA 1JEQB 3B9QA 4NK5A 1PLLA 3AK4A 1EP3B 3IPAA 2GX6A 4IZHA 3CRNA 4W9MC 4QU0A 1MC1A 2OCPA 3NWJA 1V11A 1Z6GA 2O4UX 1A7AA 4M98A 2YWCA 1NAHA 2G28A 1ZEMA 3EUAA 3P0JA 5H4HA 1IPHA 1W87A 3CNOA 3I3OA 4HGOA 1HKUA 2XUGA 5CVDA 2WIAA 5HBRA 3A3YA 3OC0A 1F8GA 4BFUA 3NC0C 1QP7A 1ECCA 4RCYA 4ZANA 1G5FA 1AXRA 2W2QA 3GEMA 3GLGB 4JODA 2JK0A 3NUZA 2ZROA 2P3LA 4LJYA 2MIIA 1Y3DE 4WKGA 2YMMA 4BV2A 1QYWA 3NOXA 3VSEA 4FZ3A 3LJKA 1K75A 1OI7A 5HQJA 2CLLB 2B6HA 1FDUA 3KT3A 3SBOA 2J85A 5LNK1 4I4LA 3ZR4B 2WM8A 2ZZMA 4CCYB 3ANTA 5IKXA 3PXXA 2BR5A 4L9AA 3TS1A 1A98A 3E3LA 5CA1B 3FYCA 3IPRA 4JLBA 3FSRA 3DW1X 3UA3A 3ZDFA 1G9XA 2QR5A 3MWDB 1IOLA 3ZHUA 2Q1WA 4LYFA 3A14A 5KTOA 3VH1A 2XQFA 4ZCQA 1UXGA 4OFBA 3WOHA 2ZSAA 3ZCVA 1T2NA 4D42A 5BXYA 3T9BA 4NS4A 3Q1LA 1VGRA 3IDOA 3CO0S 4MB6A 3L84A 2XUAA 3Q3CA 3HUUA 1E5TA 3U48A 4E08A 3PT5A 8OHMA 1B00A 1AGXA 1XWFA 1D2EA 1GTL1 3NT2A 5BOSB 5HVNA 1SH7A 2YXLA 1KZ6A 4ZI3A 2OORC 1D2GA 1QYXA 3KOUA 1RWWA 4JLWA 4H6WA 3RS3A 3JX9A 3O91A 4MVJE 4J94A 2K5UA 1OYOA 1HLPA 3OU6A 4IH1A 4J0QA 4QPDA 4PZ9A 2DLDA 3IQIX 4N5LA 3HK2A 2O7VA 4MVJA 3M83A 2AQHA 3A1SA 2NZJA 1SCKA 1X1BA 1I0ZA 5JT1A 3DMRA 1SCJA 2O3TA 2DPLA 3FZQA 1Q22A 1N5MA 1RQGA 3EAQA 4PYMA 4B76A 4YX9A 2WW8A 3QHAA 1N33B 1XKTA 3B52X 2Q29A 4MX8A 1PR4A 1O94C 1AOXA 3AQIA 1ZUNB 3PFGA 3KHKA 4EW1A 4A8HA 3U3ZA 3Q3GE 2F3QA 2ORED 4CR6A 2C7OA 3OX4A 2F1OA 4EG6A 4JNKA 2C5HA 1MAUA 5K05A 1AQYA 1TU0A 1GCUA 3JAKA 3JQRA 1KAQA 4LOAA 2CZCA 1FNMA 3C2QA 3OPYI 3PK0A 5AK3A 1KFCB 1PR2A 3PCTA 4BX8A 3TQQA 5C5DA 1ORRA 1XYGA 4QQFA 4PBSA 3WJAA 4BIIA 2ATXA 2ZK7A 4PQFA 2R11A 4NV1A 5L8VA 1E2LA 3DLPX 3DLIA 2GBFA 3ETDA 2COKA 4GKBA 4P92A 5LP6C 4DUGA 1HYHA 1NLYA 4LZAA 1JFTA 2YNMD 1MH9A 1MU0A 1UMDA 4NX2A 2GN8A 4OG2A 4WUVA 1ULAA 1ZISA 3JVVA 5CT9A 1CETA 4BQQA 1LNZA 4PGGA 5C1PA 4MGEA 1ORWA 3GP3A 1W2WB 1DXHA 4CPDA 3ZG6A 3CUYA 4DR7B 1Q1NA 3CUUA 1PE0A 4XR9A 2JH9A 5C34B 1U2DA 2YYZA 1OXSC 4RKRA 1LRJA 1X1DA 1HC7A 1XRSB 2QN6A 4XUEA 4C43A 4DADA 1SD2A 2HU5A 4G0YA 4F6RB 1VPLA 2O0MA 3W7VA 2AJTA 2A7XA 2C9MA 3LU1A 4UQOA 4DIKA 1AX9A 4RZSA 4DMGA 4GP7A 2QSUA 4N0MA 4W5NA 2COEA 2H1OA 5G0SA 3SFTA 2CD7A 1FFSA 4D57A 1Y4DE 2Q3EA 4QU8A 3RC9A 4EP1A 5ER9A 1CRLA 2C2KA 2YINC 4UHEA 2FW8A 1PK8A 3LF2A 1M7BA 1ZD2P 4A8JC 1I6KA 1XRPA 4KVAA 3GDOA 5H59A 5HILA 2A94A 1U02A 1B14A 1B8VA 1SXIA 1F60A 1T5DX 2Q3HA 5THXA 1WXXA 1ZBDA 2P2SA 4DFDA 5KNDA 2HHHB 3ED1A 2P8SA 3I01M 3E7FA 4MIOA 4YJHB 3PHGA 4Q7MB 3RIHA 2KPOA 2XRFA 1W8DA 3CZPA 4G0PA 3CZAA 2G72A 3RVRA 1ZH0A 2GBGA 2C8LA 3IE0A 4TWBA 3GNQA 1RCUA 4L4SA 3TL3A 5E3HA 4F38A 5IANA 3OQMA 4JP1A 1YMQA 2ZBFA 1LK7A 3W5JA 4OJNA 2O8DB 3AEXA 1CJKC 3AY6A 1E61A 1L5ZA 4NBUA 3P9NA 2C4WA 3G5TA 3QPWA 2FMXA 2YH2A 3B6ZA 4CQMB 1PV4A 3LT4A 3NDBB 3TN7A 5J4HA 1XI2A 1A9XB 1RRGA 2GA9A 2VXCA 3MD9A 5CT8A 1WLYA 4UPDA 5HGJA 1GP2A 2GWHA 1AO3A 2UVPB 1ZD5A 2C3PA 2Y1OA 3GBSA 3HLTA 5L6LB 1CJVC 3S68A 3D8TA 1NXVA 1XFDA 4Z99A 3N1UA 5CD1A 2VJMA 2O8DA 1TM5E 4MUGA 2ACEA 5JNLA 4F85A 3F74A 4C14A 4CR7A 1SURA 1TJPB 3PU6A 2FUG1 4F5DA 1ZGBA 3N2GB 3KPWA 4OQMA 5HOEA 4ZDJA 3H6KA 3QU7A 5FRDA 3N0WA 1U9ZA 3S7ZA 5K3FB 3EUFA 3GN1A 3CIFA 5DB4A 2FN8A 3BXHA 3TFQA 4DUYB 3THYB 2C3YA 1XZBA 3Q72A 3DVAB 4KGZA 3L0CA 4IIJF 2R87A 4IVQA 4X0EA 1VPWA 4EEZA 1JLKA 2J0UA 2NSHA 3GFPA 4HAIA 4CN8A 3O4RA 1XU7A 1VLLA 4LS3A 4V2UA 3C1AA 7YASA 1T9HA 2P30A 1SCIA 1WPQA 1NRWA 3MB8A 4FTWA 3BL5A 1AKEA 4O0MA 4GWLA 5KOJB 2R6CA 2L42A 2HCBA 3DS8A 3O3OB 1M2EA 4WY2A 3C3WA 1N2GA 3X1KA 4BBZA 2UDPA 1VXOA 1NTOA 3QOXA 4PEVA 1U04A 1L2TA 2NPOA 3AHIA 3CINA 4B6PA 1MOQA 2B1IA 1JJAA 2JBHA 2I6XA 3IRUA 4PG6A 1U8CB 5CLGA 4GE0A 2UYGA 1XCOA 1PT9A 2CN1A 3BMOB 2WU1A 3GUYA 2BHTA 2G4CA 4OQPA 3EDCA 4WXYB 1KY2A 1BU5A 2ZUDA 4FE3A 3U3DA 2YV4A 3UYKA 4BYMA 2FRXA 3AUAA 4M7RA 3CWZA 4AMVA 4UBKA 1UDAA 2Z2YA 1D2RA 3FFTA 4WFKA 3UUGA 3VPGA 3CVXA 1V3QE 3DLAA 1FFWA 1JVBA 1PT5A 2FF5A 3ZDDA 4R16A 3H2ZA 4RQTA 4B2LA 1ADFA 1IBRA 3AIOA 1ID1A 1E3MA 2REQB 3TL2A 3BWDD 4V1CA 4HGQA 5BV1A 5LZ5A 3CN7A 4GUAA 4P4SA 3AJEA 4JELA 3FPCA 1AG9A 2AF3C 3P9RA 4IVPA 2HB6A 4DA9A 1NKVA 1NJ1A 2V1UA 1ZNYA 1YZVA 3LPDA 1D5WA 1FP2A 4EW6A 2IX3A 3CVVA 1J4AA 1Z83A 2NU6A 4JQCA 4N0DA 5BORA 2FSSA 5DM0A 4V3BA 2CKDA 1D07A 1GFIA 1KF0A 4KQEA 2JFZA 5CK4A 1A9SA 1IJBA 5DNWA 2J1LA 3DCNA 1XDWA 1N6HA 3L5KA 1JYEA 5FI1B 4N01A 5JNRA 3WMWA 2QQ0A 1G8PA 1Y48E 1BCRB 4DB4A 4FCTA 3M4XA 1CXZA 2ZJZA 3KTOA 3KOMA 2D59A 5TY0A 3LUCA 3NHUA 1R0RE 1DFIA 4UUAA 3W1EA 1R2QA 2XADA 1GD1O 4HDKA 4GVLA 2HR1A 5EWJB 5AVUA 2YRXA 2GM4A 3PE4A 2HLDA 4D9GA 2GFIA 3AI1A 1P5ZB 1RJ9B 4X90A 1O6GA 4KZPA 1AHIA 1II8B 4K86A 4IKPA 3R24A 1CEEA 4RNDB 3T7DA 3UEOA 3F6EX 3HY4A 3FDZB 4FOTA 1B93A 4UAGA 2O8VA 4FMBB 2W4QA 2I76A 2VHTA 5BNWA 2WU3A 1V35A 3RBXA 4P5DA 5F4ZA 1OMOA 1QH9A 4ZMSA 3ZHTA 1Y81A 3G49A 4NP6A 1T5BA 4GPIB 4MHTA 1NT2A 3DE5X 3ZWCA 3NHPA 1XEAA 1PLJA 1F1JA 3ET4A 4GXRA 2GK7A 1XRLA 1QX4A 1DQPA 1WBBA 4DWJA 1NDQA 1Q17A 3OF3A 4JDUA 5KSPA 3RTEA 5KU7A 1Q0PA 1QG6A 1G19A 2P5UA 2RI1A 3BORA 3DYIA 2ZXFA 1CG6A 3ANSA 3BFKA 3CUTA 3H13A 1LWNA 2YBDA 4QYSA 3WWEA 4C0SA 1AMOA 3NVKI 2NMVA 4KJZA 1WXEA 1Z62A 1OXVA 2Q41A 1Z07A 1X13A 1BJTA 4JH0A 3HCEA 1SOVA 2HIMA 4HZGA 4JI4B 4Y2GA 2NNWB 1N77A 2C4TA 5L45A 1KEVA 4MW1A 3LXMA 4HVAA 5ALFA 1VKHA 4B87A 5JS6A 1CEXA 1PTJA 2WIBA 3HKCA 4KV9A 3TW8B 4JVLA 3QV1A 1OKKD 1BWRA 1ECBA 3UJ3X 3VV3A 2HYIC 1NNI1 4IAOA 1EXMA 3LBNA 1ZVQA 3S1LA 2ZIZA 5KVCA 4TLCA 3MAJA 5KNBH 3CIOA 2FFHA 4YYEA 2C82A 1B8OA 3NIGB 1Y7IA 4NZZA 1Z6PA 1SB9A 4NAVA 4OLFA 4BL5A 3JQ8B 2H54A 2VYND 3PQ5A 5CR9A