2D7DA

Structural insights into the cryptic dna dependent atp-ase activity of uvrb
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
Knots found
sequence length
652
structure length
621
Chain Sequence
DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/dna
molecule keywords 5'-D(P*TP*TP*T)-3'
publication title Structural insights into the cryptic DNA-dependent ATPase activity of UvrB
pubmed doi rcsb
source organism Bacillus subtilis
total genus 228
structure length 621
sequence length 652
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 2d7dA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d7dA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2d7dA01
2WMOB 2XGJA 2ZS8A 2MMCA 1SQ5A 4QNRA 2I4IA 4CRWB 3HP1A 2X2EA 5JWRA 5F9FA 1O3YA 4F4CA 4DBLC 5FH9A 4UNQA 1WP9A 2FOLA 2PT7A 2XJ4A 1D8TA 2A5FA 3NEYA 2YWEA 4LHVA 1E9AA 4LHWA 4LDJA 3W5IA 4C9BA 3KB2A 3AKCA 2D62A 3W8RA 2PLFA 3ZLJA 1GAJA 1R5BA 1F3OA 3EIHA 3EZ2A 4PAOA 5FOTA 3BS4A 3GLHE 4DDUA 2J46A 3IGFA 1KDOA 4OQLA 1HY3A 5HR5A 4AC9A 1Z29A 4C0BA 5GVSA 4OL0A 2XB4A 2YOHA 1KAOA 3KJHA 3ND8A 2NO6A 2JJ2D 1EX6A 1SVLA 221PA 2OBLA 4PSKA 4AD8A 5EE0A 4N0DA 2VSFA 3QNUA 2GRJA 3TW8B 3J81k 4ACBA 1IHUA 4Q7MB 4NCIA 1KK2A 3BFXA 3U3KA 4XSHA 2ZS9A 2J59A 4DSOA 4D4JA 1VYUA 3LRPA 1CBUA 3TQCA 4UJ3A 1E2LA 3U44A 5IK2A 3EA5A 4QGFA 4TT3D 5B30A 4A15A 2CLCX 3DPUA 1Y63A 3LV8A 4GOXA 1FP7A 4IOLA 4URZR 1X8LA 3LY5A 4DLZA 2CVHA 3TRFA 2ZRPA 1G4AE 5DNYB 4QL3A 4IEIA 4DCTA 4CGZA 1P2UA 4K81B 1AA9A 2AD1A 4FCTA 3EC2A 4FMCF 4TQAA 1M74A 1OFHA 3BH7A 1L4UA 2WOOA 3CRQA 3VHXA 4W5JA 1A2BA 3THWB 2QQEA 4TLCA 3FHOA 3E70C 2PZFA 1M2OB 2PJRA 2H8KA 5FPTA 4Y0AA 2BEKA 1IAQA 4JS0A 3KL4A 1T3SA 4ASUA 1RFLA 1E2HA 4NE2A 4Q19A 4CZ2A 4P4UA 1OKKD 3FGNA 3U3MA 5CDFA 1G9XA 4CEJA 5JJIA 1VG1A 1FZQA 1E79A 4JLAA 4DIEA 3TIFA 3U7FB 3QBVA 2JLSA 3OAAD 4KFTA 5EQTA 5FPYA 2ZRCA 2P6RA 4ABYA 2J0SA 2OUKA 1XTIA 3HDTA 2RAPA 1G21E 2FSFA 3FOZA 1BH2A 3ZQJA 2RMKA 4A2PA 3K9LA 2ODEA 4B3CA 2Q0HA 4V0ME 2JLWA 3IQWA 4RZXA 5D3QA 5FTNA 4RKFA 2JLQA 3K53A 3RRNA 2WWGA 4ZCIA 1KO7A 2Z4RA 1T3LA 3FE2A 1P5ZB 2DBYA 4JMPA 1S0UA 1E2MA 3C5CA 5KO2A 5ANRB 1KJWA 1A82A 3L0SA 3KJIA 3W3AA 2VL7A 4GI7A 2ZREA 1OIXA 1DS6A 1GNQA 4KO8A 4GT1A 2PJZA 2ZUBA 1VYTA 3KUDA 5FUVA 2BBTA 2V1UA 2WKRA 4M1KA 4TYQA 4L8GA 4MKGA 5FOWA 4DKXA 4LBVA 1GRQA 1XJQA 3T61A 4NCKA 4XWKA 3EPLA 2GEDA 1BOFA 1HH4A 2WZQA 1XEWX 1HT2E 1E1RA 4IEEA 2W00A 4DEXA 5FTJA 1P72A 4MGIR 2ORWA 1M8PA 1ZP6A 4TN1A 3I62A 1G8HA 2R6DA 5DO9A 1GRNA 1RKBA 2RGGA 4KXFB 3ICQB 1JR6A 3AKYA 4E07A 3AH8A 1ZCAA 2WSSA 4CEHB 1N6KA 2OXRA 1LS6A 4C7OB 3HJNA 1G3RA 1GNRA 3I32A 4IXNA 3THYA 4MYHA 3HPQA 5EXTA 2XZOA 4TMZA 1NF3A 2MSDB 5IK2D 4KI0A 2BM0A 3WNBA 4A6XA 3ZZ0A 3PEYA 4GL2A 3SNHA 2E87A 2O8CA 3AF4A 2Y8EA 1E4YA 2Q6TA 4OHVA 4Q4JA 1W5TA 1MT0A 1XCPA 3CZPA 4URVR 3WY9A 2QBYA 4KLNA 2O8BB 2OCAA 4QC2A 4AWXA 3KQKA 2HYIC 4I4LA 5BWMA 5KNDA 3UKDA 1XMSA 1XXHE 2OFOA 1CU1A 4OYHA 4B73A 2C9YA 2QE7A 3CPEA 5JS7A 1N6OA 1JB1A 2BMDA 1P3JA 4UNPA 1VCMA 1KI7A 2CDNA 2QRNA 1KMQA 5LD2B 4ASUD 5C4GB 2AWOA 4UJ5A 1JQLB 2EWVA 1ZCBA 2DFKB 1E32A 4URUR 2EFGA 1VMAA 4CEIB 2IXFA 4LJ8A 1S1MA 1WRBA 3TJZA 3OIUA 4R2HA 4Q7JB 1GUAA 2F1HA 4TTRA 1E79D 3PCRB 3CX7A 1NVWQ 4LC0A 3V9PA 3VR5A 1V5WA 4LK2A 5FBRB 4EPTA 1XEFA 4L9WA 4U00A 5D3MB 4E5UA 2QMHA 2AN9A 2ZRDA 1IBRA 4B3DA 3GLGE 2XXAA 4O25A 1XEXA 4EKDA 2PX0A 2QI9C 2ZRBA 4PC1A 3SDZA 3UATA 2ZUCA 1E0KA 3EG5A 4NYJR 3SJAA 5FBVB 5J40A 2WM9B 1JEDA 1FNNA 4JBXA 1S3SA 4GP6A 4MDEA 3QKRA 3VR1A 4FWTA 4D80A 3K1JA 4O2RA 2J1LA 2IS1A 3QXHA 4RD2A 3B2EA 3MLEA 1AGRA 5LD2C 5KDOA 1ZM3A 2IYYA 3E5HA 3KQHA 3U4QA 4TSFA 1P6XA 4DT1B 3FMPB 1N5LA 2GCOA 2X1VA 1AKYA 2VF7A 2CLDX 4B2PA 1MOZA 2RKOA 3U7HB 4S35A 1KDRA 3ZQ6A 3FKQA 2O52A 1E96A 3PXGA 3AVUA 3SEAA 4AYXA 1COWA 1UJ2A 2GXUA 3X1YA 1E9FA 4DDTA 2ZTSA 2UZIR 1GL6A 1VTKA 2JGNA 4A92A 1E1RD 1Z08A 3ZGXA 4IFBA 1KNXA 1GP2A 4LJYA 4B3XA 2G6BA 5GJVC 3MRSA 1AIPA 3PUZA 3EZ9A 2J45A 5IF9A 2FMXA 3QEJA 2V6IA 2WSSD 3IIJA 4KV9A 5K8TA 1MABB 1DOAA 4DJTA 3PUWA 2LWIA 2GZDA 2ZI4A 3P32A 3QF4B 4JT2A 1KGDA 4KFUA 3RYTC 2RGXA 1R10A 4U5XA 4JYBA 1QZXA 4IDHA 1G3IA 2Q3HA 4UNSA 5FI0B 2ATVA 4MUBA 3WRYC 2CJWB 3VKGA 5FBLB 5LB2A 1LNZA 1XWIA 3L8ZA 1Q0UA 1G17A 1D2MA 4Q03A 4QBIA 3RAPR 3TGPA 1ZD1A 4MRNA 2GVZC 2ZVQX 4M1MA 5E7JA 1OH8A 4AKGA 1DARA 3TQFA 4ARZB 4LJ6A 4LYJA 4PHHA 5L3RA 3LVQE 1UDXA 3U7GA 2IYWA 1S4QA 2IXGA 5L3SA 2Q9CA 2X2FA 2D3WA 2QAGC 2QE7D 5FL7A 1Z6GA 3L2OB 5JI2E 2HT6A 3NDPA 1RZ3A 4MITA 4B3GA 2QRZA 2WIBA 3LW8A 4MGYR 1R0ZA 4QGGA 2BDTA 1ZUHA 4NP6A 4D4LA 3QKSA 3NBYC 2G9NA 1ESMA 1N6IA 3AP3A 2OCPA 1T8TA 3HPRA 5J47A 1O87A 1MO4A 3SYLA 3X1WA 4GZMA 4M9XA 2IYRA 1Q1QA 1ZYUA 2VHTA 2WJHA 3GJ6A 4PQFA 4NYIR 4YMWA 3F5FA 3SHWA 3UK6A 3WHKA 1KKLA 4PHFA 3A36A 5EE5B 3VFDA 1AKEA 1ZC4A 4LOAA 4NU0A 5IT5A 2FV8A 4G0NA 4WW0A 4I1UA 4HLDA 1CIPA 4E03A 4UXHA 2ANCA 2AHOA 3GFOA 2V1XA 3RSLA 4C2TA 1KK0A 4AKEA 1GSIA 1PUIA 4I99A 2YC2C 1T3HA 3RDPA 4TL8A 1WBBA 1E0JA 2VF8A 1U98A 2CNWA 2QP4A 2HCBA 5FBWB 3WYFA 1OB2A 3IBGA 1X6VA 5AR1A 3U3JA 1G8GA 5EXPA 3CNLA 4HB2A 2Q9AA 3IEVA 1E6CA 3OEEA 1D2NA 2E1RA 2Q3FA 3SR0A 1Z06A 3IKJA 1OLOA 1II0A 2RB4A 2GXAA 4QM6A 5GVRA 3WMGA 4ZIRA 1DG3A 2O8DB 1OIVA 2OBNA 2QPAA 2I1QA 3PV0A 4MH0R 4R98A 5KUTA 4DLXA 2OO7A 2ZJZA 2WKPA 2J0VA 3E1SA 2QT0A 5TXGA 3LLUA 1COWD 1QHIA 3QPVA 4JL8A 1XTKA 3RSOA 1UADA 3DM9B 1XTRA 2W6IA 1N0VC 2NZ8A 2F1RA 1BS1A 2VHCA 3QPWA 3A8TA 3MWLA 3W90A 3WMFA 1MRSA 5BN4A 2HCJB 4HAUA 5E7IA 1G6HA 1EK0A 4FXPA 4TL7A 4XOIA 4DFCA 2ZU0C 5HTKA 4MKIA 4YMSA 2FE4A 2YINC 3QJYA 3VMAA 4DUGA 1LTQA 5B58C 1NKTA 3GEIA 2WJIA 3FDIA 1HEIA 4Q1EA 4KODA 3GLIB 4LPKA 4LRWA 4M21A 2JATA 2FX3A 1WQ1R 3NG1A 4B6FA 4ESVA 4KFSA 4LGMA 4PXAA 5CB6A 5GADl 1YHNA 2DWOA 3Q9LA 3PQCA 2EYUA 4HZIA 4MYTA 1U90A 3LVRE 4BWYA 2Z43A 1XBTA 3GJ7A 1WDTA 4G5OA 2FGJA 3B5JA 3CRW1 2ZRGA 4MGZR 2ONKA 3JZMA 3NVAA 4KFRA 2I1VB 4GP7A 5E7MA 4WZBE 2A5DA 4DLVA 3H0KA 3REGA 2B92A 4PC2A 4Z51A 4R7ZA 3REFA 3QXSA 2WJVA 1RRFA 5FL7D 3QY0A 1P2TA 4XWOA 4Y0VA 1M7HA 4OHWA 1G7SA 1K8RA 2FSGA 1P9RA 4ITRC 2E9SA 3HYTA 2PZEA 2NZJA 5J4VA 1EWRA 2F9LA 4DC9A 5AJXA 3JZAA 3O8DA 1Q44A 4U02A 3VQTA 3WNDA 1YRBA 4D2IA 2QSZA 2IHYA 3Q7QA 5FL3A 2X8AA 5AJWA 1TF2A 2CL6X 4PAQA 4V0MA 4QJ3A 2R9VA 2WBLC 4PHTA 3IEUA 4MKHA 4DB4A 2W83A 4C0LA 4IDNA 1W2HA 4NBSA 1G16A 3WBJA 3T15A 1W49A 3KQUA 2QPOA 1T0HB 3ADKA 3VR4A 2F1JA 3GJ4A 2GXQA 1PZNA 1N6LA 3DM5A 3PEUA 4B32A 2GBLA 3I73A 3DMNA 4BUJA 4LJ9A 3AVXA 2CK3A 2CNWD 4YLGA 1SKYE 1OW3B 2IF2A 4EIWA 2DR3A 2FPKA 2HXSA 1N5IA 2KI5A 1PJRA 2IA5A 3K9HA 2IS6A 1FMJA 1OH6A 4R71A 1LB1B 2D7CA 3MUFA 2ZJBA 4NL4H 4YMUA 3OEED 4JKYA 2IYSA 3AP1A 4TMVA 5HPYB 4Q9KA 4JBYA 2BKEA 2VP5A 1P73A 4OJQA 1JI0A 1E2GA 1T0JB 4LJ4A 3LH5A 4M4SA 4WOPA 3VMFA 2QM8A 2YC4C 5JCPA 1DADA 4BGDA 1L2TA 1KK3A 3OEHA 3AVPA 3TBKA 1J2JA 5FBQB 1JECA 2XNSA 5FTMA 1KZGB 1UPTA 1NSTA 2C2HA 2HF8A 1E69A 2W6ID 5FFMA 4KCGA 3CH4B 5DN6A 1ZUIA 2CVFA 3VR3A 4A2QA 3BB4A 2A3RA 5CYOA 4AKIA 5AJVB 1P60A 1QHXA 4Q00A 1P9NA 1T91A 2R44A 1OFUX 2FG5A 3CPJB 2D2FA 3M0EA 4Q01A 4LJ5A 1Q12A 3M4YA 3VU9B 2AX4A 1YU9A 2DYKA 4ILEA 1K5DA 2AXNA 3BXZA 4DUGD 1A1VA 1KKMA 3THXA 2N42A 1X8KA 2PEYA 3LW7A 3LWNA 2QSYA 1IOZA 1M34E 2QP9X 3WYGA 2N46A 3K0FB 1XXHA 1VHLA 5JJKA 1ZM7A 2ZI7A 4JLNA 5P21A 2IF0A 4UNRA 5KNCA 2ODNA 3QBTA 5JEEA 5CIWA 1CULC 4DXAA 4KBFA 2WOJA 1SKQA 2VYFA 4BFYA 3TUIC 1F2UA 4V03A 5DISB 2ZSFA 1Q57A 4NMMA 3SYNA 4C0JA 3B1ZA 1QHYA 2CMKA 4OQXA 2FEMA 2QG6A 2VP9A 1NVVR 1T5IA 2NQ2C 1VG8A 4N0EA 3U60B 3LD9A 3X1ZA 1E2EA 2BVNA 4C0AC 4UQOA 1G3MA 4NCJA 2DPXA 4ZDWA 2FZ4A 1NG9A 5F3WB 1KOFA 5GJCA 4Z8XA 2WTUA 3C4JA 5BYJA 2SHKA 1OXXK 1FUKA 3NBFA 1KO5A 1XP8A 2ZR0A 5DLQC 4DLUA 4LV6A 2F6RA 4D0LB 1G291 2NMVA 3FPNB 3BAFA 4QG7A 4B3BA 4GOJA 4TTQA 3KJEA 4DDWA 2VSXA 1W44A 5HCIA 2ANBA 2R6FA 2A5YB 3DOEA 4FWIB 2P5TB 3NTUA 1AS3A 1G3QA 1E0SA 4LX0A 4DRZA 3AV0B 4IVQA 4MRPA 2CK3D 4NCNA 4C3ZA 2ZRIA 3CUEF 3B13B 1S96A 4L9SA 2OILA 2O8CB 4ESHA 1OT3A 2IK8A 4HLUC 4GRAA 2HEIA 1M7BA 1MKYA 2G88A 1UKEA 3SBEA 2FJUA 3KTAA 4Q4JB 2C77A 3AKDA 2AXPA 2QBYB 4URXR 1HT1E 3ZVMA 1KYIA 2J0UB 3IIKA 1U9IC 2R65A 1QG4A 5IRCD 1UBGA 2QN6A 3OEHD 5ELXA 1FL9A 2V54A 4WZAE 3CR8A 4JL5A 2PLRA 1Q3TA 2QQ0A 3B82A 2DFTA 1XMVA 4IXMA 3DHWC 1U0LA 2LKCA 5DN6D 3V4FA 4F92B 3KUCA 1F60A 3WHLA 2H17A 3T35A 2GCPA 5A4JA 2GZAA 4RVCA 4DDVA 4F93B 4TZ0A 2CXXA 1UBCA 2F55A 3TVTA 2P5SA 4HB0A 3AM1A 4M1SA 3G0HA 2C99A 3AF3A 1NMYA 2WWFA 4WIAA 4C2UA 4MDFA 1ODFA 3Q7PA 3KDSE 2XXAB 1XEXB 3ZD7A 2XTZA 3WYAA 1YVDA 4OK5A 2FSIA 3CW2A 3KB1A 4PO9A 1ZW6A 5KU1A 1NY5A 3B78A 3VTKA 1IXZA 1YZTA 2OESA 1W4BA 2V3CC 3EA0A 4OHZA 1JNYA 1NIJA 3CWZA 2ZJ5A 1NMXA 1YR6A 3QQ5A 4OK3A 2GKSA 5CJ2A 4A4DA 4HAYA 2QU8A 2J9RA 3NH6A 3B9QA 4M53A 1SZPA 2QEQA 4WA7A 4DCNA 2HF9A 3AVYA 2FNAA 3R9IA 3U4QB 3PFIA 1CLUA 4M22A 1DAIA 4BPBA 2GCOB 4KU4A 2IHBA 1LW7A 2GILA 3EAQA 2W58A 4HLCA 3B1XA 5C4MA 2RHDA 2NTYC 3LO5A 5FOXA 2F1IA 4BZPA 3NHBA 3CF6R 4EPWA 3QSYA 3FMOB 1SHKA 3CLVA 2DFNA 2NOAA 4NCHA 1KJZA 2WWWA 3KKMA 2CEAA 4XD7A 1Z0FA 4UXJA 5FOUA 4OJKA 3WRXC 2DWQA 3K9NA 5JHGB 2C04A 3G5UA 1JJ7A 1G20E 2Q3MA 4FCVA 2WWHA 4QM7A 3EZ7A 2VHUA 1RIFA 1T6NA 1N0WA 3JVVA 2GVDC 3N2IA 4NPHA 4URWR 4EQ6B 4M1OA 2B2NA 3ADDA 4Q4AA 2O8EA 4A6PA 1NBME 2HDNB 2Q9BA 3DZDA 4JLOA 5TB5A 2EWWA 3AGQA 4JZKA 4ZKDA 4OKSA 3FMIA 4KJZA 4YC7A 3A4NA 1FP6A 5EZ5A 4OI1A 4A1FA 1WB9A 3LFUA 2PBRA 4TL9A 1WXQA 2ZJAA 2IWHA 3TVDA 2D06A 2QT1A 3ASYA 4RD3A 1D2EA 3BH0A 5FTLA 2A78A 1QHNA 1KI1A 4IFEA 5CLQA 4CVNA 3UXMA 3OFNA 2IYVA 4BASA 1E9BA 1HTWA 4FIDA 4QJ4A 4KHZA 2ZR9A 2H7VA 4MYUA 2WPDA 4RFVA 5L3SB 1DAMA 1YZUA 2OFWA 4XSGA 1G8PA 4K8OA 3CX6A 1HURA 1QBKC 1KO8A 1CR0A 3T06B 3WBKA 5CLLA 1VKJA 3BORA 1W0KA 4Q9LA 5DYGA 2CBZA 4TMKA 4BEJA 1Z6AA 2EU8A 5FPSA 1YQTA 3UIEA 4D26A 1JJVA 2QZ4A 5FUXA 2CE2X 2IYTA 4A0HA 2UKDA 1A7JA 1NRJB 2N1BA 3IUYA 3O8BA 2A5GA 5K8LA 3SJZA 3R9XA 2CL0X 2EYQA 1D5CA 2ERYA 3AUYA 4HLUA 5FUWA 3ETLA 2WJGA 2Z83A 1ZU4A 4ON9A 2ORVA 3RS4A 5KYKA 4GPTA 1KSFX 3MFYA 4KITB 1ETUA 4WAUA 4N3NA 3C8UA 1US8A 1ZC3A 1VCNA 1U9IA 2JLUA 2C03A 2OT3B 4DCSA 2FN4A 1OIWA 4RCYA 4EDHA 1FOEB 4P4TA 1R6BX 1TMKA 2ZSEA 5J4KA 3ONWA 1MRNA 2V6JA 4FN5A 4HDOB 3V4RA 1VECA 4TZ6A 2OXCA 1UEIA 2YWGA 2EQBA 5KSYA 3GPLA 1HE1C 3B1WA 1ZMXA 2GCNA 3W5JA 4EFMA 2YZ2A 1Q3HA 2QAJA 1SVOA 4KSCA 1X3SA 4RFSA 4PHGA 3IILA 2FPLA 3O47A 2FFHA 4GNKA 5LDDC 1R2QA 2AR7A 1Z6XA 3WNCA 2GAOA 4AG6A 2A5JA 3CNNA 1W36D 3SJBA 3K0AA 2YWFA 2J87A 2X77A 1IN4A 1SXJA 4XD7D 5L3QA 1VCIA 1YR9A 3T1TA 2OAQ1 4BZXA 3ZZTA 1E98A 1XB2A 3DO6A 4KYIB 3KKOA 4FMBB 4JSTA 4V0OA 3FKSA 1A5TA 2JASA 2IEYA 6Q21A 4PQYA 3Q85A 1E94E 2VBCA 4JYCA 1QG2A 3AUXA 5HE9A 2NO0A 1FW6A 4W7SA 1N5JA 5JCZA 1RPZA 1Z6YA 5KDLA 4LC1A 4PZZA 4P31A 1TEXA 4D4MA 1SVWA 1KK1A 1E2KA 1CS4C 2BWJA 1YZNA 3QOFA 2FPMA 5JS8A 1OPXA 2F7SA 2ZRNA 3CRMA 3VR2A 1Z0AA 1ANKA 1NJGA 1F5NA 4G5GA 5B57C 4K46A 2WWYA 4B44A 1Z07A 4AYWA 3RRMA 4V0NA 4C30A 3NKVA 3OFND 4RY2A 5KSZA 1CRQA 3C14C 4B75A 1YRAA 2O0HA 3FWYA 2QTFA 4POAA 3W6NA 2ERXA 1R8QA 4M1YA 4ZDKA 1E9EA 4HZUB 4PSVA 1BYIA 2WPDD 1RYFA 4DLYA 1DAFA 1YR8A 3FHCB 4QHTA 3RC8A 5KSOA 4A0RA 3H84A 4PPQA 3W9YA 2J5XA 4UXIA 1VCOA 1W0KD 3QE0A 5C18A 4D0NA 3DL0A 5LB4A 4F4JA 3QENA 2QPTA 4G5QA 2NGRA 2R8RA 1JAHA 3TSZA 4Z1MA 4F91B 4CIDA 4YDHB 1KO1A 1FMLA 3QVVA 3GLFB 2P2LA 2B8TA 3RC3A 3SI7A 3U61B 1VHTA 2J3EA 3CRRA 4Z54A 1R0YA 3D6TB 4MQBA 2NPFA 3UWKA 3AF0A 1KI9A 1NVXQ 3IDQA 4P4SA 5A0FA 3AVTA 1OJLA 1OV4A 4A8JA 3ZIAA 1JPNA 3BJIC 3SHFA 3SQXA 1GIAA 1Z5ZA 2CL7X 4X8LA 2BCJQ 1SVIA 1X1RA 2WMNB 4Q7LA 4KSBA 1AS2A 2QAGB 3GP8A 3LBNA 1EXMA 3NIBA 3Q5DA 2ORIA 4B76A 3I1FA 1NN0A 4XVRA 3GLIE 3DDCA 3MGCA 1OHHA 5UKDA 4E09A 3EIQA 4PTLA 1ZNWA 3FHTA 3TAUA 1N2CE 2VP2A 1CXZA 4JL6A 1CR1A 3UMSA 4Q9HA 4DLTA 2ZR7A 5H68A 3NDBB 3QUSA 1HQCA 1NNEA 5J5CA 5KPDA 1E4VA 4JLJA 3MCAA 3MWYW 1Q22A 2GAAA 4NONA 4XH9B 2D4HA 721PA 2WV9A 2CE7A 3ASZA 3UPUA 3B1YA 1TPZA 1FNMA 5EZ6B 2IUUA 1SXJD 1MR3F 1FFHA 3S1AA 1FQJA 1DELA 4WXRA 4JLKA 2ZAOA 4GZLA 2GBLC 2Z4SA 3ND9A 4RZ2A 1QHSA 3FKSD 1B23P 1GTVA 1DPFA 3I8XA 1WA5A 4B2IA 1CJUC 2YOGA 1L8QA 2VH5R 2HYDA 3THXB 2VPPA 2GF0A 2GJAA 3EC1A 3MWJA 4B71A 5F2EA 2HXYA 2O0KA 3T1OA 2ZIAA 3K0SA 4DHEA 2AD5A 1VIAA 1KJYA 1J90A 1R5NA 3AEZA 3C16C 3PENA 3A37A 2JCSA 4PFSA 1GRRA 5E4FA 3SJCA 2ZPTX 1BIFA 2AK3A 1OYYA 5BXQC 5SZIA 4QXAA 5F98A 3C5HA 2D2EA 1TEVA 4X8HA 1FQKA 3ZYCA 2VHJA 3T5DA 4B48A 2ZSBA 2TMKA 4JVSB 4B2LA 1KY3A 2MSEB 5C46F 1JPJA 1ZJ6A 1XD8A 1DTSA 2NO9A 3NEJA 3IHLA 1M1YE 4PPNA 3I5XA 3GLHA 4TSFD 3BE4A 3K70D 1E2QA 3A4MA 4HB4A 4MGKR 1Z6TA 2V4ZA 5HE8A 2XSZA 2ZRLA 4V0KA 1XDBA 3I3SR 3AVQA 3WP1B 1D9XA 4Z1MD 4YONB 1DVRA 1IJFA 3C7KA 1QHHB 3CRVA 1CEEA 4WZ6A 3B85A 3TUJC 3C41J 1N6PA 2BBWA 2GZHA 2FH5B 2ZS7A 2JLZA 1I4TD 4C7OA 4LV8B 1L4YA 4HUQA 4IKEA 2EFEB 3ADCA 2CCGA 3A4LA 4BFVA 2F43B 3U5ZB 4PC7A 3TE6A 3ZIAD 1D9ZA 3EZFA 3FFBA 4QRHA 4C4PA 2ZYUX 3P4YA 5CDFE 1N0UA 5TVKA 1LY1A 1E2JA 2D74A 1CKEA 4BZQA 4PC3A 2A30A 3RRZA 3VKWA 1IXSB 3CPHA 2KBEA 2ZROA 2IL1A 4XTRA 5FUYA 1PV4A 1E3MA 1T4GA 2ZI3A 5GJWC 3L8YA 2H1LA 2PT5A 1OHHD 4XJXA 4BE7B 3FB4A 1HQYE 1XRJA 3DMDA 4HDQB 3R20A 3R9WA 1ZD8A 5H70A 3VHLB 1J8MF 4JVMA 1VG0B 2ZVPX 1GKUB 1UKZA 4TMXA 1AQYA 4RCZA 2NPIA 3RS7A 2AKAB 2OCYC 1KI6B 4TLEA 3THOA 5BQ5A 4BFXA 3X1XA 3KKQA 4LI0A 2O5VA 2HJVA 3SOPA 2V8OA 3QXXA 4TQUS 3MG9A 2AK2A 1S1CA 1QVRA 2KBFA 1JEEA 5CK4A 2REOA 4DLRA 1KO4A 2B7CA 3EWAA 3PUXA 2IYXA 4BLPA 5FPHA 1TAGA 1FPMA 2G77B 2W0MA 3TKLA 3KXKA 4BFTA 4F38A 5G3ZA 3FWLA 1S8FA 421PA 4B35A 1RJ9A 1TNDA 4G5RA 1KZ7B 1X8JA 1P4SA 2YKGA 3K0CA 2JA1A 2XITA 4BEBA 1S9DA 2ZRAA 3RLFA 2GNOA 2VIIA 4MRSA 1C9KA 3VX4A 4HEJA 5DHAA 4F7WA 5DH9A 2ZJOA 1G64A 4B74A 3UMRA 2PEZA 1EG7A 1N6HA 4A82A 4OK6A 4B43A 3U2QA 4HAVA 3I5YA 1CR4A 4ZKEA 1KSHA 2BM1A 4HATA 2GF9A 4PR0A 4Q1CA 5L8VA 4JLMA 1XJ0A 1DG1G 2BKUA 1Z0DA 2QNRA 1RW4A 3F8TA 4YMTA 1W48A 2WICA 2ZJ2A 4FINA 4LBYA 2CHQA 4MA4A 3RWMB 2BBSA 4CYMA 2WVJA 3A1SA 3SFVA 3U44B 2OHFA 3R7WA 5KTYA 1DEKA 3W8NA 3FTQA 1IJEA 1UBFA 1TQ2A 2ECKA 3GMTA 3KKNA 1Y3AA 4R9UC 2WJJA 4AURA 1E2DA 5EE3A 2AKYA 2B21A 2ZRMA 4TTPA 1N25A 2AL7A 2CHVA 3KKPA 1W36B 2XSZD 1E2PA 4TMTA 1ZNZA 2QM7A 3BFVA 2OSBA 1YKSA 3PJRA 2FDCA 4ACAA 4QBHA 3P1JA 2IS4A 5E95A 2QP3A 4PX9A 4ZCMA 1W5SA 4WVFA 1KI8A 3MJHA 3EPHA 4Q4AB 2O8EB 2WAYA 4Q4HA 4JLPA 5EP4A 1XCMA 2RGEA 3LAWA 4QBGB 3WXMA 4AYTA 3OIYA 3B1VA 4RZUA 3EPJA 1FUUA 4CEJB 1E2IA 2IYZA 1GL9B 4DIDA 1Z2CA 4GBMA 1RRCA 4Q1FA 1W36C 1GDDA 5KSPA 2QROA 3BH6A 2FWRA 4ARZA 1RRGA 3BBPA 4EPYA 3SQWA 3PVSA 4JLVA 1TX4B 1Z22A 4JJZA 2ONJA 1EFCA 3QIAA 4A9AA 1KHTA 4XIGS 2MSCB 1NMZA 3CX8A 4IRUB 5TARA 3ZJYA 2G0NA 1GILA 4EFLA 2BEJA 5JWOA 4LJAA 1JXMA 2GHIA 2RGAA 4TLAA 3T1QA 1SHZA 2XTNA 4KBGA 3X2SA 5DHFA 4US1R 2OG2A 4TYWA 3TK1A 1ZM2A 3SZRA 3LQRA 3K09A 3EXAA 3NBZC 2D7DA 3EIEA 3U3OA 1HE8B 1RVDA 3GLGA 3OE7A 4LHYA 2AFIE 2DFLA 4G1UC 2UVQA 5KDDA 1DAHA 4RSGA 4TYNA 3NXSA 1NL3A 5JLJA 2IW3A 4JKIA 5HZHA 2VEDA 4KYUA 1AN0A 4M1TA 2Z6VA 4AIIA 2WWIA 3TUZC 4OQNA 1G7CA 3DVLA 2ZJYA 2ZYWX 3QKTA 1US8B 3N2EA 4F4IA 1RYHA 1DAKA 2XTMA 1TTTA 2WIAA 3TMKA 3H86A 5AUQA 3RS5A 821PA 1G19A 3QG1A 3K0EA 2RGNC 5CITA 2W6JA 4P3YA 1KY2A 1VIYA 1I2MA 4PZLA 1WF3A 5K8UA 4LBWA 2ZUDA 3HR8A 3THYB 2P3SA 1R4AA 4B34A 1AGPA 2C95A 2ZRFA 4JLBA 1N5KA 4NYMQ 4G5SA 1NVVQ 1EX7A 3BB1A 2XB2A 4H9GA 2HUPA 1Z0IA 2G1KA 2OE2A 3N5CA 4CT4B 3K0AB 1D6JA 1GL7A 1BKDR 2OBMA 3Q8XB 4UNNA 5JBQA 1E2NA 1PLKA 1OXSC 1XMJA 1SXJB 2EFDB 1DO0A 2OCBA 4MKFA 3LA6A 4MYCA 4EPRA 1W47A 3DZ8A 3GQBA 2FEOA 3HU2A 1OH7A 4L4UA 1UBEA 1TUEA 1JR3E 4NH0A 1SVSA 2NIPA 3BWDD 4PAMA 2LKDA 4Q02A 4C0HA 4L16A 4BFZA 3Q72A 4FMDB 3CM0A 1NVUQ 2DCUA 1EFTA 2P0EA 5G3YA 2ZE6A 3TSWA 2VP0A 1XPUA 5GJBA 1XU4A 3TAHA 3TR0A 3GD7A 4DVGA 2DHRA 4C0KA 3AKEA 2ZU6A 4TWZA 2IYQA 1II8A 3A1WA 4BLSA 2KE5A 2NO1A 2ODBA 3KFXA 2ASEA 4B3FX 1I2DA 1AQUA 2FFBA 2JLVA 3WMEA 1TF5A 2H16A 4P0TA 3MD0A 4NDZA 4LSGA 3QF7A 3W3ZB 2C5LA 3UG7A 3LXXA 1SXJC 1VG9B 3P20A 3AGPA 3CIOA 4RD0A 4J0QA 3QEOA 2JAQA 3QKRB 1NJFA 2ZRKA 5BW8A 3CB4A 2V55B 2BV3A 3K9GA 1WCV1 1I4LD 3CWQA 3RHFA 1ZBDA 1ZAKA 2NO7A 2RHMA 5TMPA 2IC5A 2QENA 3SU8A 2B8WA 4CW7A 4EJSC 4MRVA 3K70B 4QFMA 2QGZA 4QHYA 1U8ZA 1Z0JA 4AY2A 5G41A 3L0OA 4YXWA 1JQJC 521PA 4XWAA 3ECCA 3CKLA 1AZSC 3BIFA 3AB3A 4FCWA 2BIFA 1OXUA 2WKQA 4Q18A 3OE7D 5CM8B 4ZV4A 3CO5A 5DI3A 4JVNA 4ZO4A 1XTQA 1TADA 3HJHA 2MMGA 3FVQA 3ZS9A 4DSNA 2ZEJA 3D31A 5J4HA 4AKHA 121PA 1SVMA 1ZM9A 4P4SB 3NH9A 4M9QA 3IPYA 4YQFA 1AK2A 4A8JB 3QKUA 2G3YA 1QHGA 5FOSA 1ZIPA 2IEZA 1J70A 2PZGA 1ZRHA 1ONBA 1MO5A 4AI6A 1VDZA 4NKRA 1L7VC 2W6JD 4HUTA 2VRWA 5KPJA 1GFIA 1NN5A 3K70C 5TY0A 2GETA 2PX3A 3IIMA 3HU3A 3QXCA 1KMHA 3LDAA 2C96A 1KSGA 3AVWA 2GTPA 3CNOA 2YWHA 1FX0A 3NC0C 1XD2A 2UZ3A 2XJ9A 5LPNA 1P75A 2IWRA 2CHGA 2OFXA 1XFAA 2R6AA 1W1WA 3L43A 2OV2A 1N3BA 1RRPA 1Z8FA 4RD1A 5EE9A 1EFUA 1XZPA 2I3BA 1UAAA 3M6AA 4G01B 1GVNB 1U81A 3EZ6A 1B0UA 1U0JA 1HV8A 4NZYA 4QHSA 3IPXA 4Q66C 1F48A 1UKYA 1VPLA 4PZYA 3MJRA 5FI1B 3S1AB 4A8JC 2GA8A 5KOYA 5DGXA 1OXTA 4B47A 3VU9A 4IDPA 3EWSA 3RWOA 1KAGA 3P4XA 2RGNA 3OHMA 2RCNA 2BHRA 4ZCLA 3I92A 4JLDA 3T5GA 2XOKA 2R6CA 2REBA 1F2TA 1ZVQA 3K0FA 3QKSB 5F9HA 3X1DA 2R62A 2ZRHA 3PR1A 1AJEA 5JZVA 3KZ1E 1E1QA 2G83A 4YDSA 2BBOA 2R2AA 2YHSA 3BK7A 3GJ3A 4LBZA 3GLFE 2YYZA 3K8YA 4QOSA 3EX7C 3FYHA 3QVUA 3ICEA 1W2GA 2WSMA 3ZVLA 3A6PC 4EPVA 4L15A 5EUMA 2J41A 5FTKA 3NBXX 1HYQA 4EAQA 1XNJA 3RS3A 3U6KA 1E9RA 1XZQA 4LWZA 1YZQA 4II7A 5KHOC 3KX2A 4LV5B 4DWJA 4IOJA 4QNMA 4RD6A 4EFNA 3F3YA 2W0SA 4A2WA 3BD9A 4D4KA 2IYLD 1S3GA 1SGWA 1U94A 2RGCA 3I4LA 3GLHB 2C98A 3LBIA 1EESA 1NI3A 2KJQA 3HWSA 4JJKA 2VSOA 4KVAA 3W6OA 1KI3A 8OHMA 2O8FA 3PUYA 1XJCA 4YXWD 1T5LA 3SC3A 4ZIRB 1M7GA 2LCFA 3R8CA 2IBMA 1G41A 1GG2A 3ZD6A 3NC1C 2BCGY 1SVKA 4LY6A 2WWXA 5H1YA 2W2XA 4QJ5A 5DIFA 1DO2A 1TL7C 1XMIA 3KXLA 4O0MA 2C9CA 1K5GA 1RC8A 3GJXC 4HUQB 4KLZA 1CTQA 1R8SA 3C15C 3B60A 1IY0A 1DAEA 4DB2A 4URYR 4Q1BA 1P9WA 3IO5A 4NTZA 1N6RA 1X86B 1IN8A 2BMFA 4PPGA 5EUQB 4CT5A 4S2EA 1PVOA 1NP6A 2HJGA 3SS8A 2KSQA 2GDJA 1TUIA 1G5RA 2P67A 4PO8A 2VQSA 4PSAA 5JSZA 1Q21A 1A2KC 1G4UR 4IOMA 1J8YF 3IBYA 4PANA 1JALA 2PL3A 4OI2A 4EJSA 4W5WA 1P2SA 3AF1A 1W46A 1LF5A 2G1JA 2J7PA 2J0UA 4LZZA 4P33A 4DSUA 3KQLA 1C4OA 2GWHA 3M1IA 2XNDA 2ATXA 4C0SA 1ZNXA 4Q7KA 3D3QA 3GEEA 5G40A 1NLZA 4OQFA 4PQRA 5EE1A 2P6NA 4GDFA 3SN6A 5JJLA 2F3RA 3T1VA 4B33A 1BYUA 2P65A 1NLYA 3PIRA 3EARA 3NWJA 2OEPA 5G53C 1BO6A 3EASA 1U8YA 1P61B 4JIMA 4Q48A 2EFCB 1S2MA 2JIZA 2VP6A 3N70A 2L0XA 1XCGB 4WBSA 1MH1A 3TH5A 1JBKA 1KSJA 2JJ1A 3I72A 2H92A 3AP2A 1XPOA 3EPKA 5IDVA 1TU3A 2C8VA 1ZIOA 3HU1A 1GKYA 3MAAC 1RJ9B 2XOKD 4PO1A 4JSYA 2QORA 3A1UA 3T12A 3UMFA 1E1QD 2FZLA 2GJ8A 2VP4A 1WE2A 3Q5EA 3UWOA 2ODWA 1VYVA 2ZSDA 1LS1A 3ZZUA 4X8MA 5DYIA 1XX6A 3Q3JB 1OFTA 1CJKC 1K6MA 4CDGA 1PLJA 2JLXA 2IS2A 4YMVA 2W2TA 1QVAA 4V0LA 4B6EA 4NYJQ 4ZDIA 2IXEA 1W4RA 2GJ9A 4QGAA 2KWIA 2YJTD 4Z8YA 2RH5A 2YNMA 1G5PA 1TF7A 1QDEA 1W4AA 3DEFA 4M2LA 5CM9C 4D0GA 2ZE8A 1WMSA 1G7RA 4FD2A 3W6PA 4D81A 5DSZA 3R7WB 3L0PA 3LNCA 1T9HA 3AQ4A 2V7QA 2REXB 5CJPA 1E9CA 4FMCB 2YV5A 2WJYA 3THWA 1IXRC 1GNPA 3K0CC 2QA5A 4DZZA 3ZVNA 3B6EA 3VNVA 5C1BA 2Z0MA 4Q4LA 4TYPA 4W5HA 3PEVA 1H8HA 4EQ6A 3VNUA 5EP3A 1M6NA 1G3UA 1UEJA 2GEVA 3A1TA 3AVOA 4I1VA 4JT4A 5DI9A 4RZ3A 5AJYA 2PMKA 2C9OA 1KDPA 4DLSA 2XAUA 4US0R 1G1MA 5HCNA 2QMUA 4Q4HB 1ZM4A 3QPUA 3IQXA 4JVLA 2H57A 2CCJA 1P7CA 4US2R 5B64A 2W2VA 1W4CA 3T34A 1UKVY 2XZLA 4HAWA 2A2ZA 1Z2AA 4PC6A 3CF0A 2ZYVX 3P27A 4JBWA 4ERNA 2VA8A 3VKHA 1QF9A 2O0JA 4U7DA 1OSNA 1CF4A 4DSTA 1EFRA 2HT1A 2GEUA 3ZH9B 5EJEA 3U7EB 4O3MA 2J7PD 5CK5A 1AM4D 2XNDD 3HR7A 2H5EA 4HI0E 1IQPA 4M8NE 1UF9A 1XXHB 1U0HC 4DCUA 3AVVA 1ELOA 4D25A 1LFDB 2DB3A 3CH5A 1JR3A 3VAAA 2JLRA 4GMDA 3R8FA 3BB3A 4OHYA 1Z63A 5C2JB 1OF1A 1R0WA 4XVQA 4M9ZA 5BN5A 1F2UB 3TSOA 5E3HA 3IHWA 5IHPA 1TQ4A 5JHHB 3GFTA 4D82A 2JIZD 3OZXA 2Z5FA 4LHZA 4EPXA 1CRPA 3B7GA 2PMDA 3MMPA 2AFHE 2JJ1D 3H1TA 1E9SA 3O8RA 1Z47A 3OIWA 4IDOA 2WHXA 4UKDA 1G8FA 1RE0A 2QMOA 5AUPB 3GLGB 5FPKA 1W0JA 1P62B 5DE3A 3L82B 2OM2A 2GESA 1Z28A 2IT1A 1R5OA 4HYYA 1YR7A 2ZE7A 3CZQA 3GJ0A 5AWFC 4G3XA 4LYHA 2IUSA 1GM5A 2BMEA 1YJ5A 1H8EA 3DKVA 3QG5A 4NYIQ 4GSYA 4DLWA 2YVUA 4CEHA 2HLDA 4BQSA 3GEHA 2KB0A 4H1VA 3ZS8A 2QTHA 2ZAMA 4W9MC 2FF7A 4MUAA 3ZDQA 1UM8A 1PUJA 3MSXA 4OI0A 1CP2A 4LUCA 3VR6A 2GJSA 4HAZA 3BRWD 1PLLA 1IM2A 1OFIA 5J4LA 5JECA 1ESNA 1QRAA 3K09C 3JVUA 1G5TA 1G7TA 4GMXA 3GJ8A 2V7QD 4A36A 1JAIA 1I4DD 2GJKA 3G82C 1NSFA 3I8SA 4XTCS 2O8BA 5CYPA 1LV7A 3VX3A 3GCGA 3UG6A 3KTAB 4Q9JA 1KI4A 5EP1A 3SBDA 4GOKA 4HAXA 1IN7A 3FMFA 1NN3A 1GITA 2JDIA 4IW3B 3SFZA 4E22A 5SZJA 4EUNA 1H8HD 3GJ5A 4WXPA 1MO3A 1NKSA 1OB5A 3B9PA 2VHQA 1CJMA 1NBMA 3SYKA 2FSHA 4D6PA 3HYRA 3PEWA 4FMDF 4LYFA 4HSEA 4QBFA 1E2FA 2VTKA 1EFHA 4CEIA 1OXVA 1F6BA 1Z3IX 2FU5C 2ZSAA 3CBQA 4GFDA 2QUZA 4L5BA 4H1UA 2BOVA 5KNBA 3KFVA 1AS0A 1AZTA 5D3MA 2F3TA 1MO6A 2CLSA 1XEWY 4MRRA 3V00A 3UANA 5AK0A 4R2IA 2EVWX 1II8B 4I1OA 3LQQA 4I1SA 1KIMA 4KVGA 5JI3E 4V02A 1E0AA 2Q21A 4LHXA 4IVRA 3BGWA 4ZDJA 3CONA 1EFRD 1OYWA 4TYYA 2G0TA 3W34A 4HZUA 3U3RA 4A0GA 3PITA 1YE8A 3RNLA 3RVBA 5H8WA 2GK6A 1Q1BA 3NHAA 3TLXA 5M04A 1KNQA 1JR3D 2FGKA 2QY9A 4FW9A 4DT1A 2ZETA 1U2RA 2IUTA 4RJLA 1ZU5A 5JWHA 1IY2A 3B8HA 2FFQA 2QMEA 5JFGA 4IJMA 1WBDA 2BJWA 4CF7A 3L0IB 5EXXA 4DEYA 2RGBA 4X8OA 2V9PA 4DCVA 2B6HA 2WAXA 5CB8A 3GLFA 5AUOB 1II9A 2ZJ8A 1DBSA 3RABA 4M9SA 1LVGA 2JJ8A 1BMFA 4OBEA 4N1AA 2B7BA 1W0JD 3GFPA 3TR5A 621PA 2ZITA 4O2LA 4A0FA 1NLFA 5DI3B 2DWPA 2BJVA 2PCJA 2BMJA 1SXJE 3QI2A 4OQMA 4LJ7A 3LBHA 4Q9IA 2IYUA 5TV2A 2QTVB 3RS0A 1Q20A 1NY6A 2QAGA 3FPAA 1H8ED 1N6NA 1J7KA 1Q1ZA 1MABA 2HLDD 2OLKA 1UDWA 3IO3A 1V43A 1OE0A 3BC1A 3QF4A 3PUVA 3E2IA 2R6GA 3O8CA 5BN3A 5SZHB 5BYKA 3KXIA 4LPSA 2RGDA 2BC9A 4IDQA 1ZINA 1YZLA 2H18A 4NHOA 4ZI2A 3TNFA 4OHXA 4Q1DA 1Q1EA 1T8UA 2FFAA 3CF2A 1KMHB 2CJWA 5HKKA 2QGNA 4HDCA 4IHQA 4BECA 1G6OA 1FX0B 3RS2A 2ZRJA 1XD2B 3ADBA 2ZXUA 2XX3A 4IVPA 3ZVRA 2OZEA 3KJGA 1X1SA 1TQDA 5B2ZA 3LXRA 3RANA 1KDTA 1GKIA 4AG5A 1CJTC 5TDHA 5A5GA 2OAP1 2VLIA 4BLTA 2X19A 1GZSA 1TQ6A 2JDID 3F0TA 5CIQA 1DE0A 3H2YA 5K8IA 4P32A 4I81A 2PH1A 5JMTA 2HV8A 4QKQA 5AJZA 1ZUNB 1E99A 1NG1A 4BFUA 1R7RA 1NBMD 5FR1A 4RKEA 4ZI3A 1R0XA 4BLQA 1HUQA 2GXSA 2OLJA 1FTNA 2ZI5A 3EW9A 1F2TB 4LCBA 1XF9A 2J0QA 5FOVA 4QGHA 1P2VA 2YOFA 3OESA 1CR2A 2JJ2A 2PCLA 2J7KA 5HZKA 1XTSA 1YZKA 3SE0A 2F9MA 3U6BA 1CJVC 4BFWA 4BRWA 3LX8A 4Q5IA 4TL6A 5LBIA 1HA3A 4BFSA 5J4YA 1U99A 2A7QA 2ZANA 5SZKB 3BFKA 4C0QC 1IN5A 1EWQA 4OI4A 3OIVA 2A9KA 2GK7A 4RD4A 1G8YA 4TT3A 1JXOA 1LF0A 3A1VA 3LLMA 2IX3A 1TU4A 4TLDA 2ZE5A 1XTJA 4NYMR 1J99A 5FR2A 3DKPA 4PPFA 1A4RA 4BLOA 1GWNA 1Z0KA 4TLBA 1H65A 2EW1A 1XD9A 3DOFA 2DY1A 5EP2A 3I61A 2JEOA 5JEDA 3P26A 1IONA 4HB3A 1MV5A 5L3VA 2XEXA 2O8DA 1S9HA 1EGAA 2K5UA 1DAGA 1GOTA 4TQ9A 2ZI6A 4FI3C 4RFSB 1G18A 2O8FB 1QHHA 4IOKA 4LYAA 3D7MA 1ZD9A 4BLRA 1SULA 4M0LA 3A58B 3BOSA 4ZPXA 1BMFD 2AWNA 2EFHB 5JRZA 1IN6A 1XPRA 4Q47A 3TW4A 1KI2A 1ZNYA 2F43A 1NN1A 3D8BA 1W7AA 3CR7A 1OKKA 5L3QB 4AK9A 2ZYTX 3PG5A 2CCKA 3RRYA 1YZGA 1OH5A 4M1WA 1NIPA 2XZPA 1SKYB 3H4MA 1U8AA 2ZM5A 3LX5A 4TMWA 2NG1A 4KAXA 3FFAA 5JRJA 3MWKA 4XVUA 3BERA 3OAAA 4BRUA 3GLIA 5JSZB 2C78A 2VO1A 2FA9A 2QL6A 2ZI9A 3QXJA 4EJSB 1KTVA 1C1YA 1Z83A 5AUNB 5HKKD 2ZQ5A 1IY1A 2JLYA 3KQNA 1FTSA 4HLQB 1UFQA 1KI6A 4Q1AA 1E9DA 4Q21A 2P6UA 5EXSA 3OF5A 3AF2A 3WP0A
chains in the Genus database with same CATH superfamily
1IBCA 1QUFA 4X91A 2ZS8A 2MMCA 1SQ5A 4YAWA 3TNYA 3VXKA 1ABFA 4CRWB 4WXHA 4N5IX 3HP1A 1QS0A 1XP5A 1BJRE 1WLSA 5FLXA 5LXTA 3HM9A 3QE4A 4EI8A 4HY3A 3BSYA 2WZBA 4LFBB 3O84A 3K1ZA 4X1OA 4LHVA 4D3YA 1E9AA 3QLJA 4F60A 3DHVA 1WKBA 3AX6A 5KNLA 1EFVB 4YUYA 4DLNA 3W8RA 4AECA 2PLFA 1KBOA 3FYSA 3MD9A 1R5BA 3OOEA 1I6WA 4TYNA 3UWPA 4K6HA 3TIIA 5T41A 4TS9A 5ENDA 1CJBA 3S0JA 3GLHE 4DDUA 2Q4DA 2J46A 3IGFA 1NQWA 1KYWA 4OQLA 5F1KA 5LP6B 3LQKA 1VLQA 4AY3A 4AC9A 4I9FA 1L4MA 4C0BA 4D56A 4YPVA 1IQUA 4OL0A 2VCYA 3C3PA 4PS1A 1L7XA 5CB4B 1IEWA 3R3WA 4MIEA 4QATA 3RK4A 3KJHA 3ND8A 3FLBA 2NO6A 1UT5A 1ZJ4A 3U39A 4AD8A 4N0DA 5BT9A 1ZRSA 2Q5QA 2GERA 1HE4A 2GRJA 3S2SA 3TLBA 4C21A 3ED1A 4C5BA 1FRQA 1IHUA 4UBKA 4BXOA 3H9EO 3IUBA 4XSHA 1NFFA 4KAFA 4DSOA 3V4VB 2NU7B 1EFPB 1T4CA 3LRPA 2PGIA 4P7JA 1E2LA 1XU9A 2JRLA 3U44A 4MDHA 3C97A 5IK2A 2HBZA 4A15A 3H1FA 3LV8A 1Y63A 1T36B 3CNBA 1FP7A 3Q9SA 4IDBA 4IOLA 1V39A 4FKBA 2QYSA 4S1PA 5A9TA 4WK4B 3V1UA 5DNYB 2BT4A 2HU8A 4WHMA 1P2UA 4XAQA 4DCTA 1OXMA 2QR2A 5INTA 2ZB7A 2PTGA 3TM5A 1KAMA 1AA9A 3S55A 2AEMA 4GYKA 5K0SA 2FOIA 5A6SA 1YJ8A 3KWJA 1M74A 3CLUD 4FFRA 4HQ0A 1A04A 1WY5A 4E12A 5CFMA 2WOOA 3VSAA 3W04A 4EY8A 1N5MA 2Q07A 1LK0A 1V5EA 2QQEA 2QXUA 5CEEA 4TLCA 5F1OA 1J09A 1OWPA 2FZGA 3E70C 3GLQA 1E9VA 3KPVA 3WJAA 4OU5A 1ZD3A 4KAAA 2PZFA 2GD0A 3HCBA 3H1BA 3KSUA 4KTTE 4YRFA 4YMHA 4AX4A 1JSRA 3HSSA 3F3MA 2HNAA 2Z8XA 4G26A 1E2HA 3EXHC 3Q11A 1UXGA 1KOLA 1G9XA 1DG9A 2YNMC 2EJVA 3C1AA 2OENG 3L7YA 4HXGA 5DM2A 4IFIA 2HGSA 3JASB 4N8SA 4P38A 3PWKA 4Z9BA 1B6RA 4MWDA 4QQRA 3UT5A 4N5MA 2YHIB 1NR5A 1QQTA 4DIEA 5LKAA 3FOEC 2I3AA 3TEFA 3QBVA 3SBXA 4BQFA 2JLSA 1OXKB 2ACWA 1ATIA 4LF8B 5T67A 4CT0A 3QYAA 2OHOA 4E33A 1AKUA 2A9RA 1JB9A 1UL1X 4X7RA 3WE7A 2XODA 3HDTA 3CMMA 3A6KA 4Y2HA 3ST7A 5KTOA 5TNXA 2BKAA 3M3HA 2FSFA 1CJSA 1H9CA 1BH2A 2IP1A 2WP8J 3EXG1 1SBZA 3DDNA 4A5SA 2PGLA 3IP9A 5E9WA 5T6MA 4TX1A 4HDNA 4IHJF 2F9FA 4FOPA 5D3QA 4H4EA 2ZG6A 2JLQA 3VC1A 5GIOE 3PTAA 4H15A 2HOQA 2XTAA 2Z4RA 1T3LA 1LX7A 1P5ZB 3N5KA 3P0EA 2DBYA 4JMPA 1NVBA 3DQPA 4RELA 3AFGA 3IALA 3C5CA 5ILOA 1SCDA 5BN5B 1E7MA 1V3VA 4R2WA 2ZREA 1OIXA 1DS6A 3QQPA 2ZBRA 1PD0A 2CWWA 3ADOA 3WIOA 2BTOA 1IIRA 2OG1A 3ANXA 3K9WA 3LK6A 3OUTA 3OBIA 2WKRA 2WWVD 2V1UA 2CD7A 1OAKA 2OV1A 1VBFA 4MKGA 2NV2B 1T3GA 1X7WA 1GRQA 4YCSA 3QPBA 2W9XA 4MP6A 1XJQA 3T61A 4NCKA 4XWKA 3HWWA 2XE4A 2PBFA 1JEAA 4G1FA 2WZQA 4D44A 1RWBA 3IXLA 3NFYA 2W00A 4GBED 2TMGA 1JLKA 1OQAA 4DEXA 3MWEB 5FTJA 3G9UA 1BE0A 5HVNA 5KKAA 1ZP6A 4FOOA 1O6ZA 2ZDGA 4E07A 2XGGA 4WCFB 3D3KA 5IJ9B 2VFAA 4CEHB 1OASA 4XWGA 1JYEA 5HP4A 1SXHA 2IW1A 1NVFA 2OXRA 4EZBA 1LS6A 1RZRD 3PR3A 1CUBA 1ZN9A 5TSDA 3T4PA 4EK9A 3FSGD 5EXTA 1LSJA 4EGQA 2OVFA 2Y0BA 1JQ5A 1TZ2A 2HA2A 4C1NA 3FZQA 3U4IA 3ROXA 3PEYA 4A0SA 4GL2A 2WB4A 1IEXA 4TS1A 4HEA1 4P7FA 3ZXXA 4ZREA 5C4IA 5EESA 1OYOA 2IH4A 2O4UX 1U7WA 2PWYA 2XQKA 4OAPA 3SQNA 1W5TA 4H1HA 1XCPA 3KK0A 5ARCA 5BNFA 1Z5NA 1M76A 2OCAA 3GNLA 3NR2A 4REMA 5COAA 3MJVA 1WSDA 3VR4H 3KQKA 1E2UA 4LRYA 4JP8A 3MHPA 1NPTO 2HL6A 4HC4A 4KO3S 3SS9X 1YE5A 2NWQA 1Q7GA 4RS3A 2C5SA 1CU1A 3C2QA 3DT9A 5U4XA 4Z7JA 3GRVA 1VJ0A 2QE7A 3CPEA 5G2OA 1GG8A 1MB9A 1H5UA 2VR1A 3D6MA 3HGTA 2EZTA 1TJ5A 3HSKA 3JZIA 4OGGA 3RH0A 3UNXA 4DBZA 1YS9A 2IOHA 5B1DA 3MBOA 1PNTA 1KMQA 2QRNA 5AI9A 1FRFS 1L1RA 3E9YA 5I9TA 4AROA 1RXEA 3H5IA 3L3BA 3VHQA 1U5BA 2EWVA 4JOQA 4BPRA 4M1ZA 1E32A 2X9GA 2YDYA 4URUR 1VMAA 3BIXA 4OJMX 1DC5A 1X13A 5EFOA 1XG5A 3IAFA 1Q0QA 3NLLA 2QD2A 1L7DA 4AKSA 4EY5A 2XUAA 5JQWA 1E79D 1RJEA 3RT1A 4EO4A 3PCRB 2MR6A 3SX0A 4EPTA 3V9PA 4RPJA 4L9WA 2OR3A 4ZZ1A 2RHRA 2ZRDA 1IBRA 5FWXB 3GLGE 1V48A 2LVBA 4O25A 1XEXA 4EKDA 1MV8A 3BQ9A 2QI9C 5IASA 2PPLA 4G8DA 1E0KA 3EG5A 2FQWA 1PR3A 1ORRA 1WBJB 2WM9B 4OHCA 4GX1A 3EMKA 3PPVA 4JBXA 2YUTA 4MDEA 3ESXA 4FWTA 3WGYA 4ABTA 1JDNA 1NZFA 1EJ6A 3O6VA 4YQZA 4WXYB 4XDHA 2YXEA 3U09A 2J1LA 1R6AA 4RD2A 3MLEA 3WKDA 2LPMA 3EVTA 1ZM3A 2IYYA 4GG1A 1GEGA 4JJAA 4XDGA 3E5HA 3GCXA 3L04A 3AOGA 5FF9A 3ZV4A 1P6XA 2MYTA 3L7CA 4PF1A 4RUKA 1N5LA 3LBFA 3VSCA 2GCOA 2X1VA 3ZDRA 1P5HA 1AKYA 4E2FA 1T0IA 2CLDX 3FPHA 1SHTX 3QEAZ 2EKQA 3QUBA 5I9MA 3HKDA 1H23A 1KU6A 3PD0A 4JOCA 4EH1A 5JAZA 4S35A 3U7HB 2ALJA 3COSA 3HKBA 3EJ6A 4KN8A 2O52A 3EZXA 1X19A 3HFGA 3V2UA 3AVUA 3G1UA 1GQRA 3NWOA 3QPDA 1GCIA 5KNCH 1COWA 3CT6A 2F00A 4LG1A 1UJ2A 4OEHA 5MFPA 3SC4A 1E9FA 4W5OA 3R6LA 4F5EA 2UZIR 1KFBB 1THTA 1WV1A 3NANA 2QLBA 1V4NA 4INZA 2BKXA 1JILA 3VPFA 1Z08A 1JDBB 3V5NA 1EM8B 2D0OB 4RVNA 2GPTA 4DARA 1RBYA 2FPIB 4F5WA 5HYVA 2H7YA 3GIDA 2J45A 3DAOA 5IF9A 3CJTA 4E6EA 4KV9A 4GOMD 1V2GA 1PHPA 3PUWA 3BRCA 5DV9A 4KFUA 1Y3CE 3P32A 2GZ3A 1P9OA 2RGXA 3G85A 4HNUA 1R10A 4U5XA 5BN3B 5KJEA 1B1CA 1SZCA 5HF5A 3D3EA 1Y7PA 4BL5A 3IKLA 4G0QA 2XWBF 2ATVA 5BY2A 2R7KA 4JENA 5GINE 1BX3A 2NT4A 2BGKA 4KACA 2PH7A 4ZAGA 4ZQCB 1N2EA 3L8ZA 4UUQA 1C1DB 1Q0UA 4NV1A 4KPFC 2Z6QA 1D2MA 3KNZA 4NZNA 2AEJA 2HA7A 4MRAA 5E38A 3TGPA 1ZD1A 1D7OA 2JHPA 5J2UF 4FLEA 2ZBFA 1OH8A 4AKGA 1DWOA 1DARA 1TCVA 3EG9A 3B9RA 1WMAA 3OX4A 1S6YA 5SY9A 5G0WA 3K9FC 1XI2A 1OWMA 4LHEA 3ZHVA 4ZCQA 2OXIA 2D3WA 3OZGA 3VTZA 3ZCUA 6PFKA 1USGA 1Q74A 3PKIA 3RWBA 3DEIA 3NAZA 4D9IA 2HT6A 1GU7A 5JI2E 4JMLA 4TVBA 2V7WA 3HJBA 3CRZA 3R6TA 2RE8A 4DTCA 2QRZA 3LW8A 1MXHA 2NSDA 1NVMB 3O74A 5D51S 3NBAA 3RE1A 1ODKA 2I7DA 3A1EA 4PSUA 4S3MA 1ESMA 2VQDA 1IZ0A 4YV2A 4HF7A 1T8TA 3H2KA 2B4TO 3DS8A 3BL6A 4ZVLA 3UPTA 4G5FA 1BD3A 1QCCA 4EI2A 3VR5D 3ZR4B 2VHTA 1WZ2A 4ICIA 2WAOA 1IK6A 2W71A 3WHKA 4B85A 4BWVA 3N2LA 5EE5B 5G4KA 3VFDA 1QWOA 4NOLA 2O0LA 2PUWA 2A33A 2JD2A 4G0NA 3SM9A 1SIBE 5JQGB 4I1UA 4HLDA 2ZT7A 1ZLXA 2AHOA 3GFOA 2V1XA 3RSLA 4DVJA 1A88A 5ALXA 3L06A 1WBBA 1ID8A 3RDPA 2I2CA 1CJCA 1DEOA 4TL8A 5DKFA 1ACLA 1E0JA 2BTQA 1U98A 2ON6A 5JDIA 1LNSA 3B70A 4TLMB 4QLBA 1OB2A 3IBGA 4ZTBA 5AR1A 1YIDA 3MQ2A 3FDXA 5EXPA 1F8XA 3UOGA 3N6XA 2YIVX 3CNLA 4LRSB 3STTA 4CE6A 2Q9AA 4RXMA 4DJEC 3M1YA 3ROQA 4PG5A 4MXDA 4XVCA 1HDIA 3IKJA 5AVJA 1II0A 1P1KA 1JTEA 4NEGA 1DIAA 2GXAA 1ZLYA 2AXQA 2PKWA 4KWCA 1NC1A 4LSZA 2OBNA 5ALSA 4KLRA 2G72A 3EA4A 3L4BC 3PV0A 3TIGA 3ZEAA 5LMNB 2OO7A 4X54A 1T3ZA 1U2DA 2P9JA 1EJ2A 2J0VA 5TXGA 3L1UA 3T7AA 2F3PA 3I01M 5KYWA 1B3BA 3FVTA 1BWQA 1XTKA 2JGDA 3RSOA 1NAIA 2VZLA 5J9FA 4EG1A 5B3KA 4PAWA 3KYCA 1HOTA 4JR1A 1M2WA 4Y6PA 3DYBA 1U2QA 1E5QA 2J5QA 2YJ4A 4ZZ3A 5BN4A 2HCJB 2DM6A 2NV0A 3EHDA 5EL0A 4NG4A 4RTJA 4IICA 2QW1A 3BDVA 4K6MA 4CCWA 1CS0B 2BGGA 5HTKA 1E61A 4EHHA 2I3ZA 3GQBB 2FE4A 2WIGA 1JDTA 1VL0A 2V03A 3VMAA 2PMCA 4JQZA 1LTQA 5ELLA 3ZK9A 1Z16A 3FTPA 3OQPA 4FFNA 5DTRA 3MEQA 4JYAB 1JI3A 2P8JA 4KODA 2VYCA 4H3KB 4IGFA 5DTQA 4LRWA 3UF0A 1GCUA 1WABA 1FJXA 1GTSA 1D4AA 3L8DA 2VWGA 1WQ1R 4C2UA 5GADl 1MG0A 1YHNA 2DWOA 3Q9LA 3DW1X 5HFJA 4HZIA 1L3CA 2AG6A 3PTLA 4CM1A 3VPBA 1HYEA 4TVOA 4YX9A 4BWYA 4MQLA 5IPFA 2YWJA 1XAJA 1WDTA 3MINA 4G5OA 2FGJA 3P2JA 1U8TA 1FNSA 4ZJPA 1DHTA 3JZMA 1S01A 1SOWA 3NVAA 4R1TA 2I1VB 4F3NA 3T3OA 1R9NA 4N48A 4BN0A 3MPUA 1I80A 1QS0B 1WU8A 3C4VA 2EG5A 3UOAB 4YEDA 4Z51A 3LHSA 5LXTB 3REFA 4JB3A 4R9SA 4CG0A 2WJVA 5A4KA 1RRFA 4JFRA 4LZLA 1EKXA 3SGLA 4XWOA 4JUCA 4YCAA 3P0IA 1CY0A 1RM3A 1BRMA 2FP3A 4JBLA 4CGYA 1YKFA 1P9RA 1ULUA 3I76A 3PQEA 3QHPA 4ATNA 3S8EA 1DO8A 3K5HA 5L45A 3FUTA 4KOEC 2ZXEA 3IBCA 2R2GA 3ZHRA 3L92A 5KWEA 3WLOA 2F9LA 5AKKA 4DXHA 2VJCA 2PWAA 1MT3A 4PNHA 3RTEA 3JZAA 3O8DA 2UUPA 4QVKA 4U02A 3M6WA 3VQTA 2WUVA 1QC5A 7ADHA 3DVAB 2HHHB 2Y05A 1R27A 3Q7QA 3OD1A 5FL3A 3NP7A 1GPUA 5AJWA 1TF2A 2CL6X 4V0MA 5IULC 4IRMA 1I3NA 5DTEA 5KTMA 1F8FA 1O97D 5LDHA 3HUDA 4C0LA 4OXIA 3GFVA 3WLQA 3U48A 2R7NA 3HCRA 1DDGA 2GBCA 2HHJA 4WKOA 2WVGA 3VR4A 4BXOB 4XM0A 1DUSA 4DBLE 1GZDA 2VTDA 1FEZA 5IMBA 3I9V6 1KERA 4UHKA 5JRDS 1CQPA 3IQDB 1T4CB 1OU0A 3I2FA 3ZNQA 3AVXA 1DX6A 2F48A 2CK3A 4I8XA 4E2WA 3UMJA 1BSVA 2KI5A 2EW8A 3OZRA 2IA5A 2BP7A 1FMJA 4IJ5A 3A4YA 5AOBA 2D7CA 2A6PA 4CQMA 1KZYC 1AXEA 4QLOA 2C7RA 3A4VA 5AI8A 4YMUA 5CCBA 2IYSA 4X92A 4TMVA 1TZJA 2P9GA 2O2GA 4FZVA 4C4YA 2LGJA 5A6SB 4WCDA 4TKVB 1W1UA 1Y9AA 1GVHA 1QFSA 2EBFX 3LH5A 4WOPA 3VMFA 2VDRB 2JGIA 3IAS1 4ILKA 3ICWA 1NXTA 5LA6F 4E0BA 4AS1A 4Y2UA 4A23A 2VPTA 2ZW9A 4PR3A 3LZ6A 4B3SB 2OC9A 1DC4A 1KK3A 1C4XA 5CLGA 5FBQB 2XNSA 2FR8C 1B74A 4RKRA 1ES9A 1NSTA 1RRMA 3JCZA 3O9VA 4QUDA 3MRTA 1E69A 5AHXA 1TO6A 1CNMA 1BTOA 1YL6A 3QITA 1LPPA 1XCOA 3OCZA 4GX2A 4KIGA 1JG3A 1O9GA 2CVFA 3BB4A 3JWGA 4W99A 5LQSA 4AKIA 4QFBA 3WI7A 2WZCA 1PT7A 1QHXA 1T91A 1VSQA 2R44A 1OFUX 1XRRA 2XWSA 2HWKA 3GMSA 5CLJA 2C84A 3M0EA 1R6XA 4Q01A 3H9QA 3LDFA 2NAFA 3I2GA 5BN1A 3ZOKA 3DYIA 3KC2A 2DYKA 3UT5B 5ETJA 3L7MA 4LOLA 2MYPA 2XQVA 5FEMA 3ETEA 1X8KA 3LW7A 5JAHA 5DMHA 1G55A 1GR0A 3LWNA 4NI5A 4PV7A 5CPBA 3MOGA 1R0RE 4G0YA 4R8RA 2K6GA 3D2BA 2QP9X 4DLBA 3B3FA 5J63A 3RI3A 1L9KA 1RLIA 5JJKA 1SU4A 2ZI7A 3ZN2A 4ZC8A 1FSZA 4GLFA 1V16A 5DK4A 4UNRA 1JHRA 2WWTA 1O9HA 2PUTA 2G5CA 3ZWKA 5KNCA 5CMLA 1CULC 2AIRA 2WOJA 1E1LA 1L6IA 4HDNB 2IHZA 4MYRA 4XPZA 5BVGA 4EHJA 4HRVA 4JN6B 4DQUA 2P4UA 1Z82A 2HLNA 1H69A 4L0CA 1PQUA 4NMMA 4YJ2F 1IWOA 2CJFA 3FDJA 4L75A 4CM5A 2PL9A 4KR7A 3ZWXA 3WA6A 4C0JA 2J5RA 3HXOA 3I52A 3ZGZA 2KPOA 3H16A 5JD6A 1N2SA 2DHEA 1PWXA 3KRTA 2QG6A 3SHOA 1VKRA 3MF4A 1ECFA 2V59A 4DCMA 2YWRA 3D7NA 2N3ZA 4MP8A 3LD9A 2R8YA 1VLJA 3ZW8A 5D7NA 5I3ZA 2IZ6A 2PU7A 3AF5A 1E2EA 4GUAA 4C0AC 4UQOA 1X7WB 1Z0UA 1ZMTA 5K03A 1LXCA 4FYMA 3AIIA 1NG9A 5F3WB 3LWBA 1W1IA 2CF6A 3VGPA 1DMSA 3OLYA 3C4JA 4QU8A 4B4UA 3FZGA 1OXXK 3KZOA 1WV0A 3X0DA 3KLNA 3UJCA 1XYGA 4J29A 5DLQC 1PSDA 3UT0A 4Z0HO 2F17A 3BPSA 1ZCFA 3BAFA 4HWKA 1YR3A 1HNXB 3P9KA 4GOJA 1NVAA 1OA1A 2W2QA 2A58A 4TTQA 2G08A 2VSXA 4U7PB 1W44A 4EYSA 4DDWA 2E6KA 3WNVA 3NIWA 4M0KA 2A5YB 2B9VA 3DOEA 1UAYA 3DO8A 3CW8X 3NHFA 4FWIB 2QVGA 3IPRA 1FTWA 4XYEA 4JUIA 4FSHA 4ZMRA 4F4UA 1W2WB 1DTWA 4HWTA 2WE7A 3PFFA 3T7DA 3AV0B 3BMXA 5COQA 2X13A 4CMGA 5MDHA 2ZRIA 4DL9A 3K9QO 2BELA 1SOMA 1H5QA 1S96A 4Y18A 1J0XO 4F86A 4JI5B 4XUCA 2PQ6A 5KI6A 4HLUC 2HEIA 2OM6A 1C4WA 1IZ7A 1M7BA 2YZMA 3RROA 4R7TA 4AB1A 5ENVA 4BGUA 2BFWA 2A0UA 4PSDA 5DHUA 3KTAA 3LHKA 2GTIA 4TS3A 2X7XA 5CVUA 2GF2A 3IERA 4WK2B 1OTYA 4EGFA 1QIGA 4URXR 3JYPA 4ZTUB 5AK4A 2WU8A 2P11A 2GFIA 5CRIA 3ENKA 2DETA 2R65A 2W8ZA 1QG4A 3A9UA 5CTAA 1UBGA 2I8CA 3K0HA 3SHTA 3IOYA 2V54A 5ELXA 1TGVA 2FMKA 3E7WA 4JL5A 5KTPA 1Q3TA 4KKXB 4FDTA 2V6BA 2DFTA 4IXMA 4TWJA 5T3YA 2QL9A 3DHWC 4PX2A 1AGYA 3IXQA 2EARA 1K68A 1GPLA 3WHLA 5IT0A 1SCKA 3VR3D 2GCPA 1U5BB 2JAHA 1FXWA 3TDMA 2GEFA 2WF5A 2GZAA 2ZSKA 4REOA 3H7IA 4EIWA 2OWDA 3HCFA 3NVKI 3TVTA 1Y98A 1DEAA 3D6JA 4OQZA 3RG2A 2E1PA 1S8AA 2DQKA 2C99A 3KJXA 1NMYA 8AT1A 5ERGB 4FSXA 3VVBA 4PINA 4WIAA 4BO8A 2RK6A 2JFPA 4NAVA 3ZWCA 3EISA 1JLMA 5ECDA 5IFKA 2WABA 2ZIZA 2FEWB 3KDSE 1XEXB 1S5PA 3NASA 1D03A 3OZDA 1YVDA 5BXYA 3PXBA 2FSIA 2HCTA 1ZW6A 4IDDA 3ORRA 4RSRA 2QXTA 3VTKA 2FMIA 1IXZA 4P2BA 3SDBA 3T6KA 1N78A 4F5YA 2IIPA 3N8NA 3EA0A 4DRYA 2F3QA 1J8VA 1NIJA 3BKXA 1CWUA 4ZU1X 1VGQA 3RAEC 1I8TA 1DIGA 2WUGA 2J9RA 5B7PA 3H83A 4DCNA 5CDSA 2HF9A 5HKLA 5BSGA 4JX8A 1IMOA 2FNAA 1WB5A 1CLUA 2YJZA 4M22A 1DAIA 1JE0A 4RBNA 5CUQA 3I9NA 2GCOB 3MJ4A 1XZKA 3GGOA 1LW7A 4KU4A 5DT9A 1GCOA 3TB6A 2PKCA 3DF9A 4D9NA 1XTTA 1SU8A 4IF4A 2WWRA 2GLTA 2RHDA 3HKDB 3KTFA 2NTYC 2XYRA 1GGNA 2QY6A 1JHVA 2O2XA 3V7UA 1PL7A 4IH9A 3QEBZ 3HKBB 3WDMA 4ENWA 2E37A 2I91A 5F76A 4IDCA 2QZ9A 4K86A 1GQSA 2A14A 2DFNA 2BSXA 2WWWA 1YS4A 4CLXA 1T5BA 4XD7A 2PA0A 4UXJA 3WRXC 3GRAA 4GQIA 1W8DA 4MV6A 4F6RB 1NNI1 1VI5A 4BX8A 1H3EA 1QTQA 1G20E 3GDOA 3NHZA 3OU2A 2PUCA 1PYOA 3FVRA 3JVVA 1N0WA 3WJ2A 3H11B 5AW7A 2Y92A 3E8SA 4M1OA 4QDKA 5HW0A 3ADDA 2XMPA 4GM0A 4QGBA 4XR4A 5ER9A 3DZDA 5JLAA 3TZQA 4A6PA 1L1QA 4JLOA 1JYFA 1T2FA 1BX0A 2H5JA 3BE5A 4LXIA 2HHAA 1ZQ9A 4MQMA 2QGFA 4OKSA 2A9PA 4UZSA 4Z2YA 3FMIA 3QU5A 1U0SY 5LC1A 2HK8A 1XKXA 3EF1A 5CFQA 2NYAA 2YCLA 4KLAA 5NULA 4YRKA 1ISHA 2PBRA 1WXQA 2Q2OA 1KE2A 3SR3A 2IWHA 4C06A 4YJFA 3TVDA 2QT1A 1R6VA 3GL9A 3TOXA 3WWPA 4BN5A 3PLAE 4DANA 3KEOA 5FTLA 5HS4A 4NMWA 3SM3A 3N8DA 3FTEA 2VCHA 1JFFA 2RG1A 2VAPA 1BDHA 3H8SA 4BMOB 4MLPA 3TM4A 2QRHA 2IYVA 3PNKA 1HTWA 3TXAA 3IYLW 2VJAA 4QOJA 2VN8A 1F1JA 3BHJA 3T1YB 3EG9B 4KHZA 5E6SA 2H7VA 1H0KA 2J6HA 4MYUA 5EJGA 4RFVA 4F9FA 1OJ7A 4RQTA 1OV6A 5G1NA 4MHSA 3T41A 3V7WA 1LV8A 2E4UA 3C3CA 2CD9A 1G8PA 3LXMA 3B1JA 1L4FA 3JATA 4I4CA 2WJ4A 1VKJA 1MAHA 3OH8A 4KNYA 3U4HA 2CBZA 4BEJA 3RAJA 3AK4A 5FPSA 4W7HA 3FB1A 2O6HA 3ZTTA 4COKA 1IEQA 2RAVA 1NWHA 3S70A 3IPCA 3K72B 4A0HA 3HN6A 4B9AA 1CZOA 2GS9A 4IJQA 4ARIA 2ZT8A 2N1BA 3H75A 4IWXA 4XPIA 2Q5OA 5LQJA 4KDCA 5K8LA 4NJMA 3R9XA 1OBHA 2LCQA 2CL0X 1D5CA 1FYVA 3IT1A 4HLUA 5EIFA 1MA3A 4C14A 2VT7A 3TXXA 4MLZA 5G4KB 3ESRA 1WUYA 3QEKA 2H9YA 5EZQA 3LM8A 4I46A 3KQVA 2GBIA 4B5KA 1I7QB 1XAHA 1CT9A 5B1SA 4C03A 2V0NA 1EVZA 4FZ3A 2ZTHA 5ADHA 2DT8A 1ZC3A 1E7QA 4HMQA 1A8IA 3DE4X 2OT3B 1W96A 1AH2A 2PR2A 1NVEA 1WXXA 2HQOA 5J4KA 1C7RA 2GZRA 2V6JA 2BTQB 3R5SA 4FN5A 1MFZA 1I30A 3V4RA 5G02A 3L7AA 4B79A 1QIDA 2RK3A 2V7EA 3KOZA 4UBJA 2CNDA 1NOIA 3CJRA 2QRPA 4C1BA 5M2QA 2EQBA 4FFWA 4LE1A 3W5JA 4G89A 4HX9A 1J1UA 1VBMA 4IO0A 4HH1A 3B3JA 1YB2A 1X3SA 5IJWA 3G49A 3BGIA 2CXHA 3DAYA 1X92A 1XZMA 1YVPA 1UEXC 4L57A 1VPVA 4WLVA 1FIUA 3T1HB 1IBLB 3WNCA 4OM7A 2Z57A 2OAEA 2JK0A 3IQIX 4QWMA 3VBCA 3R4VA 3CVXA 1M67A 1NBWB 2ZBPA 5D6OA 3WMXA 1IN4A 5KYWB 2VBFA 1D6SA 5KYTA 3KYCB 3LLSA 3SFTA 3T1TA 5KS2A 1D2HA 2OAQ1 3IJEB 4KN9S 2WJ3A 3ESYA 1M66A 1E98A 1UQUA 2XWPA 4P93A 2NU8A 3TSYA 3WL3A 3A1CA 3KKOA 4FMBB 2HA4A 4JLSA 4V0OA 3FKSA 2AR9A 1EXVA 4G9BA 2PH5A 2A0WA 4LNAA 3HDVA 2Q3JA 2A1IA 4QUEA 1E0DA 3ZWNA 2ZB3A 3TQQA 2Q2VA 2VBCA 4JYCA 3NMUF 4W7SA 1M5TA 2CWDA 4JHXA 4PZZA 4CQJA 1TEXA 1UH5A 2C61A 4RPKA 5I7HA 1SQ0A 3MJFA 1SU6A 4UBLA 2MSLA 3AR5A 3C1OA 4J3FA 2FPMA 3GMIA 5SICE 2ZRNA 1NVKA 2EATA 3CRMA 1H3NA 3FOAA 1F5NA 4ZQGA 1XQXA 4KIUA 4CF3A 3K73O 4R7GA 2GWRA 4FGWA 3RRMA 1SXQA 1E5TA 3D2LA 2C5AA 4C30A 2OYSA 3MINB 4RY2A 4XGIA 1DMRA 1RYDA 2Y9PB 3DKRA 4EW1A 3N2NA 1YRAA 3FWYA 4POAA 1MOSA 2HW8A 1KE1A 1R8QA 3H6KA 4AJOA 2JRCA 1Q0RA 1IJKA 5B2EA 3KP1A 1SVUA 1DAFA 4EKGA 3FHCB 4XGKA 5C1PA 1RWVA 5KSOA 1NXPA 4PPQA 1P4HA 2CXSA 3R75A 4F9GA 5BUCA 4XM1A 1VCOA 3SKYA 3ODPA 2AOTB 2OHJA 3QE0A 1H2YA 4LOJA 4TOIA 3T9AA 4P7GA 5B1HA 5LB4A 4C4ZA 4D0NA 1JEYB 2OL4A 2R5NA 3EY4A 3QA3E 4LVOA 4J3NA 4IHAA 2BKVA 1ATZA 3QENA 1P5FA 2ZVDA 4H4CA 1U7XA 4JDPA 4CHTA 5B55A 1Y1RA 4MUIA 4PGAA 1KO1A 1FMLA 1T35A 1QC5B 3T9BA 3VO8A 4DABA 1R8XA 3HACA 2EBWA 2FPOA 2IFTA 4P53A 3FLMA 3E0QA 3UMGA 4MUHA 1H6AA 3WJ7A 1R0YA 3M2PA 1BU8A 1EP9A 4EKNB 2FWNA 3UWKA 3IP1A 4JI3B 3AF0A 5HIAA 5C8YA 3IDQA 2YQZA 4PWZA 3LA8A 4LECA 3U16A 1H2FA 1JPNA 4NK4A 3JQ9C 1DWPA 3SHFA 3HKCA 3R3JA 4AF7A 3DEYX 4JJGA 1Z5ZA 3KR0A 3LVFO 2JAOA 2CGEA 4ZO9A 2WMNB 4MV5A 1OI3A 3FBGA 4KSBA 2X1LA 4E2ZA 1DBWA 1V35A 2OZVA 3DVQX 3LBNA 3Q5DA 3OZVA 4PXSA 3VO1A 1TMYA 1A9TA 1SK9A 2BP7B 2Z3ZA 5MHTA 4PE5B 5DGCA 1XZFA 2YQ5A 3DDCA 3ZQUA 1AK1A 3MJCA 4NARA 4BWFB 4CQMB 3EIQA 4E09A 1BVRA 2Q2QA 3FHTA 2O2SA 2VP2A 3TAUA 1CXZA 5ALNA 3WGZA 2C31A 1Y7LA 1TC1A 3IVCA 3AEUA 2WD9A 5E4TA 5H16A 3VR0A 1FFBA 1KZHA 1XK6A 2X5NA 4I55A 1RKQA 3H9UA 2QYTA 4B9EA 2P4SA 5KPDA 3U9TA 1LJLA 3H05A 3MCAA 2P2GA 2G76A 3H8JA 5D86A 2OAGA 3VRHA 3VOBA 3WGVA 4M98A 5AVTA 5D1HA 1O5TA 2GAAA 3SQDA 3JR7A 1XTZA 5TLSA 2YYSA 1MEOA 2DE0X 2FMUA 3UPUA 4P58A 1FMFA 4DY6A 5KJ6A 1HYBA 1WDKA 1Z2PX 2NU6A 5KQRA 2YJ6A 3M6XA 2Z4SA 1UODA 1ZCJA 1RJWA 3F5DA 2MSKA 5CT4A 1Q3KA 1AKTA 4UARA 5EPEA 3IULA 3ZY3A 2V9ZA 3KZXA 4AUMA 4D0RA 3TIXB 2NZYA 1DHRA 5AKXA 2OY0A 2M6KA 3T9DA 4N0QA 3VVLA 5HRCA 1T4MA 1I33A 1LPSA 3IR6A 4CTKA 1UXOA 4BP3A 1U3VA 3V6LA 5L95A 4WOCA 4I5GA 1BDMA 2QRJA 2BGIA 1C1XA 2PGNA 4MP3A 2HXYA 4MA0A 2C5FA 1N1GA 4FI3F 4ARCA 1TI7A 3DL4A 2AD5A 2WQZA 3I0NA 4JQYA 4N7MA 1QU2A 3AL0C 1SCIA 4ANFA 1D5WA 1V16B 5AM5A 4DEVA 3DDUA 4PFSA 1HGXA 3SLKA 5EJ4A 4C7BA 1D4OA 2AK3A 2WHPB 1BVYF 5HQTA 3UCEA 2VAVA 5BVGB 4QXAA 5F98A 1FX1A 3CLHA 4BRZA 3H5VA 3VSBA 5JAMA 5HTOA 1U3UA 1Y82A 3HVJA 3I9JA 4JVSB 1KY3A 2P1DA 5BSTA 1HR0B 1KS2A 5GPBA 2G1PA 2AGVA 3BT7A 3I5XA 4JUBA 4F06A 1O96A 2NXNA 3BE4A 3K70D 2I29A 3UWMA 4DHWA 4UTVA 3EZNA 4J7UA 2EL9A 2MR5A 3M6VA 4V0KA 1Y3HA 1QANA 1GYQA 1SURA 5DCYA 4F84A 1YTUA 3OG9A 4FHGA 3WP1B 2CMDA 4YONB 2R86A 4ZOLF 5L51A 1QHHB 4U7HA 1K5PA 3CQ9A 1FDSA 3I83A 1U2PA 1EVEA 3O8LA 1L4YA 4L4SA 4TTSA 1E66A 4DRXA 3UGTA 1YJBA 2NAPA 4RESA 4PZUA 5K01A 4K9KA 2W2LD 1PZHA 3A4LA 5D84A 2I0FA 4BFVA 2F43B 4PC7A 1JSLA 1KAHA 1D9ZA 2HJWA 3NDRA 3KE8A 3TE6A 3ZIAD 2AX3A 3GFSA 4NPAA 1DTWB 4O33A 2CLOB 1VLMA 1YQ9A 5FA5A 1E1MA 1E2JA 3Q8LA 5HFNA 4BZQA 3RYCB 4PC3A 1THMA 1X7ZA 3VKWA 1KQPA 2D59A 1PX2A 3WDKA 3PFKA 4W4TA 3L18A 2ZI3A 2H1LA 4XJXA 1OHHD 1GDTA 2XBUA 3U9SA 1HDOA 3GW8A 1IRIA 1FW8A 3OSZA 1ILEA 4INOA 3K5IA 1KFCB 4JVMA 2XR1A 1GKUB 2Y2VA 4I4TF 1QFMA 1UKZA 2B83A 3QLUA 4JJ7A 4Q9AA 5M7EA 1EFKA 1YJXA 1W5BA 4C7XA 2OZPA 1B15A 3ZZTA 2BAGA 1OC2A 2YFKA 2OCYC 3THOA 4GGPA 5TS3A 1TFUA 4LZOA 4BFXA 3AUAA 2V8OA 4LSWA 2VNKA 1A7KA 2H48A 5DNDA 4KVZA 5FXMA 4BNUA 2Y6UA 4ND4A 3C6ZA 1DV2A 1QVRA 2KBFA 4P36A 1DQPA 3M5PA 5T7BA 3B6KA 1PIWA 4HDRA 2HB6A 3L6UA 1GJRA 1Z2NX 3PGVA 3HXTA 4OV6B 2ECFA 3RR2A 3PUXA 3OCXA 1AV7A 1TAGA 4XRGA 2VUIB 4YVFA 4EECA 4GI5A 3EZYA 4B35A 5DWQA 1YUMA 5LP6F 1G4HA 2AN1A 4Q3CA 2VJNA 3WGIA 2PE5A 3L8HA 3EGDB 4P54A 3L1JA 3E05A 1BGXT 3EAGA 3QE9Y 2XE6A 1U9YA 1SR8A 2A9OA 4S12A 2YKGA 3EVDA 4BGVA 2VIIA 1BN6A 5T8KC 5EZSA 1YBFA 3ZV3A 4F7WA 1T9DA 4HEJA 5DHAA 4DA8A 2WM3A 2Q6OA 3FVVA 3GOHA 4HX5A 4KQHA 3U2QA 3VKVA 1A2QA 1CR4A 1KFJB 3RF7A 5JSUA 3G2QA 1UWKA 3DDWA 2H52A 4XIFA 4PR0A 4Q1CA 4C2BA 4M0CA 5I7OA 3GV0A 1KEWA 3OQ1A 3GT7A 3OM8A 3NTOA 4IIDA 1W48A 1RCUA 2MT9A 4IMIB 5H9WA 3RWMB 1R1DA 4CYMA 4Y6LA 3SFVA 2OHFA 5HHTA 1ZCZA 3R7WA 1K8YB 4OQDA 3ZH2A 4TZTA 1TT5A 3KKNA 1MVLA 4R9UC 1SPXA 4ZU3A 4JX9A 1E2DA 3DHEA 2AKYA 3RTAA 3K16A 2Z95A 1N25A 2NP7A 3IQFA 4J0GA 1PGOA 1L5FA 3O82A 1W36B 4CN9A