2D7DA

Structural insights into the cryptic dna dependent atp-ase activity of uvrb
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
Knots found
sequence length
652
structure length
621
Chain Sequence
DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the cryptic DNA-dependent ATPase activity of UvrB
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/dna
molecule keywords 5'-D(P*TP*TP*T)-3'
total genus 228
structure length 621
sequence length 652
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 2d7dA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d7dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d7dA01
4D82A 2BKEA 1NLYA 3O8BA 4PHGA 3ZVNA 2ZTSA 3TAHA 1E0KA 2R44A 2OILA 4PZLA 5AUNB 1KNQA 3LVQE 4Q66C 4OI0A 3TH5A 4QM7A 2FPKA 2QSYA 2OSBA 3T12A 2CE7A 1OW3B 3EWAA 3S1AB 2KBEA 3WYGA 1SHZA 4PQYA 4V0MA 1V43A 4HUQA 2AK2A 3W5IA 2HLDD 1ZW6A 3OEHA 4NCKA 1OXUA 3NEYA 5IDVA 3UANA 4MUAA 2VIIA 3FDIA 5FR1A 4F4CA 5JHHB 1S2MA 3K0AB 2IYSA 5LD2C 3LV8A 5E7JA 3SNHA 3Q3JB 4NYMR 2JJ1A 1GZSA 1OKKA 5FUYA 4BRUA 4G5QA 1OV4A 1R8QA 4QHYA 4TMTA 4ACAA 1Z0JA 4B2PA 2R9VA 2CE2X 4JL8A 1TQ2A 1HEIA 2X77A 2CHGA 3LW7A 1KZ7B 1JAHA 5L3QA 3WNCA 4Z1MD 4DHEA 3IPYA 2PMDA 3SQWA 1P73A 1IN6A 5DI3B 2CCGA 3KQLA 4KAXA 2OHFA 1UFQA 4UNNA 4QJ4A 2EFDB 1TU3A 1CRPA 1KY3A 1NBMA 2QP9X 2GCPA 1R5BA 4HSEA 5HE9A 2ANCA 2IF2A 4QGHA 3ZVLA 1NMYA 5DE3A 3CNNA 2PCLA 1P5ZB 2ZI4A 2PLRA 4B33A 4QM6A 3WYFA 5IHPA 3GFPA 2WMNB 1E2IA 2QE7D 3SJCA 2XJ4A 2ZSBA 5J4HA 3QXHA 3TRFA 1NI3A 1AS0A 2GEDA 2GESA 5FUVA 4B44A 1QHXA 3VHXA 1HT2E 2DPXA 3WMFA 4PZZA 3OE7A 3CX8A 3QXXA 2QRZA 2IHYA 4PQRA 3ZS8A 4ASUD 1E2QA 4BLPA 3DVLA 2WM9B 3TVTA 4A82A 2HLDA 2ZJBA 2BMEA 4DEYA 1P9NA 4RSGA 4DUGA 5KHOC 2IW3A 3VKHA 2QSZA 2Z5FA 3U2QA 2JDID 3ADKA 1TQDA 4B34A 2GXQA 3TQFA 2IS2A 4Z54A 1N6KA 4LJ4A 1XMVA 1KO5A 3LQQA 1G8HA 3MFYA 2FDCA 1ZUHA 2GZAA 1ZNWA 2R6GA 2JLQA 4W5HA 2NMVA 1F2TA 2WV9A 2XTZA 4TMZA 4YMSA 5DI9A 3T34A 4C0HA 2RGNC 3OIWA 4NMMA 4OQMA 2V7QD 3CB4A 1UF9A 5FOWA 1H8ED 4OHXA 3JVUA 3U6BA 4GFDA 2ZE6A 1OJLA 4QKQA 4U00A 2QAGB 3RVBA 5K8TA 4JL6A 3Q7QA 4WBSA 4EPRA 3DHWC 4P0TA 4DRZA 2WWWA 1OIXA 3CR8A 1GL6A 3BIFA 4AKHA 2VL7A 4DC9A 1KI4A 1W4RA 1CBUA 3GQBA 1RYFA 4ZIRA 1P2SA 4TL7A 3HDTA 5CJ2A 1CRQA 2OO7A 3I5YA 1OIVA 5JZVA 1GNPA 3U4QB 4UXIA 3QG5A 4CEHB 4P4SA 5KU1A 1NN5A 4CZ2A 1SXJD 4EQ6B 1Z83A 3VKGA 3BB4A 1COWD 1YR8A 2WKRA 3QVUA 5HZKA 2ZYWX 3CPHA 3FB4A 3PUXA 5FPHA 4CEIB 1NLZA 1GVNB 1N5JA 2XZLA 4XWOA 3AF4A 1SVOA 3G5UA 1ZU5A 2FMXA 5F2EA 3IQXA 3RNLA 1GFIA 3GLIE 1U8ZA 2IYUA 1XXHA 1G7CA 1UAAA 3KJHA 3T61A 4A8JC 1Q0UA 2FE4A 2PX3A 3CH4B 4JSTA 5B2ZA 4YLGA 3AVWA 4RD2A 1WRBA 3W8NA 1F2UA 3AV0B 1DO2A 2AFIE 2QP3A 3M0EA 5F9FA 3TJZA 1VMAA 5KO2A 4OJKA 4OK3A 4XSHA 1XTRA 1OH8A 2GAOA 2VLIA 3OESA 5CLLA 4TYPA 2GZHA 3PFIA 4G5GA 2A3RA 3OHMA 1XRJA 2EFGA 2X2EA 3HU2A 3VU9A 4RFVA 3U3KA 5F98A 3R7WA 2WSSA 2PMKA 1W1WA 2YWFA 3KB2A 1P60A 4O3MA 4DSOA 2ZRBA 4R9UC 1E2NA 1E9EA 2BBWA 2QAGC 3MCAA 1NJFA 3RWMB 2NZ8A 5AUQA 4QL3A 3IEVA 2RGAA 1DAKA 2ZRDA 2DR3A 4PSKA 1ESNA 2OEPA 2YVUA 3GLGE 1XEXB 1G8YA 5JMTA 1XU4A 4IDNA 5J5CA 3VHLB 1A4RA 1PUJA 2J87A 2ZE5A 1VTKA 1RJ9B 3KKPA 4I1OA 4HB0A 4RD0A 3KKMA 2FG5A 4TZ6A 1ZAKA 1AA9A 1DADA 4DJTA 2WKPA 2NQ2C 2REBA 4PC2A 5GVRA 1QG4A 2CLCX 3I72A 3CNOA 3AUXA 1UKEA 3IIJA 1OKKD 1QVAA 1JAIA 3WY9A 4YMTA 1ZM3A 2WKQA 1E1RA 4M1TA 3AF1A 2H92A 2ZRCA 3THXB 2QNRA 4JLPA 4OHYA 2ATXA 1MABA 5J4KA 1XMJA 3H1TA 1W2GA 2YV5A 1H8HD 1NMZA 3EZ7A 4AG5A 4B71A 4JZKA 5JEEA 2YNMA 1YZUA 2ZRNA 4XVQA 4Q7LA 2CL7X 2OE2A 4UXHA 1FFHA 3QE0A 4L16A 2ODBA 2O8BA 1XEFA 3SZRA 1J8MF 3LA6A 4H1UA 1R5OA 1E2GA 2RGBA 1RJ9A 2ZREA 3OIYA 5L8VA 4TLEA 3FPAA 1WP9A 2CBZA 2QA5A 3UWOA 3BH7A 2GETA 4MGZR 4M21A 1E1QD 2FZLA 1NVVQ 1RPZA 4QBFA 1R0ZA 4Z8XA 1DO0A 2YOGA 3UATA 1G4AE 3SYNA 2G3YA 2W0MA 3R7WB 3HWSA 1JXMA 3RRZA 4L8GA 4EPYA 4MGYR 4LI0A 4LYJA 4M22A 2EWVA 1A1VA 3BGWA 2WJGA 2FX3A 4PFSA 4MITA 4R7ZA 4V0ME 2IXFA 1IM2A 3TMKA 3K9HA 5KNCA 3IBYA 1D9XA 2R6FA 3BFVA 1I2MA 1M1YE 3THYB 5M04A 1T8UA 4S2EA 3R8FA 1JALA 4LHXA 4D4KA 3AVPA 2C95A 1U98A 4IKEA 4WA7A 2AR7A 5DGXA 2BBSA 1KDTA 4FCWA 1L4YA 1T0HB 3D31A 4CF7A 3K9NA 1T4GA 3CRMA 3MUFA 4QHSA 5C46F 3IPXA 2JLZA 3SU8A 3OIVA 4LJ8A 5ANRB 4DSTA 1E2HA 1BMFA 2HXYA 2ZU6A 1XTKA 4PPFA 3SHFA 4P32A 3RS0A 4IEIA 1FUKA 1C1YA 1GIAA 1P2VA 4I4LA 1A2KC 3AKDA 1KI9A 4IDHA 2F55A 5L3SB 5B64A 5C1BA 1KDPA 1BO6A 1W46A 4GI7A 4V03A 4URWR 3VR5A 1BYUA 1QHNA 1F3OA 2JJ2D 3HPRA 3CONA 4JIMA 4GSYA 4NP6A 5JRZA 3U7FB 4Q19A 4KHZA 2PZEA 4OQXA 4DCVA 1JXOA 1MV5A 4DLXA 3X1XA 3QEOA 1TPZA 2ZE7A 3PR1A 1ZNXA 2FZ4A 2VSXA 2QT0A 2A2ZA 4PO1A 2H5EA 3AVYA 1GRNA 1YZKA 4NZYA 1Z0IA 4DLWA 4URYR 4QOSA 1UBCA 1XTIA 4RKFA 2XXAB 4S35A 2DB3A 4FXPA 2AX4A 3SEAA 2V4ZA 3A4LA 4A0HA 3I62A 5KOYA 4ZCLA 1BOFA 2C98A 4GT1A 1W47A 3FGNA 1XCMA 1Z07A 3WXMA 2PJRA 4U02A 4XSGA 4Z1MA 3GD7A 4V0LA 4DDWA 3GLIB 5HZHA 4HDCA 2LKDA 3F0TA 2FGJA 4XWKA 5FBVB 3L82B 3NH9A 4OBEA 2ZRGA 3DMDA 2D2FA 2IYWA 4FMDB 4G01B 3P1JA 1D9ZA 2DWPA 4KBFA 4BUJA 1O87A 2YINC 2F3TA 3QSYA 2ERXA 3FKQA 2AXNA 3KQNA 1VCMA 5AJZA 2ODEA 1S8FA 3MAAC 4Q4AB 1NSTA 4Y0VA 3QPUA 2ONKA 1YR9A 1YRAA 2CL0X 1KSFX 2CMKA 1T3HA 5KDLA 5LD2B 4BEJA 1XD9A 1P9WA 5AUPB 2ZSAA 4M9QA 6Q21A 3PJRA 2AN9A 2IS6A 1W4CA 3G0HA 4IVQA 2G6BA 4FMBB 3TVDA 3QPWA 4GPTA 5LBIA 1Q21A 4IOMA 2ZI7A 1XZPA 2IXEA 4U5XA 3Q5EA 2F43B 5L3VA 1P61B 2FFQA 5HCNA 2VRWA 4Q7MB 4TWZA 2AD5A 2CHQA 1E94E 5FL7A 1CR1A 1WBDA 2CNWA 3VKWA 2HF8A 3CBQA 4GOXA 5AUOB 2YKGA 3ECCA 4B2IA 1ANKA 1VHLA 3OFNA 2ZS8A 3U7HB 2DFKB 1MOZA 1GWNA 3QBTA 5J40A 1CJMA 2X19A 2Z4SA 4X8HA 1GNQA 1KZGB 1X3SA 1DAMA 1J99A 4NCNA 1AJEA 1OH5A 4AURA 3AM1A 4XWAA 2O0KA 1M7BA 3AVTA 4A15A 4YXWD 1TNDA 3QF4B 1RC8A 2YC2C 2Q6TA 1R7RA 2WHXA 2HDNB 3RLFA 4LK2A 1XF9A 3SI7A 3QG1A 3ADCA 1LB1B 4JT4A 1RE0A 4Q02A 2ZUCA 5DN6A 4Q5IA 5FL7D 2GHIA 3W5JA 4EIWA 2P65A 1Q20A 2JLRA 3PITA 2EW1A 3KJEA 1H8HA 3GEHA 2P6RA 1GOTA 2R62A 1W49A 4XJXA 4YMVA 3X1DA 4LJ6A 4AI6A 3AF0A 2PX0A 1RRCA 1PVOA 4M2LA 1AKEA 4KVAA 1IY2A 1U9IC 1W0KA 2D62A 2WWHA 3LX8A 2QQ0A 1DAGA 4AY2A 2F9LA 1ZD1A 1CJKC 3C14C 4LZZA 4Q4AA 2G77B 3EG5A 1IOZA 4TYNA 3THXA 1AZTA 2WWYA 1MO5A 4WW0A 1N2CE 1E2MA 3ASYA 4Q9HA 4LHVA 1RYHA 2AK3A 1B0UA 2SHKA 2O0JA 2ZRMA 3CKLA 1VYTA 5DNYB 3PXGA 2UZ3A 2VHUA 4XTCS 4D80A 2BEJA 4PQFA 2J5XA 2P6NA 5FUWA 4ERNA 1G8GA 3VR2A 2VP0A 2CL6X 2FSFA 3SYKA 4ARZA 1TAGA 4E22A 4Q1BA 5JECA 1Z6TA 4GDFA 1P2TA 4C7OA 4MRNA 1IHUA 3VU9B 4QJ3A 3TUZC 3OZXA 5JI2E 1XD8A 1GAJA 2B2NA 5KUTA 3VFDA 2F6RA 1ZP6A 3GPLA 1AGPA 2GXAA 4KYIB 1G7SA 2QI9C 3IQWA 1OIWA 4Z8YA 5B58C 4I1SA 4XIGS 1NP6A 3KZ1E 5LB2A 3P4YA 2OLKA 1I2DA 3LFUA 4NPHA 4RD3A 1NY5A 3AQ4A 2ATVA 2EWWA 2P5SA 2BHRA 3GP8A 1WMSA 2OXCA 3TGPA 1F48A 5AK0A 4E09A 2ASEA 4NU0A 2C9OA 4Q4HB 3D7MA 4EJSA 5BW8A 4NCIA 2BBOA 5JEDA 4V0KA 1XMIA 3MJRA 4IVPA 2Z0MA 1SKYE 1Z2AA 5GADl 1FNMA 3TSOA 5DSZA 1OB5A 3SJBA 2A7QA 2AD1A 4NONA 1FP7A 1N5IA 1SVKA 4KFSA 1TEVA 1AK2A 4D81A 1XP8A 5BQ5A 1HUQA 4US1R 1E9BA 2C04A 3QKUA 2FU5C 5JJLA 4RD6A 1ZINA 2QTFA 3CRVA 4HB3A 2BKUA 1Q12A 3IEUA 4HZUA 1FMLA 3GMTA 4D6PA 1FTSA 1EFHA 4RFSA 5TVKA 5JCZA 4PC3A 3ETLA 4TLCA 1S9HA 1QHGA 2FPMA 1QBKC 2WJYA 5SZKB 2ORWA 1ZRHA 1SXJB 1TF2A 3DPUA 1R5NA 2GJ9A 3DDCA 2VBCA 4ZIRB 2JASA 5FR2A 3NHAA 3GFOA 4HEJA 2C9CA 2OCAA 4C30A 4GBMA 2VP5A 4QGFA 3REGA 5B30A 3B9PA 1G64A 2QU8A 4TN1A 4PANA 2XSZA 2GRJA 2GDJA 3MWYW 2NPFA 3FVQA 1WDTA 3G82C 5G41A 4YONB 3L2OB 2V9PA 4NKRA 1T0JB 1GKUB 3W90A 4JLJA 4BLQA 3VNVA 2YJTD 4AKGA 1VG1A 4MYUA 3GJ6A 3U60B 4L5BA 2OT3B 4V02A 1G3MA 3W8RA 4DB4A 1G5PA 2B7CA 5JSZB 2VF7A 2J7PD 1Z28A 2XSZD 3R9WA 1NJGA 3PV0A 1Y63A 3PUVA 5CM9C 2ZRAA 2ZUBA 2VHQA 3RS3A 1PZNA 3UWKA 1DVRA 1Z8FA 3IILA 2VA8A 1KHTA 2JLUA 3LW8A 1SZPA 4V0OA 3GEEA 1XPOA 1LTQA 2GCOA 5JJIA 5BN3A 3K0FB 3N70A 2QE7A 4BLTA 3ZQJA 4IDOA 3TUIC 1XD2A 1W4AA 1KI6A 1VG9B 4C0QC 2RGNA 1UDXA 1G3UA 1OYWA 1YU9A 5DI3A 1NG1A 1EXMA 1KI6B 1JNYA 3EPLA 4DLYA 5EZ5A 1GL9B 1X86B 2ECKA 4HLQB 1U99A 3E5HA 3L0OA 2FPLA 1ZIPA 3VMAA 1OE0A 2NO9A 2VQSA 3FPNB 4BFXA 5EUQB 4LOAA 2WPDD 1ZC4A 1EFRD 1IXRC 4Q00A 3MJHA 1FPMA 2YYZA 4ZV4A 5DLQC 1N0WA 1Z47A 2GILA 1CIPA 2JJ2A 4N0DA 3FMIA 3K0SA 1VYVA 4EJSB 4Q4HA 4MRVA 5FFMA 2RAPA 4CDGA 3LAWA 3ZZ0A 3X2SA 3ICEA 4A36A 1BMFD 4DDVA 1KI7A 2ZPTX 3LLMA 1XPUA 3AKEA 5LPNA 1L8QA 1Z06A 3SFVA 4UNRA 5EUMA 3UXMA 2OCPA 4BE7B 3RANA 3CF2A 2CJWA 3KKNA 3NBFA 3RS4A 2R6DA 3A8TA 2ZJOA 4G3XA 1NN0A 1GRRA 2QROA 2ZAMA 4I99A 3WBJA 1KSHA 3EPKA 2VHJA 3BH6A 1HQYE 2ZR0A 1EFUA 1LF0A 3BFKA 1EGAA 2VHCA 3OIUA 5AJYA 1W36B 4RZ3A 2BJWA 3KQKA 1S3GA 4DLUA 3P20A 3QEJA 221PA 5AJVB 2FV8A 1XDBA 2BV3A 4LRWA 3QKSB 1DG1G 1YJ5A 2AHOA 4WAUA 4C3ZA 3K0CA 3ZGXA 4JVSB 5H68A 1HT1E 4AD8A 3T5GA 5L3SA 1OXXK 4D4JA 1D8TA 1Q1ZA 3B13B 1Y3AA 4DDTA 2ZRKA 1E9SA 2ZRPA 2XZPA 4Q01A 2IYRA 4YDSA 4UJ5A 1QHYA 5GJCA 1CJUC 1HURA 1ZCAA 1MRNA 1VCNA 2KB0A 1XNJA 2W58A 3K70B 3U3JA 1UPTA 4AYTA 1E1QA 4LY6A 3RABA 5IF9A 3KUCA 2ZI9A 4WIAA 1MH1A 3LBIA 1DBSA 2HV8A 2IYZA 2BEKA 4ZDKA 1HV8A 1YVDA 2QG6A 3AUYA 1D2MA 5H70A 4A8JA 3B60A 3K53A 2ODWA 2K5UA 5TXGA 4BWYA 1JR3E 3GLFA 2ZM5A 2OLJA 4MRPA 5CK4A 4GOKA 3T1OA 5C18A 2ZROA 3EIEA 2B8TA 3DL0A 3A37A 1NG9A 4AC9A 3I92A 1Q3TA 3SYLA 3U44B 3L0SA 2FA9A 4QXAA 2C77A 2FNAA 1DARA 2ZI3A 1Z0FA 5AJWA 2DFTA 3QF4A 2EFHB 1DS6A 1II0A 5HTKA 3QNUA 1UBGA 1NMXA 1HE1C 1XB2A 2IYLD 2ZRFA 3Q9LA 3FWYA 4WXPA 3EC1A 3AP3A 5P21A 2ZR7A 3NHBA 2BMFA 2VTKA 4TSFD 5EJEA 3EZ9A 4FINA 1X8KA 2JGNA 1G9XA 2QPTA 2VP2A 1E9RA 2O0HA 3ZIAD 3REFA 4EFNA 2ERYA 1GITA 2F1RA 4MGIR 3RHFA 1MO3A 4NYJR 2IT1A 4Q1EA 1G7TA 1IXSB 3VQTA 1A82A 2B6HA 3LNCA 1R4AA 1XEWX 3KFXA 4AYXA 1G5RA 4AWXA 4B35A 5LDDC 4BRWA 2PT5A 1W5TA 4FMCF 4M8NE 5JS8A 2JJ8A 1CF4A 2H7VA 4M4SA 1E0AA 1QVRA 1KI3A 2OV2A 2X2FA 4JJKA 2WAXA 1XTQA 1UKYA 1Z0KA 3NDPA 3KKOA 4ZI2A 3K9LA 4OQLA 4EKDA 521PA 4KYUA 2C03A 4PX9A 2ZJAA 5TMPA 2R2AA 2JLWA 2J7KA 1BIFA 1OFIA 1S0UA 1D6JA 1JR3D 1KNXA 2CVFA 4DIEA 5BWMA 5FOXA 1AIPA 1CJVC 4LX0A 2BDTA 3AVXA 1KK1A 2MMGA 2N1BA 2A78A 4X8OA 4PHFA 1NBMD 1PLLA 1P7CA 1NN3A 3OF5A 3KXIA 2OAP1 1KOFA 1EFCA 2E9SA 5G3ZA 5J4LA 1AS3A 4YDHB 4DSNA 1T3LA 2W83A 4KCGA 2H1LA 1KI8A 5J4YA 3L0IB 2GJSA 1NN1A 1QRAA 3TBKA 4A2PA 3BC1A 4W5WA 4DCNA 4M53A 1KKMA 2EFCB 2GEUA 5SZHB 2AFHE 5SZIA 1SVWA 4B76A 4Q1FA 3V4RA 2NGRA 1E4VA 5CM8B 3ND8A 4OL0A 2Q9AA 3Q5DA 2WIBA 5K8UA 1SXJA 1G6OA 1WF3A 1E2JA 1LW7A 1IN5A 4Q9LA 2J59A 3E2IA 1QHHB 2IYXA 1AQUA 3DZDA 4C0KA 4UKDA 4LJAA 3LH5A 1GILA 1OXVA 5JHGB 4PZYA 3K8YA 4EFMA 1U94A 1SXJC 1G5TA 1IJEA 3T1TA 1Z0DA 3U3RA 2YZ2A 1XTSA 4C0JA 3IDQA 5CDFE 3FHTA 1H8EA 4IFEA 2FOLA 1JEEA 2V1XA 5TB5A 5H1YA 5EZ6B 1ZNZA 4Q48A 2A9KA 3T5DA 3CNLA 4A4DA 2KBFA 4Q47A 2WOJA 5GVSA 4EQ6A 1UEIA 2BWJA 3A58B 4CYMA 1S1CA 4DLVA 3RRMA 1QG2A 4TTQA 3AVOA 2JLYA 3KQUA 4A1FA 3B1XA 2ZETA 3DKVA 2HYDA 5DHAA 2PEYA 1U81A 3SC3A 4XH9B 2HT1A 1KY2A 2XTNA 1JPNA 1T3SA 3IGFA 3BD9A 2VP9A 1SKQA 1E79D 2ZIAA 3BAFA 4F4IA 1XCGB 1Q1EA 3CZPA 4URZR 1KO4A 1US8B 4US2R 2HJVA 4PAQA 3WP1B 2ZYVX 1HYQA 2W6JA 3RS2A 1L4UA 2NZJA 2WWFA 1Q3HA 2V55B 4EPTA 2Q0HA 3BRWD 1WBBA 4ASUA 2CDNA 1NSFA 2B92A 2D3WA 3C4JA 4H9GA 4E07A 5DYGA 2JLVA 2QMUA 4DB2A 2KJQA 2N42A 2ZANA 1MO6A 3SE0A 1DG3A 5JWOA 5K8IA 4UNQA 2I1VB 2PZGA 4M9XA 5AJXA 1OXTA 4ZDIA 1OT3A 1W36C 1WA5A 4D26A 3BORA 2JCSA 3QXSA 4LHYA 3RSLA 1FP6A 3EAQA 3H4MA 2OZEA 4ZPXA 3FMFA 3LXRA 4DWJA 3B1ZA 4KFUA 2WMOB 3RRYA 2KWIA 1FX0B 1LFDB 2D7CA 1YE8A 4FCTA 4BGDA 4B2LA 1JB1A 4TQ9A 2R65A 4BLOA 1VG0B 4RZUA 1E69A 3QJYA 3UKDA 2Z43A 2D74A 3T06B 4Q7KA 1UEJA 3RSOA 3TSZA 3TW4A 3TIFA 1P3JA 3FOZA 4V0NA 3OEEA 1AGRA 3ZZTA 3AGQA 3CPEA 4KSBA 4GOJA 3A6PC 5JJKA 1JPJA 4HATA 3UMFA 4JVMA 2QY9A 1DOAA 1E1RD 4QG7A 5FOTA 2J46A 4JVLA 1XX6A 3B1YA 1D5CA 4GMXA 3TAUA 3K0FA 2XJ9A 5KSZA 4ITRC 5CYOA 2ZXUA 2DBYA 3MLEA 3LWNA 1I4LD 3RYTC 1ETUA 2ZSDA 1UJ2A 4XTRA 4X8MA 3BWDD 3V00A 4RZ2A 1ZJ6A 3PEWA 1RW4A 1NVXQ 2V6IA 4ZDWA 1N6RA 1E6CA 1W0KD 4LYAA 2WSMA 4D25A 3CF6R 1FX0A 4PSAA 2GVDC 2PL3A 2OBLA 1Q57A 2WZQA 5EE1A 4HDQB 5JS7A 2CXXA 4JSYA 4LYHA 4LSGA 4TT3D 1UM8A 4PTLA 3K0AA 1E32A 2R8RA 2ZVPX 2Z83A 3VX3A 3K09A 1AQYA 3R8CA 2XXAA 2GTPA 1ZUNB 1UKZA 1IQPA 3LBHA 3CRW1 1DELA 1Z63A 1ZU4A 4R71A 5E7MA 4NL4H 3C41J 3RAPR 5GJVC 4TMXA 3MG9A 621PA 2VP6A 3S1AA 1JQLB 1YHNA 3QIAA 4LC1A 3TK1A 4LWZA 4TLDA 3QBVA 1LS6A 3O47A 2CCJA 4B74A 4C0SA 3EZ6A 3KTAA 1U0LA 1EX7A 3D8BA 1ELOA 4NDZA 3N2EA 3JZAA 5JI3E 3I32A 2XB2A 3V9PA 2JAQA 3MMPA 3BFXA 4QBIA 5UKDA 3SOPA 5ELXA 5E95A 3T1VA 1RIFA 3GLHB 3ZS9A 1G8PA 1XMSA 3CWZA 3ZLJA 2W0SA 4Z51A 2GWHA 2E1RA 1MABB 3D3QA 4YC7A 2QQEA 1E2DA 4GMDA 5C2JB 2P2LA 5FPTA 1EX6A 1K6MA 3IO5A 1TMKA 3BK7A 1HA3A 1E79A 1TX4B 1FMJA 1IY1A 3GLHA 2CCKA 2FSHA 2BM0A 2IUTA 4TL8A 2V7QA 3CO5A 1U8AA 4CRWB 1IBRA 1KDRA 3THYA 421PA 1J70A 1E9FA 2WVJA 4OHZA 2EYQA 2IUSA 2OCBA 4MRSA 2EFEB 2NO7A 4P33A 3WBKA 1ZM4A 2ZSFA 2JDIA 3C15C 5FUXA 4O0MA 5SZJA 1GNRA 1XEXA 3AVQA 1K5DA 1IN8A 2J45A 3H84A 4FI3C 2NOAA 4B3XA 4IXMA 2NO0A 4GNKA 3L43A 4DCUA 4A0FA 1VG8A 2A5YB 2VSFA 1NBME 1ZIOA 2C99A 2QT1A 3SBEA 2ZRHA 4KITB 1X1SA 3CRQA 4R2IA 4NBSA 3HU3A 2F7SA 2OFWA 4MGKR 1ZC3A 4HUTA 3GFTA 3F5FA 3QPVA 2QL6A 4FD2A 3QI2A 1S96A 2J3EA 5HCIA 1M7GA 3C5HA 4M1WA 3RC3A 4DUGD 4HAWA 4PC6A 1RVDA 1ZM7A 2UZIR 4FN5A 2WICA 1ZD9A 1WXQA 1Z6AA 5EP2A 3GJ3A 4K81B 4H1VA 4Q9JA 1F2UB 5HE8A 4NYJQ 3WYAA 2Y8EA 4FIDA 3PEVA 4MYHA 1XEWY 2A5JA 1M2OB 3PCRB 4O2LA 4QGAA 4J0QA 3CH5A 4NHOA 1XXHB 1BKDR 4JLNA 3QY0A 4DT1B 3QQ5A 2WJIA 1KMQA 1KGDA 3AP1A 4NYIR 1KJWA 2XNDD 5DYIA 4EAQA 5KSPA 4AIIA 3P26A 5A0FA 1DAIA 4M1MA 2HCJB 3MWKA 3KJGA 4KU4A 4B73A 1W0JD 2G83A 3B5JA 3GEIA 1N6OA 2RGDA 1RFLA 1KDOA 1PLKA 1GM5A 4FW9A 1RZ3A 4UQOA 2FGKA 5FTKA 1FW6A 1T8TA 1IN4A 1XD2B 5KPDA 4LBZA 4XVRA 3O8CA 2AWNA 2YWEA 2BM1A 2G1JA 3HR8A 4HAUA 2VH5R 2ZU0C 4UXJA 4M1YA 1VYUA 2P6UA 5FBLB 4BZPA 2GF0A 3LXXA 1KSJA 1JEDA 3ZIAA 1WCV1 5IK2D 2L0XA 1KAGA 5BYJA 3O8DA 2QAGA 5G3YA 1W5SA 4ESHA 3CX6A 4IOLA 3LQRA 1ZVQA 2JJ1D 4G5RA 5FL3A 4LV6A 1ESMA 1X1RA 4HB4A 1KAOA 2QRNA 1ODFA 2VPPA 4Q1AA 5A4JA 3LRPA 3PIRA 3ZH9B 5EXXA 3A4MA 4LBVA 5E3HA 3GLFB 4LGMA 3H86A 3QF7A 2ZJ8A 1E9AA 3FYHA 3DOFA 4FMCB 2GA8A 4KFRA 1X8JA 2O8BB 3CX7A 1Z3IX 2GJKA 1GRQA 3EPJA 1VDZA 3JZMA 1J2JA 2RCNA 2P67A 3EA0A 4URVR 2W2XA 4ZO4A 4LPSA 2PLFA 4OQFA 1P6XA 4JKIA 3HPQA 3ICQB 1M74A 1Z6XA 2V1UA 3KDSE 2F9MA 1E2PA 4LPKA 4MDEA 2ZEJA 1KYIA 2REOA 3TUJC 4JLVA 4A9AA 2VF8A 3H2YA 4A92A 1Z22A 4DKXA 3L0PA 2O8DB 4B47A 3EA5A 2RH5A 1R8SA 3U3MA 1Z08A 2I3BA 2C2HA 1N0UA 2NO1A 4B6FA 1TQ4A 1FQJA 2NTYC 3BXZA 4PHHA 4AYWA 3THOA 4CT5A 3BERA 3NXSA 3EWSA 2NO6A 3LBNA 3C8UA 1R6BX 3M6AA 3VX4A 4CEHA 3KXLA 2OBNA 3BE4A 4EPVA 5EXSA 2XNSA 4XD7A 2FEOA 3WHKA 2V6JA 2NG1A 3FMOB 3IIMA 3QKSA 5CYPA 2FFBA 4I1VA 4DLSA 5KSOA 1FOEB 3KKQA 1TUIA 1XWIA 1I4TD 4DLTA 4POAA 1YZTA 2H57A 1EWRA 3OFND 4MKHA 5G53C 3T15A 5EE9A 5E4FA 3D6TB 4A0RA 5FTJA 2GJ8A 2IC5A 2MSCB 2RB4A 4QHTA 3AF2A 4PSVA 3GLGB 1OYYA 3LO5A 4DSUA 4IXNA 2A5DA 1TL7C 3MWJA 2I1QA 4NTZA 3UG7A 1T5LA 1VECA 2XZOA 1IAQA 3DOEA 4WZAE 4DIDA 4U7DA 2AXPA 1ONBA 1XPRA 4KLZA 4RVCA 3NVAA 4ZKDA 1FUUA 2YHSA 3B1VA 4B48A 2JEOA 1JJ7A 3EARA 4HAZA 1TEXA 4LC0A 3X1YA 2XITA 2V54A 2O8CB 1Z6GA 2J1LA 3GJ5A 3W6OA 2GCNA 3R20A 2I4IA 5BN4A 1KJZA 3OEED 1P2UA 2N46A 3K09C 3VNUA 4WXRA 3T1QA 1IN7A 3AH8A 1NKSA 3ZVMA 5FTLA 3IHLA 2ZVQX 1G41A 5EXPA 5TY0A 2A5FA 2QENA 1KMHA 4Q9KA 2KI5A 5JWRA 3ADDA 1MO4A 3NH6A 1W44A 3UMSA 2HUPA 1VPLA 1TUEA 1EFRA 1IXZA 1KSGA 1GG2A 4BZXA 4DCSA 1AM4D 5JRJA 3NDBB 4DCTA 2RHDA 3EZFA 1ZM2A 2PT7A 3NG1A 4HI0E 4QFMA 4BFWA 1D2EA 1VCOA 2Q21A 3TR5A 2ODNA 1LS1A 4D0NA 1CS4C 3I4LA 1S4QA 4JBYA 4RD4A 5HPYB 3TNFA 5EXTA 4KBGA 3HU1A 3B85A 4LHWA 4NE2A 4QBGB 2WPDA 4LV5B 3FWLA 4LV8B 5FBRB 1F6BA 3BJIC 1FTNA 2BMJA 2UKDA 4CEJB 4LBYA 1DEKA 1KO8A 2QTVB 5F9HA 5L3QB 2BIFA 2NPIA 3A36A 2ZJ5A 5CJPA 5FBQB 2ZUDA 3UK6A 4B75A 2DHRA 1IONA 5JSZA 3AKCA 2AWOA 3I1FA 2W2TA 4HDOB 4W7SA 1NIJA 3SQXA 3CRRA 1QHSA 1SKYB 3VR1A 1S3SA 4F4JA 2DCUA 4D2IA 2B21A 3OAAD 2QPOA 1S1MA 5CB6A 2GXSA 1ZMXA 1DAFA 2HCBA 5CK5A 4BEBA 3I5XA 3LDAA 4JVNA 2HXSA 4OJQA 4GZLA 4OI4A 3CF0A 1L7VC 1SVIA 4YQFA 2G0TA 4DFCA 3MRSA 4TTPA 1YZNA 5FOVA 2BMDA 4DBLC 3U44A 2XAUA 5FPKA 4GZMA 1OFUX 3QKTA 1QF9A 4B3GA 4JYCA 2ANBA 3ZD6A 2J0VA 2B7BA 4Q03A 2Q9CA 1YZLA 2D06A 3TW8B 3EIHA 3VR4A 1E96A 5EE5B 3WNDA 4CIDA 3FFBA 4CGZA 2ZITA 5FI0B 3TKLA 1NIPA 4MDFA 2GBLC 3GJ7A 3KUDA 1RKBA 2IK8A 3AP2A 4MKFA 5EE3A 2QORA 1Q1QA 1G4UR 1G1MA 4OI1A 4F92B 2QMEA 3M4YA 3E1SA 4L9WA 4CEJA 2FN4A 4MRRA 3Q72A 1JQJC 3PENA 4BFUA 3KX2A 1U90A 1E0SA 4QC2A 2RGXA 5E7IA 2P5TB 5DO9A 2X8AA 2D4HA 2GK6A 3TQCA 2GAAA 5KPJA 3DZ8A 3NBYC 4Y0AA 2J0SA 3QENA 5G40A 1JR3A 1KK0A 1SVMA 3GLFE 2BCJQ 4C0BA 2DYKA 3QXJA 4OHWA 1BS1A 4LBWA 4E5UA 4NYIQ 2WWXA 2QMHA 2IX3A 3SJAA 3Q85A 1VIYA 2J9RA 2IYTA 3EC2A 4Q1CA 2O8FA 3IHWA 2TMKA 3BBPA 2LCFA 3NC0C 3TSWA 2VEDA 1B23P 2ZRJA 4D0LB 1GL7A 3A1SA 3W6NA 3W9YA 3I3SR 1P75A 2QTHA 5DHFA 1K5GA 4HUQB 4MKGA 4KXFB 1TTTA 2CJWB 4B3FX 4IDQA 3I8SA 1U9IA 3IBGA 4L15A 2HJGA 2O5VA 3NIBA 4IVRA 5KSYA 4RJLA 4G5SA 4B3BA 121PA 1AN0A 4QGGA 4M1KA 4TSFA 5BYKA 2IHBA 1UBEA 2EYUA 2IYVA 4MYCA 4TMVA 2KSQA 4WZ6A 1Z2CA 1TU4A 4JLMA 4TLBA 4PC7A 3R9XA 2GZDA 1G17A 1R0XA 3GLGA 3KJIA 3DM9B 2HF9A 4CVNA 5IRCD 4P4UA 4RZXA 3QOFA 5JFGA 4C0LA 1KO7A 1CEEA 4XVUA 4BFYA 3U7EB 2BJVA 4QBHA 3GCGA 1OXSC 3CR7A 4GRAA 4JKYA 3B9QA 3B8HA 3AKYA 1OH7A 2FWRA 4HLUC 1PUIA 3SDZA 1EFTA 1N5KA 4P4SB 4Q9IA 3NTUA 4RKEA 3R9IA 4JJZA 2OBMA 1F60A 5B57C 2R6AA 4KI0A 4ON9A 4R98A 1NKTA 4E03A 4ZDJA 1Z5ZA 2W6JD 1N3BA 2Z6VA 1SQ5A 4BZQA 1C9KA 1CLUA 3NWJA 4JLAA 3FHOA 4GP6A 3K70C 3AEZA 2A5GA 1WE2A 1KK3A 2XTMA 2WIAA 5CLQA 2O8DA 1MRSA 2Q3MA 3P27A 4JYBA 2BOVA 4RD1A 4TMKA 1S9DA 2GVZC 4HYYA 5D3MA 1G21E 3EZ2A 4CT4B 2G0NA 2WWGA 3MGCA 4D0GA 3JVVA 3P4XA 3Q7PA 1MT0A 4LJ5A 3KFVA 4A2WA 1A7JA 2CNWD 2FJUA 3B1WA 4BLRA 1J90A 1FQKA 4W9MC 4LJYA 3IUYA 3UIEA 1GP2A 1AKYA 1MKYA 5EE0A 1OB2A 1Q44A 2HT6A 2QBYB 2FSGA 2G1KA 4B3CA 2IA5A 4C2TA 4DVGA 721PA 1D2NA 4TT3A 2CLSA 3N5CA 3NC1C 4TQUS 2UVQA 1II9A 3X1ZA 5J4VA 1A2BA 2FFHA 2IUUA 3HYRA 4OK5A 2F1IA 2GEVA 4P31A 2ZS7A 1DE0A 3LVRE 4JLBA 2IS4A 3NEJA 3DMNA 5FBWB 1CP2A 1P62B 3RC8A 2DFLA 3F8TA 3OAAA 2ZS9A 4ACBA 3UPUA 5IK2A 3NBXX 5FTNA 2AL7A 4JMPA 4PAOA 1TF5A 4Q4LA 2W6IA 1LV7A 3UG6A 1II8A 1N5LA 5FPYA 2O8EB 3Q8XB 4TMWA 4OI2A 3WMGA 1M6NA 1XJ0A 4N3NA 1OFHA 5C4GB 2NIPA 4RFSB 1VHTA 4I1UA 4KV9A 2FF7A 2ZJZA 3K1JA 4BFTA 5KNDA 2ZAOA 1WB9A 1JECA 4RCYA 1YZQA 4PAMA 1VCIA 3VAAA 1E9DA 3VR3A 8OHMA 1CU1A 5DISB 2XB4A 1P72A 4IJMA 2WBLC 2G88A 2QUZA 2WJHA 1L2TA 3BOSA 4TL6A 3BS4A 3EPHA 2RHMA 4BECA 4ZCMA 5TDHA 2EU8A 2IEZA 1M7HA 1QDEA 4AKEA 1GSIA 2GJAA 2XNDA 3AB3A 3PUWA 3QXCA 3ZD7A 2IF0A 1G18A 4KFTA 4IEEA 3ZDQA 4D4LA 2J0UB 2H17A 3C7KA 4Q4JA 1P4SA 3CIOA 1HQCA 2VHTA 1EESA 3GLIA 3PQCA 4HAVA 2BCGY 2GKSA 4DT1A 1ZBDA 2P0EA 3I8XA 3DM5A 1XFAA 1KTVA 2JIZD 3KXKA 4M9ZA 1YKSA 3W3AA 5EP4A 2JA1A 3H0KA 3B2EA 3PVSA 4IFBA 4BFSA 1O3YA 5CB8A 3U61B 2FFAA 1X8LA 1HE8B 1NLFA 5JCPA 4UNPA 1FZQA 4Q21A 2IWHA 4F93B 4IRUB 1OHHA 4TL9A 2W2VA 4HAXA 2JLXA 4A6PA 1U0HC 4OK6A 1X6VA 3PEUA 4EUNA 1N6HA 2J0QA 2LWIA 4I81A 4US0R 2C78A 4M1SA 1N6LA 1KO1A 2BBTA 4PXAA 1W7AA 4MA4A 4LHZA 4R2HA 1RRGA 3ZZUA 4BLSA 3WRYC 3AGPA 5EP3A 5JLJA 3ONWA 4B43A 4DDUA 4TTRA 4M1OA 1AS2A 4ZCIA 2O8FB 2VP4A 4G5OA 2V3CC 5FI1B 4L9SA 3A1UA 3PEYA 4HZUB 3VMFA 5FOSA 4AK9A 2OAQ1 4JLDA 2E87A 3HJHA 3FMPB 3QUSA 2QM7A 5IT5A 3X1WA 2ZQ5A 5L3RA 1Z6YA 1MR3F 3A4NA 4TYYA 2QEQA 4OKSA 3I61A 2RMKA 4Q4JB 2HYIC 5EP1A 3OEHD 1XBTA 1CR0A 3CW2A 3LLUA 4XOIA 2MSDB 4CW7A 1GKIA 3ZJYA 4KVGA 2Z4RA 1J7KA 3GJ0A 4KODA 3FKSA 1JI0A 4BFVA 3K0CC 4TYWA 3GJ8A 4ILEA 3U4QA 1EK0A 5K8LA 2ONJA 1ZD8A 1LVGA 2P3SA 2JLSA 2ZJYA 3T35A 2AKAB 3F3YA 2OG2A 3PG5A 1KIMA 1W2HA 1KKLA 2QGZA 4MYTA 2CEAA 3C16C 4NYMQ 3RWOA 4PC1A 4A0GA 1UDWA 2YOHA 3KL4A 1GUAA 4PO8A 3UMRA 3EX7C 1ZNYA 1CJTC 5DN6D 2OFOA 5H8WA 4LCBA 1R0WA 2CHVA 1HTWA 1P9RA 1T91A 1VIAA 3CUEF 3B82A 2D2EA 5FTMA 4B6EA 3PUYA 3K0EA 2WJVA 1UADA 1OLOA 2FSIA 4HLDA 4IDPA 4JBWA 2PJZA 2FEMA 3N2IA 4OQNA 5GJWC 1G16A 3TE6A 4LYFA 5LB4A 2REXB 2F3RA 1Q1BA 2H8KA 2MMCA 1HY3A 2MSEB 2WOOA 4MUBA 4ARZB 5D3QA 4K46A 3HJNA 3AVVA 3FTQA 1F5NA 4DZZA 1U0JA 5TARA 2KE5A 5A5GA 1NVVR 4NH0A 4MKIA 4Q18A 2RGCA 3A1VA 4PO9A 2Q3HA 4N1AA 2ZRLA 5HR5A 1M34E 2F43A 1SVLA 2OESA 3OE7D 3P32A 4BQSA 4DLZA 4F38A 3IO3A 3KB1A 3GJ4A 2YWHA 2GNOA 1G19A 3FE2A 3L8YA 1E99A 4BPBA 2J0UA 2RKOA 4IHQA 1CULC 2YOFA 4PR0A 1XJQA 2C8VA 2CK3A 2ZYTX 4DXAA 2PBRA 3SS8A 2AKYA 1T6NA 3AVUA 2OUKA 3KQHA 1SGWA 4HAYA 1E98A 2CK3D 4ABYA 1TADA 1EG7A 2IBMA 3EIQA 2PEZA 3IIKA 3M1IA 4B32A 1DPFA 4A6XA 2WJJA 4L4UA 4YMUA 2QGNA 3MWLA 3DKPA 2XEXA 1N6IA 4O2RA 3TR0A 1A5TA 2WWIA 3THWA 5F3WB 4Q7JB 1R2QA 1CTQA 4YMWA 3O8RA 2W00A 4C4PA 5J47A 4TZ0A 4F7WA 1CKEA 3SR0A 4B3DA 4EJSC 3SFZA 1T9HA 2RGEA 1V5WA 2EVWX 2IEYA 4OHVA 1OPXA 1JBKA 1JJVA 3LY5A 3CZQA 3RRNA 3L8ZA 1W36D 4KLNA 1G8FA 1NF3A 1SVSA 2CLDX 3QVVA 3NBZC 1XZQA 5BN5A 4AKIA 3TLXA 4WVFA 1LY1A 1OSNA 2ZI6A 2WSSD 4XD7D 1R10A 1J8YF 2QZ4A 1US8A 4WOPA 3BH0A 1G7RA 1OF1A 3SBDA 3WHLA 1YR6A 3SN6A 2G9NA 2EQBA 2QPAA 3RS7A 3WNBA 4ZKEA 1LF5A 1I4DD 1KK2A 4A8JB 1U8YA 4KSCA 4JT2A 1HH4A 3U3OA 3BB3A 3NKVA 2D7DA 4CEIA 5BXQC 4HB2A 4TLAA 1W48A 2OCYC 3DEFA 1VKJA 4JS0A 2OM2A 4M0LA 1G3QA 4IW3B 4N0EA 2HEIA 1YQTA 1YZGA 4KO8A 4PHTA 1QZXA 2J7PA 3GLHE 3HP1A 5TV2A 1KJYA 1NVWQ 4UJ3A 1JR6A 1AZSC 4FCVA 4QNMA 4RCZA 2DY1A 2GXUA 1NL3A 4X8LA 4FWIB 4BASA 4G1UC 4QRHA 1XTJA 1UKVY 4HLUA 2QM8A 4EPXA 3CM0A 1SXJE 1QHHA 2GK7A 821PA 4O25A 3HR7A 5FPSA 3PUZA 5DIFA 3FKSD 3I73A 1DAEA 1II8B 2YC4C 3WMEA 2O8EA 2GF9A 1SHKA 1E2KA 3KTAB 1H65A 1DTSA 2DWQA 5AWFC 3SHWA 5AR1A 2JATA 2YWGA 2LKCA 2XGJA 1E9CA 2PZFA 2J41A 3SJZA 1NY6A 4RY2A 4URXR 1ZCBA 3MSXA 1G20E 2CVHA 3K9GA 1QHIA 4MQBA 4DLRA 2ZI5A 2FH5B 5HKKD 2ORVA 2IYYA 2BVNA 4PPQA 3ZVRA 2IYQA 3ND9A 1YR7A 4MH0R 2QBYA 1F2TB 1UBFA 1W0JA 1N0VC 1IY0A 4Q1DA 2OXRA 4FWTA 1C4OA 4K8OA 1GDDA 2ZYUX 3VTKA 2RGGA 4IOJA 1FNNA 1G291 3WRXC 2X1VA 1E2FA 4TQAA 2DWOA 1G3IA 2XOKA 3QKRB 4FMDF 4LJ9A 1OHHD 5EQTA 3THWB 1K8RA 4HLCA 1TQ6A 3W6PA 1E2LA 2ZE8A 4QNRA 4GL2A 5JBQA 1NRJB 1M8PA 2VO1A 3E70C 2H18A 3U6KA 1BYIA 3ZYCA 1OFTA 5KYKA 1T5IA 1XXHE 4PPGA 4EPWA 3B6EA 1PJRA 1ZYUA 3B7GA 2JIZA 3WP0A 1YRBA 5KTYA 1Z0AA 1E2EA 1E4YA 5KNBA 4LUCA 1G6HA 1BH2A 1GTVA 4OYHA 2WTUA 4G0NA 4BFZA 5GJBA 3LD9A 4WZBE 2QMOA 1CR2A 3ASZA 3IKJA 4TYQA 1NVUQ 5CIWA 5KDOA 2ZRIA 3VR6A 2GCOB 1N6NA 2QP4A 4JBXA 3RS5A 3FHCB 2XOKD 3J81k 1TF7A 4AG6A 2WAYA 4P3YA 1RRPA 2ZSEA 3QKRA 4EFLA 2Q3FA 2ZJ2A 3FFAA 3HYTA 2B8WA 2VYFA 3CPJB 2V8OA 3GJXC 4UNSA 4GP7A 5KDDA 2IS1A 5FOUA 2C9YA 1KI2A 3ADBA 1KMHB 2BC9A 1Z29A 1R0YA 3C5CA 3CLVA 5DH9A 3EXAA 4W5JA 5CDFA 5CIQA 1N25A 3A1WA 2OFXA 1IJFA 2DFNA 5FH9A 4JLOA 5HKKA 1XCPA 2PCJA 1W4BA 2W6ID 1RRFA 4JLKA 2O8CA 4HZIA 1OH6A 4DEXA 4P4TA 2QN6A 1XJCA 5D3MB 5JWHA 2C5LA 4M9SA 1U2RA 2R6CA 3AF3A 3MD0A 4C7OB 4II7A 2ORIA 4PPNA 2O52A 2A30A 3LX5A 5CITA 4KJZA 4LDJA 4ESVA 1NNEA 1CXZA 1E3MA 1G3RA 3U7GA 1ZUIA 4ZI3A 2IL1A 2VSOA 2F1JA 2XX3A 3EW9A 2IWRA 5C4MA 2C96A 2H16A 4JL5A 4YXWA 4A2QA 3ZQ6A 2ZR9A 3RDPA 4LJ7A 4D4MA 3CWQA 4IOKA 4QJ5A 1DAHA 3A1TA 1ZM9A 1WQ1R 1GKYA 3V4FA 1N6PA 3EASA 2QAJA 1CR4A 2Q9BA 3K70D 3B78A 1COWA 1E0JA 3BB1A 2GBLA 4NCHA 4URUR 4C9BA 2IXGA 1LNZA 3W3ZB 1FL9A 1PLJA 3U5ZB 4F91B 4EDHA 2PH1A 4C0AC 1PV4A 4C2UA 1KI1A 2F1HA 1EWQA 4NCJA 3W34A 1SULA 1Q22A 3DO6A
chains in the Genus database with same CATH superfamily
1AX9A 1USVA 2NW6A 1NMQA 1IZ7A 1H2BA 3A26A 1ZZEA 2ZTSA 4IIVA 2OILA 1SKBA 2PBZA 3U09A 4Q66C 3DF9A 3DKRA 1MAVA 5JFOA 1B15A 1VPWA 1SVUA 1XK7A 2R47A 3ND5A 1P6QA 4DC0A 5DNDA 2NSHA 4PQYA 2AOUA 4EMSA 1ZMOA 1O54A 2D1QA 4HRAA 1D2CA 2P2SA 4CL8A 3O9MA 3W5IA 1IJBA 3FJYA 1QAOA 2HLDD 4KNWA 3W8DA 1N2SA 5IDVA 1E20A 2VIIA 2NT3A 4D99A 4F4CA 5JLAA 3USZA 5JHHB 1UWKA 3K0AB 3R3HA 4J6FA 3Q3JB 3EJ6A 3ETGA 4BZWA 1YC2A 2D4AA 4YP0A 5FUYA 4GZ5A 1EP9A 1V47A 3BGSA 1GPDG 1OV4A 3VTAA 3GPBA 3HXLA 5TS3A 4TMTA 4B2PA 4BB6A 2CE2X 1Z8NA 1YAHA 1Y3DE 5CNIA 3VU8A 3DZHA 1P1FA 4K88A 3MGKA 3AEUA 1EWTA 1TJNA 3EDRA 1JG4A 5EKXA 4Z1MD 1Q7CA 5CA0F 5JAUA 1C4KA 1WD5A 5JCJD 2HY7A 3IPYA 1W30A 4QJBA 2X0EA 4GC9A 4HX5A 4EY3A 3EIOA 1DU4A 4WKCA 4MAAA 1KVQA 2NZWA 4KMSA 5J2TF 4UFNA 2FOIA 3FIUA 1CRPA 4HSEA 4RDCA 4Y2XA 1GARA 2ANCA 3VH3A 1N5OX 4FFBB 5JV5A 1KJ8A 4BCBA 1GQFA 1NMYA 5DE3A 1UOEA 5ADVA 5BN3B 5A1TA 1P0PA 4IWYA 3H2IA 2WMNB 1E2IA 1NNUA 2HIMA 4X20B 3VAYA 3SJCA 4JUDX 2SECE 3QXHA 3TRFA 2HBYA 3LQ2A 1JQKA 1V4BA 2GKGA 2GESA 3QV2A 1AY0A 1S3IA 2XNKA 3U81A 2QZZA 1C1DB 1FS5A 1HT2E 1ULAA 1Z4LA 2B78A 2YXEA 3WMFA 1GADO 2QRZA 3AOEC 4DF3A 1TRHA 4PQRA 2YZMA 3UV7A 2FK7A 2XCQA 3K6KA 3HJTA 3CW9A 3KKEA 4M1ZA 4U2EA 4TV8A 3LUPA 2ABWA 3NBKA 2ACWA 1U2DC 4QULA 1NNLA 4MW2A 5BSGA 1SUDA 2G80A 2I03A 4FX5A 3ZGYA 4ZK6A 5CFMA 3WLRA 4JLUA 1P9NA 4AUKA 3HE3A 1EQ2A 4DUGA 2IV7A 1CDOA 4FJ0A 1E5QA 1MAAA 1KR5A 5BSTA 1X2BA 3EFEA 1HE5A 1TQDA 2I0FA 4KJXA 4FW8A 4MYSA 1DWQA 1YL5A 4HLNA 4J0EA 3EDYA 1GTZA 4KIGA 1N6KA 3FSJX 4Z54A 3QFHA 2FQYA 3DVSX 3LQQA 3MFYA 3R0IA 2FLKA 3S68A 2R6GA 1ZNWA 3AEQB 2O1WA 3GG9A 2WV9A 3E4DA 4K6GA 2XTZA 4YMSA 4C0HA 3JRXA 1RQ2A 3FJOA 3RIEA 4GSKA 3ZGLA 3AZQA 4A91A 4NMMA 4BX2A 5BNIA 3KETA 1OAOA 1HNZB 3JVUA 1WEKA 1DX9A 1OJLA 3QFFA 4YMLA 3TQHA 5K8TA 2B1QA 3FTCA 3P2MA 4JL6A 5CUQA 3QBJA 1K66A 2OXTA 4EPRA 5IS2A 1JEQA 5D6OA 2WWWA 2QRVB 1Q0PA 3EDMA 2R1TA 4JC0A 1Y42X 1F17A 1GL6A 2ODQA 3ABIA 3BIFA 1DKPA 1HDOA 4GUAA 1P2SA 2FQ1A 2GEFA 3RAGA 1L5LA 1YBVA 1LK7A 1GNPA 2C3MA 1O08A 1RAGA 1ESDA 3QG5A 3UQZA 5FTWA 5ILQA 5KU1A 2GK4A 1EBUA 1TDJA 3VDQA 1GLGA 3IH5A 4H7EA 4EQ6B 1AMUA 3VKGA 2GZMA 1YR8A 4BO0A 1RE1A 5IAKA 4N9WA 3PUXA 4MR9A 4WZAA 2A0XA 2XZLA 1J8DA 1VE9A 3JCZA 3ISTA 2HNBA 3AF4A 4QX6A 1JH8A 2HO5A 2RH8A 3L46A 3ZWQA 1CVIA 5M29A 1IYZA 5J2TA 2AR9A 3QU4A 4OHOA 2C97A 3T9BA 4DV2B 4HYQA 2IYUA 5B37A 1JIXA 1FFXA 1H42A 4WEOA 2DUWA 3WGZA 3KJHA 4JGIA 1UAAA 4A8JC 2FE4A 2YYYA 3CH4B 4JSTA 5AVSA 4R05A 5DEOA 3VZBA 3AJ9A 4G56A 1X15A 5D2CA 1C0IA 1CUEA 3AV0B 1C1HA 3OT1B 2AFIE 2QP3A 1Q11A 1XZEA 3PE4A 5F9FA 1GPNA 4OJKA 4OK3A 3DA8A 7YASA 1JPUA 1SHLA 1DV2A 5HBRA 3PFIA 1L5HA 1I7NA 3BREA 3IOBA 3PFNA 3TZHA 1SQ6A 3DOUA 3FD8A 3PNMA 4J1TC 3SXJA 2EFGA 4D98A 4HVLA 1IXYA 2Z8ZA 1VHDA 2N9UA 2VYNA 4NLLA 1J5XA 3G2OA 1VZ3A 3O95A 5I4KA 1HX7A 1PZXA 1TO1E 2PZBA 4TUYB 2Z8YM 2QAGC 1NJFA 1HEYA 2BF7A 2HA6A 2NZ8A 3NKFA 3P2EA 4PLZA 2C20A 3PR2B 3IRVA 4FYPA 3RSSA 4DJJA 3IEVA 4G24A 4FZVA 1NF8A 2B69A 2Y0DA 3KVYA 2DR3A 4NDAA 5D5PA 3WZLA 1U7UA 4EOGA 2Z5VA 2OEPA 2Y67A 3JQ6A 1M6EX 3N7AA 1TYCA 1EFAA 4B3TB 2V7XA 5IDQA 4BXOB 3KQQA 1A4RA 4TXLA 3VPBA 4P3OA 1MIOB 5AQEA 3KKPA 3JPWA 2XADA 4XUGB 4I1OA 4RD0A 1T4BA 3U4HA 2HQBA 1GT91 4U3JB 1DADA 1YI1A 4HTAA 3DD5A 3HUUA 2REBA 5ICEA 2JG3A 2GZSA 1I6WA 2BEWB 2GARA 4YRJA 2Q2QA 2ISCA 1PU2A 3IX7A 4NFHA 2C3PA 4WN9B 3I72A 3ND7A 3CNOA 4DADA 4F9GA 3D5TA 4ZAXA 3WYDA 2H1VA 1FTYA 2WE8A 4AECA 1J0BA 4RM2A 2P7HA 1EVJA 2WKQA 1E1RA 3NGLA 3MQ4A 3VNAA 4DVJA 2I7CA 3G2KA 5EAIA 3Q3CA 2ATXA 3PXEA 1SZCA 3IBFA 3OZSA 2FEXA 4O5OA 4ND7A 2HREA 4M3NA 3VZCA 2LD4A 4CLOB 4F1WA 2CNDA 4KIUA 4QFBA 1M1YB 2G6TA 3WLQA 4JASB 1EG2A 5I9MA 1UIRA 3Q87B 4GE3A 4I50F 1DJMA 1H66A 3VPSA 1DJOA 1GN8A 1YZUA 2DPYA 3K0KA 5BO5A 3R09A 4Q7LA 1QTQA 1YS2X 1FMCA 4FVTA 4UXHA 5A5DA 3O94A 1ISHA 2O8BA 1OLXA 4BNDB 2DKNA 1XEFA 1J8MF 3LA6A 1GNVA 1L7BA 1U4OA 4H1UA 1BRMA 5THXA 2WZCA 3OWHA 1RJ9A 1I4EB 1TKBA 3DYBA 4GMFA 9ATCA 4G1BA 8ABPA 2QLBA 2GHQA 1RCTE 1PS9A 1R9GA 3NAQA 5B3KA 1XQ1A 2XPCA 5B6JA 4FT4A 5JZSA 3LQKA 4YTEA 4Z8XA 2V6MA 2YOGA 2WK1A 3QJ5A 3QMMA 3N0RA 5G0UA 3UATA 4ARVA 5FO1A 3VDNB 1P3DA 2IV2X 1Z39A 1QMPA 5FLKA 3ZV6A 3N9IA 4JGGA 3RO7A 1KQGA 3ST7A 4D8XA 4N3BA 1JXMA 3LO8A 4ZODA 4MGYR 3RI3A 4M22A 3V7WA 2WJGA 2JFHA 4PFSA 2GOYA 3OQJA 3ILSA 4LHSA 4MITA 3PSHA 5A3SA 3JQRA 4XVCA 3L7IA 4MA0A 3F9IA 1M1YE 4RA9B 4YV1A 3U37A 4S2EA 5JU6A 1C3XA 3NCHA 4TTAA 3R8FA 2AJDA 2O48X 1M83A 4G81A 4PSDA 1U98A 4IKEA 4UUOA 4LY0A 4EJMA 3PFBA 3D31A 4B4OA 4CF7A 3LKBA 5C46F 1WX1A 4MS3A 2EJWA 3ZXSA 2PD4A 1ES9A 3BCRA 3IFSA 4IINA 4F6CA 4DSTA 2CV0A 1E2HA 1BMFA 2O2IA 1YQ9A 1NLMA 2QTGA 5IULC 3G9TA 3TPZA 4EB6B 2NU6A 3RS0A 2PAAA 2II6A 1FUKA 3LYAA 4G97A 1JGTA 4AW9A 1F4PA 1XJ5A 3VPGA 1TFUA 2MINB 1RI2A 4B8ZA 3ZBPA 3I6BA 3UKOA 1B1AA 3DBRB 5IAJA 2QB5A 4W4TA 1BO6A 1Q6YA 3Q3HA 2BEUB 5GOZA 3PC7A 1R50A 2HA5A 2CFIA 4OQEA 2ZOSA 2FRXA 4URWR 4TQGA 4V03A 4EFKA 1ZMBA 2I2DA 4U0JA 1QHNA 2PBLA 2XYRA 1YSCA 2JJ2D 3DXXA 3EJWA 3HPRA 3JTEA 4GSYA 3U7FB 3W9UA 1K3UB 3SX2A 3IMCA 4DCVA 3KKZA 2WMYA 4FJ1A 1L5YA 2G9RA 4N76A 1MV5A 4H27A 5CBPB 4DC1A 3QEOA 5ICSA 2VSXA 1P0MA 2QT0A 2YDXA 3PVZA 2JIDA 4PO1A 3M3HA 2RHTA 4JSRA 2QTAA 4KQ9A 3ZTYA 3FDFA 2H4YA 2PYIA 1Z0IA 3G8AA 2XXAB 2DH6A 3V8PA 2SCUA 1NUAA 4DLBA 1QRSA 2WF9A 4C03A 4ZCLA 3KSUA 3L8CA 1DX6A 2W2LA 1Z07A 2QW0X 3MMXA 4Z1MA 1KZHA 2FEPA 4J0DA 2D1RA 4X1KB 2O14A 1G42A 1YS9A 2JD0A 4GOLD 4CG2A 1YHZA 3BQMB 5MFZA 1F0YA 3DMDA 1Y3IA 2ZDHA 1PEAA 4IIHA 4E7OA 2IYWA 3FTFA 2GSDA 1LUAA 3JATB 2YRWA 1H1TA 1BA3A 2QRPA 1R0CA 3P1JA 3AI7A 3MWEA 3O4GA 5D5QA 4BUJA 1D0VA 4JQOA 5CT8A 2QJOA 2OC9A 2IP1A 2RBGA 3RUAA 4MVWA 1O87A 2WAAA 2F3TA 3QSYA 2GLUA 1R27A 1G21A 1S8FA 4CKBA 2VT6A 1QIMA 2CFOA 3F8WA 4Q15A 4U2KA 4YR7A 2FVYA 1YR9A 4XM2A 2EOAA 1KSFX 2XBUA 4GU5A 3NTQA 5AVKA 4EGFA 3LCVB 2Y1LA 4BEJA 1Z6ZA 2FVXA 3TPFA 3HEAA 3NALA 2GN1A 2W90A 2G6BA 3EGDB 4J0KA 2CNLA 3FCEA 4CNBA 3HJBA 4GPTA 2C7OA 3TR6A 5LBIA 3TXYA 1WDKA 3O8NA 1MX3A 3T5CA 1XJWA 2IXEA 3Q5EA 4AL4A 4E70A 1XRNA 4JHLA 4UUBA 1R16A 3HA7A 4ND4A 3FPFA 3FWHA 5HCNA 3PLNA 4TWZA 2OB2A 2FEKA 5ED4A 4ESEA 1XC7A 1EMDA 2K7FA 4R81A 1CR1A 3OY2A 1T2DA 4L51A 2HF8A 3LCUA 2C00A 1PQYA 2JI9A 3PA8A 1G0NA 2O0MA 1W9MA 4TS9A 2ZS8A 3WQRA 4LF8B 4REQA 4JC4A 4WNIA 3WDMA 1P1RA 1MOZA 1K6IA 3QFSA 4WPGA 5AW7A 2I6QA 3OE1A 1IXKA 4I3HA 5IZCC 3UTCA 1X3SA 1TGYA 3ZI7A 5E4YA 5DGHA 1L8AA 3A9SA 5CAEB 1JDZA 1KXJA 1Z25A 4QELA 1FNBA 1OH5A 4HH4A 5FDFA 2Q6IA 3NYQA 5ARDA 3AVTA 2BFCA 1AQLA 5F9MA 3T7EA 2WD7A 1TNDA 1RC8A 1HXHA 4EHHA 3SVLA 1JE0A 2WHXA 1VSUA 3K2EA 1MAUA 3CVWA 2JFGA 4KDEA 4NS4A 4RXUA 3IR7A 1RYNA 4LK2A 3TB4A 3IVMA 5LOVA 3QG1A 1VRWA 4KEAA 2C5GA 2Z57A 3DFUA 3PBKA 2JAXA 3ADCA 1K4KA 4Q02A 2R5NA 3ZGZA 1EX1A 1Q20A 2EW1A 2XAAA 1S8OA 1N2JA 3TB6A 3KWMA 4F5DA 1ND6A 1DUVG 2R62A 3O03A 3RRJA 2YJNA 4XJXA 5EZYF 2XUGA 4KRXA 1XXLA 4GM0A 5COQA 5J5VA 1MC8A 1AGNA 3X1DA 4ZAGA 4C6HA 2V5VA 3ZWPA 2IH5A 4ZGGA 4DIUA 1U9IC 1W0KA 5K3EA 3BN3A 2CLLB 1J20A 1DAGA 2QQ0A 3A4YA 1UBOS 3CV3A 3C14C 1B41A 3DHEA 3CO0S 4Q4AA 1T0PA 2G77B 2JGDA 2ID9A 2OD2A 2G0AA 3A3KA 3DLCA 3EG5A 4QYWA 4WGGA 3UAGA 3VH2A 4GLLA 3N28A 3CEHA 4PRLA 1MO5A 1NQOA 1DFIA 1ISFA 1WXWA 2ZJ4A 4G0WA 4JOSA 1DINA 1G20A 1N2CE 3RLIA 1E2MA 1SCNE 2IU0A 3FOEC 1DO8A 3HXQA 1RYHA 1YHYA 3LWBA 4X95A 2AK3A 3QU7A 1B0UA 3ZX5A 2BMWA 4B09A 1GU0A 2ZRMA 4BNGA 1VYTA 2DFPA 1HG0A 5DNYB 2YQ5A 4L5AA 1ZISA 4XTCS 1KFBB 3IT1A 5FUWA 4C2TA 2E21A 1BN6A 1I2BA 2COUA 3NZEA 2HPAA 1BCRB 1KS9A 1WZUA 1VXRA 1Z2OX 2EC5A 2VZEA 2QPLA 3BMCB 3LSYA 4MK4A 5F73A 3Q7RA 5CRIA 1KBZA 4WH0A 4WRRA 4KQJA 4F6RB 3E3AA 3VJLA 5JECA 3F7NA 1JJAA 1SY7A 1W6UA 2XDQB 1P2TA 2O7VA 3C2QA 3M2PA 1VB5A 4JOCA 3BXEA 1UZNA 3UB4A 1EBBA 4Z0NA 1N78A 4NH4A 4MRNA 1IHUA 3FPBA 1W52X 4QU9A 3Q41A 1JW9B 3QPBA 2VJYA 2O3RA 1XD8A 3FSEA 2BH9A 1M8KA 1VP3A 1OVGA 1HPLA 2F6RA 1JT2A 2HMWA 2QV0A 3QLJA 4XD2A 3V1TC 1DT3A 3GPLA 3ETDA 5EQDA 3CNHA 3R7SA 4E94A 3AI3A 4I1SA 4XIGS 4N48A 3KZ1E 3OT1A 3HKCA 5CVUA 4O4JA 3P4YA 1I2DA 2B83A 2AHRA 2VQFB 4R0MA 2Q7OE 1E7RA 1BE0A 5BSVA 1STOA 2EWWA 5G4KA 3NIDB 3CMMA 2F8MA 1NRIA 1CFZA 1JLRA 1YGPA 3SAJA 1Y9ZA 1AUVA 2ASEA 4NQZA 1RI4A 3GCXA 4ZEOA 4KO4S 4C6RA 3D7MA 1LH0A 1O97C 5I7FA 1MJHA 3H16A 4K0KB 3MJRA 4RC9A 5D8DA 4IVPA 1WZEA 5AVWA 2IEBA 2Z0MA 4TZKA 1A7KA 4N7MA 3CXUA 3EUAA 1FBTA 2H54A 3SJBA 2ADFA 1JG2A 1RTTA 4U63A 4D8TA 1CE8A 1S2DA 3AETB 5LR6A 1AQJA 1SVKA 3I05A 2AC2A 1XP8A 2JF0A 1KAEA 3QHQA 1VSBA 3WGIA 1E9BA 2C04A 3KVRA 4EUKA 1R88A 1OBOA 2FU5C 3LT2A 4PLHA 2QZPA 1E3EA 3ZKWB 3RBAA 2HMSA 2QTFA 3CRVA 3IUSA 1GR0A 2BKUA 1QE0A 4H0NA 2VDWA 1UBUS 1FMLA 2R1TB 3GMTA 4OHBA 5JADA 4RFSA 5K0JA 2ZWIA 2LPMA 2X8LA 3FTDA 1ZK3A 3GFVA 1QFJA 5T64A 5TVKA 3Q7SA 1WR8A 5SZKB 3FDZB 3PUKA 3UWMA 2ORWA 1U3FA 4F97A 1ZRHA 5AKIA 5B7NA 4HGRA 4MR7A 4D8VA 5TEVA 3LRXA 1LJUA 4BRUA 4TWBA 1Q83A 4JQSA 4P4LA 5J58A 5FR2A 2O07A 2Q1SA 3GFOA 5CEJA 1Z33A 4C07A 2SNIE 2XWSA 4XQ0A 2BI8A 1V26A 2XSZA 3CF4G 4XSVA 3QFCA 1Y4DE 5KAPA 1U2GC 1U7DA 2ESRA 5DOZA 1UBMS 5AVRA 2QUHA 3D64A 1P0CA 1WDTA 3BWVA 5G41A 3KOUA 3P96A 5TGDA 1RHUA 1WXHA 2OY0A 2Z2XA 5EJ2A 1T0JB 1GKUB 5JS2A 3W90A 3CX4A 2NXWA 5LFAA 1OPRA 2Z8YA 5WRFA 1UBHS 3JYLA 4IH4A 9ABPA 2P78A 1P31A 4V02A 1UKAA 1PQUA 1G3MA 1IHPA 3W8RA 5JXJA 1FXSA 1XGKA 2UZ1A 3FYUA 3AILA 4G89A 3COSA 2FZ5A 5FBKA 5JSZB 5LMZA 1Z28A 2WZBA 4DR2B 2XSZD 1G9SA 5U4XA 1NJGA 2J3HA 4F5EA 3IMEA 4BJ1A 3F5MA 2ZRAA 2ZUBA 2VHQA 1FVFA 1F6DA 3UWKA 3ZXIA 1DVRA 2QXTA 2JLUA 3LW8A 3WLJA 4OSEA 1JSRA 4KMRA 2FSUA 2H48A 4IPTA 4RMGA 4P4GA 1XPOA 2BELA 2FPPB 1M1YA 2ZIXB 4BLTA 3RGWS 3UAYA 3HSSA 2CXSA 1INLA 1OMOA 1Q84A 2QW8A 4IILA 5IFKA 5LYJF 5J2UF 3N0WA 5T41A 1OYWA 2WI8A 4FQ7A 3USES 1W36D 3GHYA 3L1IA 4H18A 4JEMA 4J75A 1NXQA 2ZTVA 1JHXA 1H6BA 4OM7A 4UTVA 4HNTA 1U7TA 2HN9A 4P2BA 4UM5A 4DLYA 5IM5A 5HKAA 1NVGA 4HLQB 3S0JA 4R8KA 1EA5A 3EY4A 3JQ8B 5DMXA 5JZMA 1P19A 2FPLA 1D1PA 3VMAA 1ZIPA 3L0OA 4BKQA 2CGEA 5KB3A 4BFXA 2QN1A 1SBHA 2X7JA 1ZC4A 3NUZA 4HGQA 3BMOB 4D4GA 1EFRD 1SKAA 3OM1A 4Q00A 4COOA 3VSEA 1T1GA 2L82A 1L1QA 1BJTA 5DK6A 4AJLA 4ZV4A 5I9NA 2G8NA 3H99A 1V11A 1CIPA 2I6UA 3PUHA 3W78A 3K0SA 3FMIA 4ZCTA 1VYVA 5JNVA 5HF6A 3U7JA 4WADA 4HN4B 1R74A 4MRVA 2RAPA 1GEEA 5FFMA 4CDGA 5BUZA 1YQEA 2O7NA 3ICEA 4C4RA 2XKJE 4PCUA 4YVFA 4DDVA 5AVTA 4Z9YA 3PD0A 2ZWMA 1LBTA 1ZI6A 3RYHA 4JI7B 3T95A 4OYRA 3SFVA 1ZN9A 2Y1FA 3UXMA 3U1BA 2AUMA 5I7RA 4BE7B 3D2AA 1ZONA 3FM9A 4I2VA 2CJWA 2OWDA 4FYYA 4A1FA 4BGUA 5HP4A 4MW0A 1L4KA 1ZIYA 4IVNA 2ZJOA 2X9QA 5HQJA 1GRRA 2QROA 4I99A 1A88A 3OE4A 3JYOA 2WF6A 2VHJA 3B2NA 3JQAD 1HQYE 3L7KA 1TTTA 2BL4A 2EKZA 1JS1X 1LF0A 5B7QA 1W9HA 1HYBA 4Y2UA 1E1NA 2ZUTA 4RK5A 4G8DA 1S3GA 4DLUA 4CU5A 4DPKA 2QM0A 1DG1G 5AW0A 1SMKA 1YJ5A 2A5LA 4WAUA 3IEPA 4FHDA 3OFKA 5TSDA 3WGHA 3KQYA 1EDEA 3K0CA 2Z2ZA 3AEKA 5ERYA 1OZ0A 3RE1A 3QVSA 5H68A 1GA1A 1S7CA 1L5WA 1E61A 4CKEA 4JXZA 5CTAA 3D6FA 3R3WA 5T67A 4D4JA 4J0GA 3B13B 1E9SA 3O83A 4Q01A 4D92A 3MK31 3DBIA 1JYFA 1OFUA 1DGQA 3QYFA 4M76B 4FOOA 2HCTA 4JKOA 5BP7A 3DP7A 2VCHA 1IY9A 3P0HA 1KEPA 1NUHA 3BTUA 3LY8A 2XA1A 1ZZGA 1NWCA 4OH1A 1MRNA 2KB0A 4HADA 4L22A 3RHTA 5DM0A 5E6RB 2ZQYA 3K70B 3DR5A 4ZOAA 1WW8A 4OQ4A 1H85A 3LI2A 4DQUA 1E1QA 1JLLA 3RTGA 4JI0B 3KUCA 1V1MB 4YRSA 1YXMA 3CRZA 2J9FB 4XVHA 4U2CA 2XZOA 2BEKA 2QG6A 2B5VA 1PNQA 1P2DA 2ZJ6A 4Y2RA 5AHOA 1VLJA 2GTIA 2P8JA 3B60A 2Q7XA 2ODPA 4QTZA 3OZ7A 5DKFA 1N3YA 4BWYA 2W22A 3LY7A 1ENYA 3A06A 5LBTA 2PKWA 3ZHOA 4B5LA 4D9FA 4RYDA 4I55B 1V1RA 1R37A 3AWDA 4GOKA 1DDGA 1LBQA 3PJGA 1PR3A 2B8TA 1G2PA 4IYJA 2PMBA 3I92A 5E38A 2OP0A 4AC9A 3U44B 3L0SA 1FS4A 1Z7GA 3FBGA 2Q5CA 1EP2B 2W98A 2VWPA 2ZI3A 2WJ6A 1V48A 4CQMA 1YZHA 2PYDA 2DFTA 3QF4A 3GA7A 3UXEA 3PICA 5CVJA 3OX1A 4I4TA 2CB9A 5HTKA 1JUDA 2FN9A 1NBEA 1W8DA 2EZ8A 3Q9LA 4FGUA 3UGQA 4Q4DA 4Q9NA 4E4RA 4PG5A 5BURA 1DIOB 3AM5A 3W5BA 4AMUA 1X8KA 1SUEA 2QPTA 1IVNA 1H6DA 2VP2A 3G0BA 3P97A 4UEWA 3REFA 2A9JA 3G6KA 4EFNA 5FUQA 3JAMA 1UPAA 4M38A 1L4FA 2ERYA 2LGJA 4LDNA 1QIKA 4L9AA 3RHFA 4ERXA 2C1XA 1JIUA 4YP7A 1NYRA 1A4IA 3P94A 4D3ZA 3U7QA 2B6HA 3KKLA 1MZVA 5L6LB 4AYXA 3IL2A 3GDHA 3MT8A 4LKRA 4B35A 5IDWA 1FSPA 1U9CA 1W5TA 1NOKA 1KQOA 2V7EA 2XUHA 2JJ8A 4Q3DA 5H81A 4DCJA 5JDIA 4S12A 1F0NA 2XZTA 3IUPA 2LDBA 3B6JA 2IHKA 3NYWA 1XRRA 1CUGA 4H16A 1ORDA 2X2FA 1FY2A 2WAXA 1XTQA 4DL9A 2ZIZA 3U39A 3OF3A 3KOZA 4DV7B 2LR0A 521PA 1APBA 4MP3A 1DC4A 1F4LA 4RQUA 5SYMA 1M10A 4PG7A 4W5WA 1RYYA 3OTHA 4EW2A 3QVGB 4EVRA 4NICA 4PX9A 3AEUB 3RPEA 2ERCA 3G5MA 3NASA 3QEMA 4EP1A 1UFOA 1PR6A 3IP7A 4TWAA 3YASA 3RAJA 4OB6A 1ZD3A 5DCLA 1LEHA 3N58A 1S0UA 4BS9A 4XFJA 4E4TA 1EE9A 1JR3D 1KNXA 4R2LA 3M6WA 4LX0A 4LQLA 3AVXA 5EUCA 3EEYA 2A1UB 2UUAB 3GVIA 1KK1A 4K6MA 2A78A 4KX5A 4X8OA 2G71A 5ITVA 2AJLI 4PHFA 3ASUA 1YT5A 1PLLA 1GVHA 3A4VA 3IULA 4P36A 2IGBA 3RFVA 1ZIDA 1I6LA 2OXFA 1EFCA 2E9SA 1YR2A 3G59A 3C7AA 1WL8A 2NVBA 5C35A 5LLDA 3QHAA 5EHXA 2ODAA 2W83A 3BFPA 4KCGA 4BN0A 5KTMA 3V4VB 2WTEA 3FYTA 3L0IB 3ZV4A 2HFKA 1QU2A 1QRAA 2Q6OA 2K87A 1VL0A 4PYMA 2OCLA 2JBAB 3NGXA 3EXIA 4K6FA 1KKMA 1NI4A 2YW2A 1AKTA 1P45A 2XDQA 4G9BA 4B76A 1RWQA 2FMKA 4WN3A 2NGRA 1UJMA 1MG0A 1E7QA 3HCWA 2Q9AA 3OD1A 3LUAA 5KJEA 3ZU2A 1G6OA 4I50B 5A71A 2A0WA 2QVGA 4F56A 4ZYXA 2P5YA 3FVRA 3E2IA 1QHHB 1U7WA 2PN1A 3DZDA 2YXLA 4UKDA 4LJAA 2A88A 1GILA 1OXVA 1V9SA 4ALIA 3MZ0A 1RZRA 3H5IA 1PFQA 3ITNA 3K8YA 4EFMA 2NUBA 2ZSHA 1PR9A 1SXJC 5K20A 5FWAA 1G5TA 1J23A 3PD7A 4OQPA 5C8YA 1JR2A 4C0JA 4DQ0A 1H8EA 2ZB4A 1SQSA 4DFDA 1JEEA 4I4NA 5TB5A 5H1YA 3GB9A 4EY7A 3JYPA 2XI4A 1RTKA 3HLYA 3AETA 3I39X 4K28A 3R8XA 1G6KA 3LL7A 3L0CA 4X1IA 2P2NA 5F2KA 3RIMA 4BO9A 1RKQA 3LP5A 3CNLA 4TMYA 1V2HE 2QD1A 1DTEA 1Y9EA 4Q6WA 1PGOA 4QU8A 2Q2WA 3SSAA 1S1CA 1FU4A 5DCWA 3T5MA 4DLVA 3AVOA 4RIEA 1JKFA 2EBFX 3DKVA 2AS0A 3C3XA 4IDBA 3MILA 5IWAB 3VPHA 4K6HA 1QGZA 4XH9B 2VBGA 3GK3A 4Q3LA 1JPNA 3ZXYA 4QXPA 2YZ7A 3KHKA 3RUDA 1QQTA 3P9XA 2F4NA 1OZHA 2VP9A 2CUKA 3HCAA 1P33A 2ZIAA 4NDNE 1BU8A 1F9AA 3FOBA 1KO4A 1QH0A 3KEQA 4US2R 2WFAA 4EKEA 4ITVA 4PAQA 2HRRA 1ACLA 1HYQA 4KAAA 2W6JA 2R1ZA 3MPOA 2VRCA 3RS2A 1CB7A 3DHVA 4U1RA 2NZJA 2IS1A 3FVWA 3IV7A 4LA4A 1Q3HA 3WL8A 3PC2A 5LCXA 1NSYA 2WF7A 3THRA 4AX4A 2XUPA 1WBBA 3TLYA 1NSFA 5JSFA 4EL0A 5FFFA 2ALJA 1VIMA 3D0RA 4LWOA 5IXYA 1LBHA 2N42A 1NPYA 2ZANA 1UFKA 4O33A 1ZI8A 2OO5C 3OU6A 3PXBA 4NY1A 3K5PA 1S4MA 2QQ5A 2YNMD 3FXAA 4IDDA 2A84A 4DJFC 2I1VB 1C0KA 4RY0A 4ZVVA 4CF3A 4ZDIA 2ZBQA 3C1OA 1W36C 3RH0A 2JCSA 2CD9A 2XKKA 3RSLA 1JBEA 1NC3A 2B3TA 3RQSA 3H4MA 1RXUA 2OZEA 1KIAA 5ULLA 3FMFA 5C3UA 1KXZA 1RXSA 5IF3A 4EDFA 1WHSA 2WMOB 1WPQA 1C3OB 4MW4A 2Q8QA 4WJKB 4HWSA 3OLVA 1LFDB 1JLSA 4YP6A 1HDRA 3HB1A 2XVXA 5F7JA 1T3TA 5REQB 4TQ9A 3A2NA 4ZCRA 1USKA 1VG0B 1UK7A 4GLBA 4RMIA 1E69A 1LPPA 1E1YA 3EGDA 3GJTA 5DHUA 1GQYA 4Q7KA 4KGZA 3ZCXA 4CV0A 4FB4A 1FP2A 4O6VA 2ADMA 1RXVA 2FMHA 4V0NA 1I6KA 1AGRA 2AE1A 1WY7A 3OEEA 1N1MA 4KSBA 1CNFA 2R4UA 1FCJA 1GUDA 1DHRA 3W7BA 4HATA 4JVMA 1CP3A 1DOAA 1MDBA 3E84A 4QG7A 1PW7A 2J46A 3I8OA 4JVLA 5DM60 3B1YA 1GPYA 1EGHA 3WSTA 3TAUA 3U4DA 4FSDA 4EG8A 3R76A 3FETA 3K32A 2QL9A 3UJ6A 4CTNA 2DBYA 1I5OA 1PVVA 1G8JA 1H0RA 3CLUD 3IP1A 1N2OA 1B4DA 2XKBA 1EUCA 2EDAA 3P19A 1Y89A 4TTSA 3UOAB 5AXBA 4LOLA 3KSDO 4ZEMA 2W2LD 5KOJB 1UJ2A 3TG8A 3V00A 4RZ2A 2HWWA 1NVXQ 3AHIA 1QIIA 5DM2A 4FIZA 1W0CA 4X1KA 1WXGA 3TLCA 4DNFA 3D3JA 3E3NA 3SC4A 2GVDC 2O5EA 2PL3A 1NUUA 2D0IA 5EE1A 1FDIA 1IZ8A 1C41A 3FCUB 3IOEA 3N74A 3EOBI 2VTBB 4KPUB 1V8PA 5EHNA 4PTLA 1DKQA 1Q95A 1E32A 2HA0A 2ZVPX 1ZVMA 2Q45A 4IL5A 4E46A 1JEYA 3O91A 3ZLBA 3BSSA 4MUHA 1Z63A 3IBSA 3FCSB 2VOEA 5NLLA 3WWOA 3FUVA 4O59O 3OOYA 1I8TA 4TMXA 1FDOA 2VP6A 3GNQA 3S1AA 3UXYA 4ZAFA 3KCQA 3X1JA 1YHNA 1EHIA 3ZBUA 4MUEA 1DLJA 2WC1A 1OA0A 4PIPA 1UZAA 2OZPA 2YY6A 2IQIA 4LC1A 4H6PA 1NT2A 3H5TA 4Y6OA 2Q0XA 4C0SA 5A7FA 1I2ZA 3C7CB 3EZ6A 3KTAA 2VQ3A 4MUKA 3D8BA 1ELOA 4BJ3A 3PNBA 3N2EA 5FWYB 1R6DA 1BVRA 1PG2A 3LYUA 5E6UB 2IDZA 3KM0A 2G1PA 4N5DA 2HBQA 2XB2A 4N40A 1BH6A 1XL0A 3HQ4O 1U3VA 3V9PA 2Q5FA 3VVLA 3WWPA 3EXEA 2EL9A 3TNLA 2V65A 2VDWB 1L3BA 1NXSA 1DI0A 1WS6A 1E60A 2X15A 1M76A 1JTVA 3DQPA 2E1RA 2PGIA 1JJBA 1VLVA 3EIUA 3QA3E 4IM7A 3SXUB 1MABB 3OMXA 1GCUA 3MCWA 4YC7A 4O02B 5C2JB 1LVUA 2HAEA 2Y77A 1VC2A 4OAOA 1TMKA 2IPNA 3LT4A 4FDMA 4YAWA 3RFCA 4BTLA 1ML3A 2FZCA 1E77A 2HWKA 4NU6A 3WWYA 1GFWA 1IY1A 3AM4A 2FSHA 1FLDA 1Q2XA 2IUTA 3EXEB 4R9VA 2D6FA 2V7QA 1VFNA 4NCAA 3H11B 1G2IA 1D8AA 4KPFC 1KL7A 4CRWB 3TDKA 1DDIA 2JCVA 3N3AC 5FADA 2XOEA 3VKUA 2AI3A 2EYQA 3DT8A 2IUSA 1DJPA 4QBKA 1RMQA 3ZPXA 2EFEB 3R2JA 5ALVA 4I66A 1GQSA 1I51A 3M6UA 3MJ4A 4AIRA 2PNFA 2ZSFA 3EGIA 3KELA 3OZGA 4L2IB 3B36A 1B0AA 1SBNE 1GNRA 1VE5A 1XEXA 5F5LA 1T9AA 4J4TA 1ILEA 3AVQA 4LFAB 2J45A 3ONEA 1Q91A 3AFIA 4FI3C 4ZOCA 3T5TA 3NEPX 4B3XA 4IXMA 2XA2A 2VT3A 2HGSA 2WTMA 3GEMA 3KE8A 3V5NA 4EUSA 1TOAA 1XTPA 3FNHA 4LSWA 1JXAA 2WJZB 4GE0A 2JCBA 1G2QA 2VSFA 4MI6A 2YJGA 2ZRHA 5JDIC 4EMTA 2GTHA 2VTBA 1ZVVA 5TQ2A 2G67A 2H2AA 1AE1A 2VRNA 1ZC3A 3IR5A 2VI5A 2QVYX 1A9YA 3MS7A 2J3EA 3CW8X 5HCIA 3VO2A 3Q6IA 1I36A 2EFYA 1JB9A 5EP2A 2J5KA 4EUFA 4X6UA 1L8LA 2O3TA 2WSLA 4JYPA 5HE8A 3WYAA 3EISA 3OCXA 3HN6A 4CM9A 4MYHA 4X97A 1M2OB 3PF9A 4EGQA 2CXQA 2XMBA 2OGUA 1HKUA 2QX9A 3QY0A 1ZJWA 3QQ5A 4OP3A 4F71A 4OLFA 4DJ5X 3AP1A 1KJWA 1K8QA 4EAQA 3V8QA 5GY7A 3FTNA 4Q12A 4TKVA 1V4VA 2J6CA 2NU7A 3QSGA 2C5HA 4UM9D 4GKKB 5EVCA 2YZKA 1KE1A 4B8WA 5SYNA 4MEJA 1DQPA 3B5JA 5B5SA 3OUUA 1MVNA 3AONB 1DV1A 1RFLA 1KDOA 1UQUA 3Q10A 4UQOA 2PTHA 1FW6A 1T8TA 5ICMA 3O8CA 3IBTA 3JQ9C 3LUFA 2BM1A 3I45A 4HAUA 4XCVA 4BBPA 1QFYA 2IPOA 4LS3A 1TT5B 3R3ZA 3GQBB 4R1QA 3R74A 5C5CA 1VYUA 5HFAA 3VGJA 4MQLA 2EFJA 3PK0A 3ID6C 1OLUA 2X8JA 3I0ZA 2AZTA 4BZPA 4BPRA 3LXXA 4XR4A 1KSJA 1KBOA 2JKZA 4OUDB 1JEDA 4L6IA 5G1OA 3UUFA 2L0XA 4BNJA 3AJEA 2MT9A 3EUEA 4UPEA 2ECQA 1L5NA 1VL8A 2BKVA 3ACBA 1IZYA 2QAGA 2WKWA 3GDOA 5G3YA 1E5DA 5HEKA 3WIDA 2E3JA 3DOCA 4JYAB 2IY8A 2C5SA