2G7MC

Crystal structure of b. fragilis n-succinylornithine transcarbamylase p90e mutant complexed with carbamoyl phosphate and n-acetylnorvaline
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
320
structure length
320
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKEEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
publication title A single mutation in the active site swaps the substrate specificity of N-acetyl-L-ornithine transcarbamylase and N-succinyl-L-ornithine transcarbamylase.
pubmed doi rcsb
source organism Bacteroides fragilis
total genus 114
structure length 320
sequence length 320
chains with identical sequence D, E, X, Y, Z
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.3.-:
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2g7mC02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2g7mC01
4A8TA 2P2GA 1F1BA 4A8PA 1TTHA 3UPDA 2W37A 3D7SA 1RAIA 4ANFA 5ILQA 1RAFA 4EKNB 2A0FA 3KZOA 4EP1A 2FG7C 3M4NA 1ZA2A 3L02A 2RGWA 4AT1A 1R0BA 4FYVA 3GRFA 1RAAA 1RABA 2AT1A 1C9YA 3MPUA 1D09A 8AT1A 2ATCA 2I6UA 1I5OA 5G1NA 1EZZA 2QG9A 4FYWA 3R7LA 3TPFA 3GD5A 1EP9A 3R7DA 3Q98A 4KH0A 2EF0A 4JQOA 4WTOA 7AT1A 3KZCA 4E2FA 2HSEA 1DXHA 1ML4A 2AIRA 3KZKA 4A8HA 3L05A 1DUVG 1ZA1A 4JFRA 4KH1A 2FZCA 5G1PA 8ATCA 1VLVA 2FG6C 1FVOA 3M5DA 4KWTA 1RAGA 9ATCA 2FZGA 1RAHA 5AT1A 1SKUA 6AT1A 2YFKA 4NF2A 3E2PA 1NBEA 1FB5A 4H31A 3NPMA 3D6NB 3SDSA 3L04A 3LXMA 5G1OA 1AT1A 1ACMA 3R7FA 1RACA 1RADA 2G7MC 4IV5A 4OH7A 3M5CA 1RAEA 2BE7A 2IPOA 4F2GA 3L06A 1A1SA 4KGXA 1TUGA 4KGZA 3AT1A 3M4JA 1XJWA 2FZKA 3KZMA 1PVVA 2QGFA 4F04A 1TU0A 3TXXA 1AKMA 1EKXA 2H3EA 1ORTA 4FYYA 1Q95A 3KZNA 1OTHA 4BJHB 4FYXA 2BE9A 4JHXA 2OTCA 4AM8A 4AMUA 4KGVA 1R0CA 1PG5A 1JS1X 3CSUA
chains in the Genus database with same CATH superfamily
2ZQZA 2A0XA 3COJA 4RQTA 1QE5A 2PZGA 3GJXC 3EZ6A 4HK4A 4ZJUA 4YT4A 4PE5B 1L4EA 3LECA 4GDFA 4FFVA 2CXXA 3LW7A 4GBMA 1KEVA 3NIFB 3N7UA 3VSDA 2QD3A 4OHZA 1FFXB 3QE9Y 1DBSA 5G0TA 5FPYA 4EGAA 3KAKA 1S8FA 5CFZA 1LPBB 1H5UA 4ZO9A 5AVKA 2QVBA 3C3AA 3LA6A 3WLLA 4IAOA 3IQXA 6YASA 1WUJS 2HL6A 3LP6A 4BJ3A 1KDTA 5BW4A 4RK4A 1EVQA 1R2QA 2FAXA 2J3QA 4QM7A 3NEPX 4ID9A 4N3BA 1Q7GA 4IXDA 1ZRNA 3N28A 2PUAA 2Y71A 3BGSA 3GVPA 4BMYA 1XTKA 1TPYA 2XRZA 1FYFA 4M87A 4ZYXA 3FNEA 3U3JA 2WFZA 1PT6A 3I01M 3G2NA 4NAUA 4RD6A 4W5OA 3AF4A 5L95A 1XU4A 3QPAA 3LQKA 4OG2A 4A8JC 5HJ7A 4CF3A 2ZLBA 3IMKA 4D3SA 1N9KA 5T4EA 1T0PA 2SECE 2YRXA 2HTFA 1XMOB 3COSA 2F8MA 4PZPA 3H4IA 4ER0A 1OXSC 4K1LA 4ZV9A 4HAUA 1N2JA 1GTRA 2R5FA 3MXTA 3USZA 4YX9A 3JYNA 1XPUA 1GQ2A 3IQZA 4CIYA 1UIMA 2G04A 1XRMA 3UGQA 2BKXA 4ADSG 4RYDA 4CV3A 4YHHB 1FVOA 4LDJA 1SUPA 3PZRA 4RHFA 1C1DA 5BQ3A 3PEYA 2O8BB 4CJXA 2QJOA 1MAVA 1CJTC 1YZ3A 3IEUA 1NDHA 3QMMA 1MHTA 3LVQE 4J76A 3FYSA 1EUZA 2FFHA 4EL0A 1M75A 4M1QA 3OI7A 2CZCA 1N5KA 4PN3A 3MMSA 3B12A 4ZMBA 2EWWA 2GWHA 2WIGA 2WWIA 2XWJI 4IDBA 4RVGA 4TMKA 3WIUA 1IN5A 2HSJA 4CT4B 4ZU3A 3HXOA 1M1NA 1NKSA 1VSVA 4EW1A 1SEPA 4XYBA 2XBMA 3AERB 4MVJG 5LCXA 4Q7LA 3K2IA 5HOEA 3AJ9A 4LISA 4R3NA 4C4XA 1R6DA 2Q3LA 2QTNA 3KUUA 4M38A 1FCJA 3SF0A 2WZCA 2H18A 2VP2A 1SHJA 2YXDA 1EJ2A 2FMIA 1J8YF 2FU5C 3A10A 5AJXA 4KPFC 5DNVA 4TT3D 1VI2A 5TQJA 1YMUA 5MN4A 3CHYA 2M6LA 2AYXA 1E5VA 2YJ5A 1Z2OX 2PIAA 1D0IA 1L4UA 4FDUA 4FS8A 1GCUA 1QC5B 4AP5A 5EHNA 2O8EB 2BONA 3DDHA 5GWXA 3ME5A 1J8DA 4LBVA 1R4ZA 1LQ2A 1RI3A 1VI5A 4FNOA 5EE0A 2XPCA 2V9CA 5IYZF 1YA4A 3NXSA 3DTNA 3U09A 1TQHA 2PL5A 2W22A 4TV9F 1LLUA 1JHPA 4ND5A 2Q3EA 1GYRA 3CH5A 1Z2PX 4R1OA 1FLVA 4L02A 5AKLA 5K9ZA 1EFAA 4MVCA 2A30A 1KYTA 1YXMA 2YHIB 4U2KA 2E3JA 4WSOA 5B1EA 5JQGF 1L5GB 4B3MB 4Z7NB 3IQFA 1MC1A 2OOKA 4QU5A 5DYNA 2XADA 3PYLA 1K7EB 2BHSA 2X0KA 1DV2A 5L3QA 4GE3A 2DB3A 1CS0A 4U9HS 2W48A 3KEOA 2IPNA 3QE0A 5JCOA 4C04A 4D96A 2ZAYA 1MQSA 1VM6A 3B1YA 3SQDA 1PYDA 1FDIA 3GV0A 3MGAA 3M49A 3FUWA 1I32A 4IJ6A 2X3UA 3E7FA 1AHIA 3TSZA 4CF5A 3TNJA 2DCMA 2I6QA 3WGVA 4PC1A 3QVWA 3CUYA 2PGJA 2YW2A 3OKCA 3ETGA 3G5UA 1WVMA 4LXUA 2RMKA 5GJWC 3ZH2A 1IC6A 3TLEA 1TCBA 3VOBA 1I2AA 1OAKA 3N2KA 1UOEA 4TMXA 3IKTA 1ZESA 1KKMA 1XTQA 3GAFA 5BYAA 4V0LA 4Q00A 1Z0IA 1ZHFA 2AN4A 3V8BA 2QQFA 3PDHA 4CYMA 5C7IO 3KQTA 3HL4A 4LRQA 2P9ZA 1WO8A 3HZZA 5EI5A 1U0JA 1P7WA 1V1RB 4ILEA 4PTLA 3IR5A 2QM7A 3CXUA 5A62A 3DMFA 4CEJA 1AKNA 1F3LA 2IOHA 4ZODA 3SDBA 5F35A 1KARA 4JT4A 2XX3A 2IS2A 2PT7A 3NWEA 4DMKA 5IKMA 2NM0A 1S1MA 5LZ9A 4A27A 2GLUA 4WAUA 1JIVA 1Z2NX 5T3YA 5IPFA 1YJCA 4HUQB 3KV1A 2YV3A 4OUKX 4ZT4A 4NU0A 3I9LA 4IDHA 3E27A 1XL0A 3HDGA 5AM0A 5C0OE 4BP1A 5CB0A 1A7AA 4KXMA 2Q8QA 5K3OA 3PQ3A 4L3WA 2W2XA 5AXDA 2CFOA 5I7VA 1XMVA 1F5SA 4EGFA 3MTDA 1CFZA 5H3LA 5KWIA 4G56A 2PKWA 1C8KA 2WA1A 3DBLA 1ECGA 1WV1A 1Q16A 1CX9B 2YFKA 1UBRS 2D5CA 3I9V6 3C3BA 2PT9A 1MX1A 4OLJA 5DBFA 2AXPA 1XDGA 3BERA 3ILVA 4NESA 5C3MA 2R0QC 2CV1A 1XRRA 2EU8A 4Y2SA 3LSYA 5TY0A 4Y2XA 4KYVA 5FLEX 5K2MA 1KJNA 1T0UA 1G2OA 2IEBA 5TT0A 3LBHA 3HB1A 2PUVA 5EZSA 2ZSAA 1JWLA 1RMTA 2QRJA 1RWXA 2QVCA 3N74A 3TW8B 1DC8A 1N5OX 3M5CA 1N2SA 3RUAA 3VJRA 1CZHA 4UM9D 3I5MA 4HAYA 1DAKA 1RXYA 3NANA 4TQAA 2J85A 1TI7A 3FCSB 3LHKA 4O2AA 1GQYA 3TTTA 4CQLB 2ZTHA 3C5VA 5KU7A 5CJ2A 3KEMA 4ESOA 3VKHA 3R6LA 1CDEA 4BAGA 1YZNA 1MO3A 4DZZA 2HJHA 4KN8A 5IC4A 4LZPA 3CR7A 3NHMA 2F3QA 3OEED 3AM4A 2JBHA 1UKYA 2WYIA 1PKXA 5C8YF 3D6TB 3WLJA 1VXRA 4CTKA 4U63A 4DARA 1EVJA 4H0NA 2OK8A 4PPYA 1TAGA 5DBGA 2ZJ8A 3VI3B 1VCOA 3AEZA 4A0GA 1PZGA 1YNOA 1IH8A 5FT9A 2PS9A 3SHWA 4ICIA 4LE2A 3LM8A 5DX0A 3VPCA 1XFDA 2I3ZA 4LYYA 1GTZA 1FIUA 2XVAA 1WUHS 3BXPA 2HUNA 2SCUA 1DIRA 5C81A 3HEMA 4KGVA 4ZJZA 4G4GA 4AUMA 5KWEA 3TSOA 5BSWA 4I1PA 1N1DA 1U2RA 1ZD3A 2NQ2C 3FF1A 3GEBA 3MS7A 2FN7A 1B14A 1VSTA 2ZW9A 1WEKA 2BMFA 1MOSA 2FX2A 3KP1A 5GONA 3L4EA 1N5MA 4D56A 1QFXA 1TO1E 3D7SA 4L8VA 4UAJA 5FNVA 2VF2A 1DO8A 5BOSB 4N0EA 3GJ6A 4EY6A 3LV8A 1CKEA 4JEUA 1B1AA 4NNPA 5DM0A 1W36B 4FFPA 1NGSA 3ESBA 1PYOA 3RC7A 5ALVA 2QUBA 2REXB 3S44A 1AKTA 2DUNA 2V0NA 3FRHA 2XXAA 4FOLA 1FUIA 2HC9A 3EXIB 4I1YA 1PLKA 3QH4A 4GX5A 1ZUHA 3LKBA 4BBAA 1F06A 1PEDA 4MR9B 5AJYA 2QJFA 3T35A 2PZAA 3WOVA 5CA1A 3LY5A 2JFQA 2OCIA 4HGOA 4N7RA 3H2ZA 4KWCA 4KDRA 2Z4SA 4A1FA 1NMEA 3P0IA 3E05A 3AESA 3F1KA 2ZATA 1EDZA 1U3DA 3CH6A 2O9JA 3NH9A 5IBCA 1LW6E 1I30A 3I53A 4YVFA 1V71A 2Q9BA 2YW9A 3F7TA 4UTRA 4E2FA 2VL7A 2G07A 2O2GA 4QPNA 3VPXA 4JI8B 1FTGA 1R4NA 2AIRA 2QRZA 2RJ3A 2EW8A 3MTQA 5AW7A 2Q0HA 3WB0A 1PVDA 3LW8A 3G1UA 3TMYA 3QVOA 3U80A 2Z3VA 1Z06A 2Q27A 2XNCA 4B3HA 4G37A 4BCDA 3L7OA 4K28A 2FP4A 4MV6A 4CEHA 4I99A 3WKCA 1GQQA 1NJ6A 1U0EA 2TYSB 2V6IA 3RW9A 4BFXA 4WXPA 4H77A 1VMEA 1WZEA 1JA1A 1TYZA 3A7DA 4BKPA 1SVNA 3NPMA 3UUEA 3LO8A 4ASUA 4C78A 1GSOA 3BMQB 4BVFA 7ADHA 2Y1EA 3NCHA 3DL4A 5IXJA 2EQ5A 1R18A 3FMVA 4U39A 5I4KA 1QZUA 2HY7A 1BX0A 2IC5A 4BJ5A 3V1TC 1KPHA 3C97A 4ZCLA 4W5HA 4RS3A 1T2NA 2GAFA 3P20A 2ZYSA 2DAPA 2ZYRA 4EX7A 1GUAA 4R2KA 4RK5A 4ARUA 3WAKA 5KQMA 4OO3A 1BXRB 1Y7HA 1DADA 2DWCA 2EYQA 4FNMA 4A0RA 2CV0A 3N07A 2AUMA 2GAJA 4FR5A 1LVUA 3CLHA 3T54A 1BHSA 2HFKA 4EMTA 1VKOA 3RC2A 3TSYA 3VYWA 2LDBA 1VIYA 3A1CA 1PNOA 3FUXA 1RXUA 3MD9A 1XHLA 2B37A 2NU6A 2ZI3A 3BORA 3PEUA 4G65A 1ZJWA 2BR5A 1GP2A 2OV1A 3B48A 2F62A 4ZT2A 3BWXA 2V0GA 5LBIA 3Q4GA 3OF5A 1IMJA 3CX8A 5BWLA 3D8HA 1W34A 1YJ8A 2VTVA 3PP8A 4L9AA 4X1KA 1PS9A 3MFQA 3MRSA 4LJ8A 1UKEA 2BKAA 3AVOA 3MQFA 4QPPA 5ICFA 1QU2A 3SXJA 2AUNA 3FNGA 4BX8A 1J1UA 1IAVA 1W29A 2BE9A 4FFBB 4BGIA 3HA7A 4V0NA 2OQ2A 1PIWA 2OPHA 4EKEA 5JMWA 1DUIA 5FWXB 3IA2A 3QLEA 4CF6A 1BCRB 4C01A 4LHEA 4LQDA 1RI1A 5J2UA 5G4KB 3COYA 3IAEA 1ZWLA 3V2UA 1SUEA 3CPSA 1M2OA 3GMDA 4PF1A 4E51A 1QCZA 3EODA 1V43A 2BEKA 2YWDA 2GVNA 4QRHA 3WLHA 5KSPA 5B6JA 5FEUA 4FE4A 2JG3A 5H68A 5DZSA 4M8NE 3CNHA 1KMMA 4HDKB 3HY6A 3FYTA 4IINA 4LE0A 3RS3A 1R6UA 3A05A 4EMSA 3MLBA 4PIMA 5FLKA 2V7QA 3ED5A 4FWIB 1ZSVA 4EA7A 1QE3A 4NMWA 1SBCA 1XZLA 1RHQA 3EXFB 4MWCA 3FJ1A 5F51A 3RS5A 3IVMA 3VHQA 5LWHA 1XZHA 4YLEA 3SP1A 1C29B 3CW8X 1DQNA 5TNXA 1GRRA 1U3CA 2V7VA 1NY6A 2Y4NA 3JYQA 2C03A 2GCEA 2WUDA 4GPTA 2O2XA 2CMKA 1ZC4A 8AT1A 1WXIA 3EULA 3SS7X 1JV2B 2A9KA 3B3AA 3DP9A 1ZRMA 3T5GA 1ONPA 4KYUA 1XXHB 1MABB 4ZICA 2I4MA 1J21A 1TMYA 4C4SA 5DGDA 2WJYA 1L5HB 3O8BA 2Q28A 3TDMA 4EJMA 5B4UA 4UTNA 5AJHA 1WW3A 2O2HA 3KVOA 2OMKA 3V2HA 4FBLA 2HA7A 3AVUA 5HEKA 2VC2B 1HNXB 3ZE7A 4D9NA 5EZ5A 3WWYA 2M9MA 1X9HA 3ZOKA 1QRSA 1RBYA 1U0GA 4YV2A 5BWBA 5TMEA 4CHGA 3I2JA 1DRUA 2IPAB 3SYKA 4AQDA 4AZSA 4LPKA 4EB3A 5EJEA 4MB6A 4PX2A 1I0LA 3TUZC 2H2FA 3RS4A 5CFLA 1NI4A 1NULA 1T3TA 2Q2QA 3QOYA 3SD7A 2BFCB 1Z5VA 2P2YA 5HRAA 1NL3A 3G8YA 1UQUA 1CE8B 1O5IA 1T8UA 2G76A 1S9DA 3C3YA 4JLSA 4MYRA 2C4UA 2BR3A 4CLDA 3L8HA 3KQPA 4I5GA 2GZ3A 4CFYA 4NI5A 4Z3OA 3K2EA 3L49A 4YRIA 2C83A 3AKEA 5CNMA 1I6KA 3O5AA 4ENTA 3ROZA 1B0PA 1NDUA 4EMUA 1EFVA 1JMVA 4Q3KA 4XOUA 3AG5A 4D3DA 3HKBA 4OMUA 5FTNA 2PX6A 4R1NA 1CNMA 1MTZA 2ZWMA 4I4TA 4ZRNA 1MR3F 3TE7A 3OT1A 4WFQA 3ZKWB 4JUBA 3LVRE 1ZW6A 5IHPA 1T1SA 5KQLA 2H1WA 3DV2A 3EDRA 1P5RA 3HBLA 4KE6A 4RZQA 1AQLA 3OZAA 3WGGA 3AVWA 1BDHA 1FQWA 4JI6B 4HEA6 2B1GA 4KX3A 4RPJA 2JFYA 4BP3A 1NYLA 2C3YA 1KI1A 3P2KA 1VIVA 2DC1A 1PI3A 4FYIA 1ODTC 2OBLA 1LC0A 5AESA 3I30X 4GOLD 2EP7A 3DKKA 4RK1A 5DH9A 3SN6A 1DJOA 3G02A 3QM1A 1P1IA 1LPAB 3D5EA 3F1LA 1NLZA 3S4YA 1J2UA 2J5XA 3AFNA 2H9IA 3MGBA 3GOHA 3RAPR 2AOUA 4YRDA 1GA1A 2QTWB 1V6AA 2RE8A 3ZIAA 5J4LA 1F60A 4E21A 1XWIA 4MV4A 3TOZA 1JHZA 4ES6A 3X43A 4XDZA 4P98A 1VPTA 4EKIA 1PJZA 1WCXA 3A9RA 3GPBA 5T41A 4S04A 2I2CA 3TNFA 4R69A 4V0OA 4NFHA 2QTVA 4KVAA 2EJUA 5E6SA 1FPQA 1XWFA 4DWVA 1APBA 1X7XA 3QV1A 5ALQA 1VIAA 1EVIA 4B7AA 1TYBE 4ZK2A 1KFEB 3RYTC 3DQPA 1RLUA 2GLTA 1SQ5A 4EM6A 4YFVA 2B5VA 5IBQA 1Z4LA 4Y0AA 3ZWNA 3I5XA 1FW6A 4HLUA 1GKIA 1HPLA 3KD3A 4JU8A 3W04A 5F5LA 1Z4IA 4GT1A 4NBRA 1A4UA 4M9SA 2BGRA 4PVDA 4RH3A 4R8LA 2QTGA 4HZIA 5IUNC 1FBTA 2IP4A 2NU9A 3HCAA 3PJDA 3LCUA 4MWTA 2RJOA 3KJIA 4JXJA 5T64A 1E6WA 2IF0A 3DKVA 4AKSA 3T5PA 2PT5A 4BLRA 2OBYA 3E8XA 4KR6A 1I94B 2AFVA 1H2FA 3GCGA 4WZBB 2YFQA 5DNAA 4G23A 1UK9A 2DUWA 3I4FA 1HXHA 3QI7A 1JFRA 3JQ8A 2HHLA 4IHJF 2DETA 1Z4JA 4Y1RA 1D2HA 1P9WA 4DLLA 3UNXA 1TK2A 4UHBA 2QLNA 2NTEA 5EZYF 4FM9A 3FLMA 4WLEA 2CYBA 4HATA 3RTBA 2OORA 5BN5A 3NYRA 4C2AA 4H18A 4DMLA 1T2CA 3LNTA 2WMDA 3L05A 3LCRA 4ZVKA 4E7PA 1KO8A 1UM9B 4RE6A 4FQ8A 3ZR4B 1IBCA 2FQQA 2C5FA 3IAHA 2J33A 4ZTZB 4P0QB 1OR8A 2HBZA 3A6LA 3MTEA 3E5HA 3K9NA 4I55A 4MUMA 5FOQA 1XD2A 4N9QA 2GSWA 3ROPA 1QH1B 2A7XA 3BF7A 4GBED 2PGOA 4K9OA 4UM9B 7REQB 4WN3A 1Z83A 2ZWAA 3F9RA 4D0RA 2XGOA 1MVLA 4F4FA 2C98A 3KD2A 3QKUA 1SKQA 4M1SA 4RH1A 1D9XA 3FWPA 4MKRA 2FEPA 2Z9BA 3NM5A 3JU3A 2UYOA 4MCJA 1IDOA 3WQSB 2XJ4A 3NONA 4KW7A 4O4LA 1SBYA 1JFTA 4R4JA 4D79A 1E1RA 3K0HA 1MAUA 4PYQA 5DTJA 1UWVA 2ZBUA 3HR7A 5IDWA 3S3TA 4QNMA 1OU4A 1FJ2A 2Q4DA 2TMYA 2WI8A 2CLHB 4ZT5A 5KNBA 2IGTA 4FUTA 1UODA 4BU0A 1BIFA 5E4JA 2X13A 5CR9A 1G98A 4TKVA 4J0KA 2RKOA 5EHZA 4YUAA 2QXTA 1SKAA 4ASUD 4B17A 2QG4A 3ELUA 1OF1A 4L1KA 1K92A 3W5HA 4P81A 2Q8NA 3OOYA 3CBQA 1Q12A 1EKXA 4WKNA 2YVLA 3V33A 2KJQA 4CMIB 4OX9Y 3BDAA 4BIMA 4FHFA 2PPVA 4YRFA 3SX4A 5ITSA 4D2IA 1SJ9A 4UVIA 1U0LA 3ZGYA 1E60A 1NTOA 5A2GA 1GGKA 3AETB 2COEA 3EBLA 3DAGA 4GEKA 5FV4A 1XCBA 1PZMA 1ZOPA 1XVVA 4RSMA 1E6LA 4HLQB 4C05A 1PR5A 1U9YA 4JSYA 2QW1A 4D25A 1NF2A 4C2TA 2NGRA 1SR8A 3QU9A 1R88A 4Y9TA 2I4TA 5A02A 1C4KA 5BQOA 2CMHA 3R5HA 3MN1A 4D0LB 4AQ7A 1XT6A 4MMYB 5JASA 4I1OA 2JLYA 2OB1A 1TAQA 2VTKA 2ZJ0A 4ZQGA 4HS9A 4E13A 2WG0A 2W00A 3II6X 3MMZA 4K7JA 2XMDA 2ZJ2A 4YA6A 1PD0A 3ZDYB 2WWFA 3CZ5A 3FVTA 3Q1LA 4Y6GB 4NU5A 4PXYA 1G8FA 5FIUA 4X66B 1IBRA 4US2R 2QTCA 2ZBGA 2YRFA 3UK6A 2VQEB 2E89A 4DJTA 2HKIA 2XITA 1KSGA 3KO8A 4RK7A 4GX1A 1ZD2P 2R3SA 2LKCA 1KAOA 3E3MA 2OGZA 3BE4A 4S1OA 4WDQA 4A0QA 4AMZA 1RM3A 3BK2A 1EAMA 2HBQA 1YDHA 5SY9A 1ZW1A 3DEKA 1B7GO 5KTRA 2R8RA 3G2KA 4HNHA 4Z7OB 4ITUA 3VUEA 5JO0A 2REBA 3A1WA 2XE8A 1I1OA 4HYTA 4RWEA 1NE7A 5TMDA 5DP1A 3K8QA 1L4MA 5EWLA 3TX6A 3ZCRA 1E1QA 1SY7A 1IU9A 4P5DA 3AILA 4REMA 5BSHA 1VJRA 3QVXA 1AC5A 5DTEA 2JI8A 2ZS9A 2V7QD 2VYCA 1ZN2A 2H4HA 3BSYA 1OZ0A 3C2QA 3FSEA 4KIJA 2VQFB 3G2MA 3DAOA 1IY8A 1Q21A 1C7FA 4KLZA 1HLGA 4WK4B 1Q1AA 1CW2B 3DHEA 2PKXA 3JQFA 4M8KA 5DX1A 2FCRA 1XMJA 3QKSA 4Y6RA 3IAXA 4HJRA 4TMFA 1F4PA 1ZK4A 3D8RA 3JRWA 3U1TA 1TZCA 1YZKA 2P1DA 4ZDJA 3HCFA 1IN1A 4Q18A 5K8VA 3WIEA 3IMCA 4Q7QA 4PAMA 5B36A 5CA0F 1Z6AA 5KYUA 1NW8A 5KS2A 3AYXB 3VOAA 3ZHOA 4A2CA 3K9QO 1RLTA 2Z8XA 1QIKA 3JQQA 2X19A 1W88A 1C1DB 1NFQA 1ZN9A 3G2OA 4URHA 2Q2VA 2VDQB 3K4PA 1LFDB 5G53C 5H81A 5KKCA 4HH4A 1LDMA 5JS2A 4MWGA 5EQTA 3VR2A 4IZ6A 3HBJA 2ZK7A 3EIEA 3ZJTA 4ITRC 3B85A 3AM1A 2Y1XA 3MT9A 4QYXA 2PANA 4HRXA 5COQA 4HWTA 2GJSA 2QMQA 4FMDB 3NEAA 4HPWA 2JHPA 4BLUA 1K88A 3AVTA 1M1NB 4I1SA 3PC2A 4DWJA 1Y4ZA 4RJIA 4Y0NA 2CUTA 4H6XA 3JWGA 5CFPA 1EA7A 2WSYB 3GVXA 1Q14A 2X0JA 3VX3A 4AJJA 2O7NA 2HJSA 4FE3A 4KGXA 1DBWA 2CLLB 3CRNA 3FKJA 4TM7A 5TQ2A 4A03A 2CMGA 1GYPA 3E70C 2BTOA 3HTXA 1USKA 4JJKA 3AEYA 4C29A 1DCKA 5K1ZA 1AMUA 5M2QA 4FLEA 1FJHA 1XEWX 4J29A 3SEFA 4YQYA 2O4UX 1XQ1A 2JLBA 2QD5A 4J0DA 5KNCD 3OPVA 3PUVA 2R6AA 1XX6A 2FA9A 4F3TA 3OKFA 3QBVA 2FZLA 3B82A 2YZMA 1GL9B 3IH5A 4RELA 1C8LA 3FKSD 1ISIA 3DDOA 2C9ZA 3BB3A 1E1NA 5FF9A 5HRCA 3UPUA 3K1TA 2CXOA 5LP6C 5JZOA 5KTNA 3VNUA 3IEIA 3OCYA 1ZR4A 2HXYA 3KOWA 3PA6A 1JDPA 4INOA 2FPIA 3T1OA 3I1YA 2PRZA 4ZO7A 2JIQA 3A1EA 4AJ9A 2JI4A 5ER6A 3EGIA 3LUHA 3ZGLA 5L3QB 1CS0B 5IM4A 3WRXA 4A3SA 2W6PA 3MG9A 1LW7A 3UB2A 6ADHA 5KYKA 4H1UA 1E7WA 4WESA 3N0XA 2WC1A 3N6RA 4HQOA 2ORVA 2WDPA 3ZIAD 4AJ4A 1YGYA 1OB5A 4BUJA 1PZXA 3W5DA 3R23A 4CLXA 3DWGA 5F3DA 1IXSB 2FN8A 1P5FA 1EUDA 1U28A 3V7WA 4MQ6A 3RVJA 1LPNA 3QPDA 3N2KB 2PX8A 3O4IA 1EU1A 4OGGA 1GVNB 5AK0A 3VH2A 3MINA 5KKNB 2WHEA 1D8AA 1E1CA 5JAPA 2JAXA 2PS0A 2F2TA 2WD7A 3D6VA 1SVLA 3R3YA 5LYJA 4RXUA 4D4IA 4Z7QB 4ZJYA 3HLYA 1JIQA 2EFEB 3K09C 4M49A 4E2WA 2IX3A 4JI2B 3E2MA 1TF5A 3GZTB 3OIYA 2YS6A 4WBSA 1KP3A 3O2QB 5ITZA 2J09A 4IGAA 4M2LA 4AYXA 4CEJB 1E0JA 1GGNA 1SD1A 1ZD8A 4KK4A 4NARA 1YF3A 5JSQA 5FA6A 1A8UA 1NG1A 1RLIA 4GR9A 5TJ9A 4AN4A 2QIOA 4MVJF 3OJXA 1ZQ1A 1GHTA 1WB5A 2D5LA 1HL7A 3B2NA 1TF2A 1YT5A 3GL9A 3O75A 4E7OA 3HJUA 5C8DA 2NXWA 3UICA 4CKEA 1ZM4A 4MA5A 4IRUB 1X13A 1H2HA 4OFWA 1D8TA 1W6UA 4LCJA 3H75A 3FROA 3JZDA 3RF6A 3RVOA 4AZ3A 1JNYA 2JCGA 4K6CA 1TK9A 3DBLB 4YQFA 1A2QA 3DO5A 3TLGA 4NYMR 2ZDGA 3F71A 3HCNA 1HQDA 4GH5A 4O8ZA 1RVV1 4V0KA 3ABOB 3D6NB 3UUFA 1Z82A 1N0VC 1NVFA 2W6NA 3RIHA 3LGSA 4QDOA 4I4LA 2Z8ZA 5CLLA 4DCMA 4RTKA 2DY1A 3CB4A 4OFBA 3EPPA 1MGPA 4E5UA 4H1WA 3ZHRA 4QUGA 5NULA 3VR5A 4JR2A 2ASVA 2QX8A 2C5GA 5MGNA 2YV1A 1UDWA 1IBSA 3PUXA 2JCYA 4BYGA 3L4KA 2GZMA 1S4MA 2ODNA 4JBLA 4Y2JA 5CJPA 2FJUA 2W2TA 5DNDA 1UXGA 3UMJA 3KKKA 1NF3A 1ISMA 5DX8A 4N7BA 5JCJA 1Z5PA 2IXGA 1UDAA 3CNOA 4O2AB 4D4JA 4UVHA 1L8XA 2X0IA 1Z6YA 2ILVA 4KUEA 2Z56A 4NU6A 1M8PA 1POWA 3TH5A 3V4VB 1ELOA 3HY3A 5FBHA 1X38A 1NLYA 2QUHA 1NP7A 2WILA 2YJGA 4F8JA 3P45A 5CITA 4GOOD 1LPMA 1JDBB 2OM2A 3NO4A 4K9NA 4FFWA 4ZRDA 5L7YA 1QV7A 3ZCPA 1ZEMA 2Y05A 4JLNA 5FHRA 4RQUA 1OB2A 2J0QA 5KNBD 2PGLA 3OZDA 1GLVA 5ANRB 4NWIA 2ATVA 2FSFA 3NP9A 1J0AA 2J59A 3BHMA 1Z0AA 2D1RA 2E48A 2RH4A 3C3KA 4BTEA 4CEIA 3VHRA 1A2OA 2WKRA 3LXUX 2CMFA 3V8EA 2R48A 1O9BA 3C98A 4WN9A 2SCUB 1YIOA 4IUBS 1RQ2A 1W96A 4HZUA 4JYMA 1B73A 1AF4A 1KNQA 1LJ8A 1V47A 2NPIA 3HJBA 1AM4D 3CNNA 4ZVRA 5C8XA 4GQAA 3D7MA 1J9ZA 4GOJA 1C5KA 3IUMA 2X5OA 2PSSA 4S1PA 3AL2A 1JDNA 2ZS7A 3T1VA 3KQQA 3P4XA 5GONB 2IEIA 4LRYA 4COKA 2PVCA 5FNVF 1LSOA 5FNVB 4FSXA 1DC4A 4KQEA 4GWKA 4KAAA 2QAIA 4ND8A 3BIJA 4IV0A 4A16A 3GT7A 3ZY2A 4EWLA 2ZRJA 5EMHA 2XUFA 4OQEA 2R4UA 2Q9AA 2FF5A 4RFLA 2CHQA 1YQWA 5CD1A 2J3LA 1HL3A 2ZRFA 5U9CA 2B4AA 4O2RA 1Z8HA 3MCWA 4QU9A 2QRUA 2XXAB 3WGZA 5IJ9A 2FRDA 3AYZB 5TE9A 2L69A 4NE2A 3UHOA 3RS2A 3V4PB 2V74B 4O0MA 2W58A 1ODIA 3ET5A 3HM2A 1LNQA 5DLDA 4BB6A 5LSAA 5CA1B 1O94D 4KODA 3RQIA 3MYYA 5LBUA 1GL7A 4IEIA 3S5UA 2I9KA 3LBNA 3DYIA 1OVGA 3VRHA 3AESB 4PNPA 3LX6A 2CFCA 3AF0A 3HA5A 4M8IA 4C6TA 4EQ6A 4ZQIA 2ZI4A 1RC8A 3L8DA 2WNSA 1ISPA 1T9GS 2JPDA 3OOJA 4G0XA 4ZA2A 4DV6B 2P27A 3CLUD 3DA8A 4HWSA 2V03A 5CCDA 2RC5A 4I9UA 1A5AB 5ALGA 2ZR9A 3L0ZA 3PNBA 4EPYA 3FYUC 1R4NB 5C1IA 4D97A 1VPEA 1FDTA 3B1WA 5KTOA 1FRVA 2RIPA 4R51A 1EFRD 1ORDA 7REQA 3JSAA 1A88A 1E1QD 2VJAA 1Y81A 5I7AA 3N5CA 3E1SA 2FP4B 1OQAA 3W8DA 4EYGA 5BUQA 4CEHB 2VJNA 3FX2A 1CR4A 4KWEA 3TDKA 5YASA 4JB3A 4DG9A 1X8KA 3FI9A 2ZUVA 4TUYA 4DWOA 1KAHA 3D4IA 1W76A 4R41A 5KTYA 2VPWA 4B74A 2ANCA 4IEEA 1CUSA 3MCTA 1GCAA 1DKOA 4XIGS 2YXEA 5C1PA 4RAOA 4RF2A 4MLCA 4MTLA 1GA4A 1V5WA 1KEZA 4E5NA 2QL5A 1V9LA 3BBPA 5C52B 4BRZA 2FW9A 1XDBA 4L4XA 5DW3A 2YCBA 1ICEA 1ZZGA 4G5QA 2BUAA 4K3UA 2Q7XA 1E1MA 2RHLA 4F2WA 3F9CA 3ZZNA 1OI4A 1QQ6A 1A1SA 2XOEA 1VGQA 1V37A 3D6UA 3PXXA 3DT8A 4E07A 2B1IA 2BMAA 3IO3A 2QAJA 3OX3A 2BTQA 2D4HA 1USUA 4OI4A 4S35A 1NBAA 1Y7TA 3DOHA 4LY6A 3LC2O 4FX5A 1CUXA 5IC5A 4CIXA 4ZV4A 5A4MS 2Z04A 3NLLA 2V0CA 3T3IA 1W94A 2ZSHA 2NU6B 3CZ9A 1WE2A 4LKRA 5JFTA 5JD5A 3JQAA 1EGAA 3Q12A 1Y8AA 4JS0A 1HDXA 4BLQA 4AD8A 4BX3A 4ETWA 1CQJA 3VYSB 2O59A 5LLDA 4BBZA 4M83A 3RC8A 2OLJA 1ZCFA 1IM2A 5I4CA 4X1KB 1P2SA 2ODAA 3J7TA 1N3IA 1CR2A 2UUOA 5DHPA 4EAQA 2J3EA 3ANSA 2BZ0A 2DKNA 2W90A 3Q72A 5CVJA 2UXCB 4ROSA 1DWOA 3AR6A 4WQMA 2RC6A 1BAPA 2ABWA 4DXHA 3L6UA 4IFBA 5TARA 3TVDA 1CDOA 1OGJA 5J2UB 3R6GA 3T7JA 1NRXA 2JFXA 3B70A 4BLVA 2C7VA 2CHUA 1XROA 3EX7C 5AVUA 1N6RA 1XCMA 1M2OB 3LRPA 3MJVA 4DCNA 2GXAA 5HKOA 2OCBA 1T9ZA 4JCOA 5T57A 1KK2A 1V35A 2V5AA 1GT91 3SMQA 2XE7A 3IALA 1TMGE 3I5YA 4FZVA 4F9GA 4G9BA 5J5VA 3RFFA 4EKNB 4CDNA 2XQKA 1T4GA 3O4VA 3L8GA 4MA0A 4ABYA 5EHXA 2YOGA 1XAJA 1RMQA 2C1XA 3BD8A 1S2DA 2HH9A 5IRCD 3LU1A 2VHYA 2MIIA 3G3EA 3WBJA 4XGNA 2JFBA 3AIIA 3NMUF 4RD2A 3E03A 1SG6A 2QV7A 3PNSA 4BFLA 4KDCA 3PDUA 2ONJA 9LDTA 1F17A 3G23A 4HZGA 2IV3A 4EEKA 4V1CB 1YVPA 5IFKA 1U6JA 3MWDA 1J2JA 5EMJA 3WDLA 5B4VA 3H87A 2WIKA 3JQPA 5F1YA 4M1OA 4CV2A 5CIWA 1AURA 1EVYA 3CMCO 1GNPA 3DR5A 3AVPA 3N8IA 4OJQA 2E4YA 5ITVA 2IHJA 1UAAA 4F91B 4A2QA 1VI6A 2X8BA 5PNTA 3KAPA 5L53A 1R64A 3LT4A 3WP0A 4DLZA 3TCXB 3DF9A 3PGLA 5FPTA 2NSDA 1XYVA 3Q3GE 4YDQA 4LF4B 2V1UA 4LTNA 2GHIA 1SC3A 2KYRA 3L9WA 5IJ9B 3PC7A 3HN7A 2ZVDA 4HFNA 4PC3A 4Q48A 3NB0A 4RHCA 4F4DA 2H00A 3EPLA 4BO0A 1NUPA 2VPTA 1SBTA 4IOKA 5L40A 1NI4B 2JFVA 4H3SA 4J7CA 3RVBA 4CQNA 4O1HA 1QTRA 2OCYC 1KQNA 5T7BA 3IP9A 3WFZA 4DBLE 5EESA 2Q9CA 1JXQA 5FOVA 1RRGA 3K4QA 3ZCQA 4F9FA 2G9ZA 2OBBA 2OO7A 3BXHA 2G1KA 2X1HA 1RRFA 1M83A 1DGQA 1JUDA 5DGXA 3N8GA 1ZNYA 5E9AA 5CD9A 3IIJA 4UHHA 5DTQA 3LK6A 1EFVB 5K0EA 2JFUA 2NADA 2RG7A 2YWXA 2VDUE 3HKBB 4TL8A 2H1LA 5JYEA 3NHYA 4I4TB 5EJIA 2JLQA 2IUEA 3JQ9A 1TD1A 1QBKC 3H1TA 3QA9A 4MIEA 1PSZA 3CWQA 2C07A 3A3OA 3HB4X 3DAPA 4AXBA 2AHRA 4CIDA 2WY2D 3JVDA 5LKAA 3RADC 3W06A 1U7OA 4UEOA 3HSYA 2YMMA 3F3SA 5EMMA 3I6BA 2DEUA 4NCXA 4A91A 1QIDA 4B87A 3VR5D 4HQKA 1XALA 4P22A 3VC7A 5JCOC 4LFAB 1P33A 1WPGA 2AHOA 4AFNA 5I9LA 1V95A 5JCJD 1NBMA 3Q0TA 2ZXFA 3KPUA 4GWGA 2AOUB 1LPSA 3W8NA 4B71A 3O8RA 2O3QA 2JL1A 1B8OA 4MUEA 4HBZA 1W5TA 2B6NA 4L75A 1Q84A 4EKYA 5KOYA 2Z2YA 4O4JA 1M1XB 5EIAA 2FJ0A 4CBVA 3RIMA 1B8NA 4KRFA 4BATA 4BDTA 2OGSA 1TLTA 4D9BA 2CNKA 2ENWA 4Q1BA 2QTVB 1QCCA 4DRYA 5IDQA 1VTKA 3KJQA 5E6SB 4IIVA 3CQ9A 4OL9A 1X7XB 4JVNA 3RRXA 1O77A 4XASA 5K6AA 4DT1A 2W2VA 3HJTA 1XZEA 3FTDA 1FNMA 4QUKA 1HYHA 2ORIA 1C9JA 1HO3A 5D84A 5IXSA 3BUSA 4FK8A 1ZGBA 3KR9A 1ZGHA 4ZHQF 4K6OA 1FJXA 1QQAA 3BB4A 2YXNA 3KYDA 4TXNA 3MVEA 1WCYA 3U3ZA 1XELA 5IBRA 4CDGA 3UWOA 1ZAYA 5AOCA 4DLAA 2NU9B 1FY2A 1NVVR 2NXCA 2OUIA 1HSOA 3MPUA 2DBQA 5KVSA 3D2CA 1I2BA 4RIFA 1IBKB 1ZUIA 2G77B 3WSTA 3G9UA 1K5GA 3FZQA 3D6MA 4RY9A 1E6EA 1UBUS 4XPZA 2W4IA 4ZYVA 2A9QA 4XIFA 1P3JA 1WD5A 2GFQA 3C1AA 3JQ8B 4Y1RB 1XYYA 2FX5A 1E6CA 3IQEA 2DFLA 1P4JA 2I76A 1Q74A 2WFAA 1A96A 4D74A 3PFIA 5BN5B 1QGUA 3H4VA 4ZKEA 3MGCA 1DHRA 4RX1A 1EXWA 1PBTA 3OO0A 1YZYA 1JXOA 3SDZA 4GSKA 3WLMA 1URPA 2WSBA 3L8ZA 1YZHA 2P4HX 3NRBA 3QXGA 4Y9RA 4KJXA 5ED0A 3ZWWA 3B1ZA 4I55B 4B4WA 5JS6A 3PC4A 1XD2B 2GD1O 3B5IA 4C2BA 5TVGA 4H7FA 5J4KA 3M3PA 4HJXA 4KVFA 1GO2A 4QTZA 3GT4A 3WIBA 1XJ5A 3FW1A 4IVNA 1SG0A 2QZ4A 2PZEA 2FPOA 1BVHA 3QQPA 4O1IA 3DE3X 1X42A 4NQRA 1T2UA 4O4LB 1TVKA 4Q3CA 4PV7A 1Z56C 3SYNA 5JXHA 2XKBA 3U16A 2XCTB 1M0TA 1GNRA 2CHGA 4MKIA 4R8RA 1DOAA 3V8RA 3W8RA 3TI9A 4RTNA 2PEZA 3MF4A 4PC2A 1KFKB 1QVZA 3KFVA 2EKQA 3HC7A 1C30A 4UAVA 1Z6TA 4KN5A 1ZI6A 2B5WA 4TKVB 4BUZA 4JI0B 2JLXA 1NJSA 1YKSA 1YO6A 3FMFA 2WAAA 3GRVA 2QZJA 1FFYA 4ZCTA 5SYMA 4N41A 3FPCA 3NWPA 3A2LA 4C1NA 1EWTA 2XB2A 4MGHA 4W63A 4YP1A 3VPGA 5ALWA 2EL7A 3FSGA 5KNBH 3IV9A 3K53A 5BSGA 2ATIA 3VM6A 3AY3A 3OHMA 3PC8C 3C45A 2ADOA 5CLGA 3U4HA 1CY4A 3IKMB 4OYRA 1XZQA 1E2MA 2QSYA 1H8EA 2QX9A 3MHPA 3PC3A 3SU8A 4AJLA 6LDHA 1C1XA 1M34A 4XH9B 1JFFA 3IMEA 2HRZA 5AKEA 5EZQA 4JROA 1U04A 2Z95A 4DCGA 4NXNB 3BYZA 1RSZA 4RY2A 2XV1A 5B2EA 2FMKA 3I6MA 2R6HA 1QPGA 5CTJA 1KQ3A 3E5NA 4IQ0A 2H1RA 1RNLA 4TMVA 5FOTA 2FHPA 1O8BA 3B3FA 3HLKA 3M3DA 3W2TA 5HBRA 3J7AC 1PDOA 3GCDA 1GKLA 1TDJA 3JQAD 3MEQA 3SNKA 3UBMA 4HT3B 1M7HA 5LA6A 4RY8A 2C4VA 5DRTA 4YPOA 5C35A 4WD3A 2DECA 3EXHC 3O9VA 2VT3A 3OX4A 5K0CA 1IQRA 2J6CA 3KOMA 3C7KA 3ZVNA 4BC1A 1P60A 2H59A 3WAJA 7MHTA 5FKJA 4UCQA 1L1FA 1QO7A 1KI3A 2CXTA 1L7XA 4GYYA 5JT1A 4HXGA 3QLVA 1WSWA 5F7XA 5KSOA 2A9OA 4L9SA 1IPFA 4X62B 2O3SA 3FI0A 3SM9A 4YUYA 4K0RA 4ND6A 4FTWA 5AK4A 3SE7A 1N0HA 3O47A 5IARA 2B7CA 5IHXA 3GRUA 4KQKA 5DSZA 3GDGA 1A4IA 3WWDA 3H2BA 1QGOA 1GPMA 3U3KA 2FCAA 2D74A 3BMOA 4AO8A 2XIJA 4INPA 4YCLA 5B1IA 2A4KA 5DW0A 2C4TA 2WJ4A 5EWLB 1H4VB 3T3EA 2JJQA 1EP9A 1HFEL 1N57A 5B58T 1QKJA 1TA0A 2Y0EA 1W52X 2N0SA 4G07A 5DHRA 2OMEA 4L73A 4E14A 5CDGA 3KR0A 2XHZA 4XW2A 4MQ4A 1L3IA 3I9NA 4EDFA 5JAIA 4MUKA 3RROA 1JQ3A 3NTUA 4L4YA 3IILA 3ROEA 1R5NA 3QKSB 1KORA 3B9RA 5A9TA 3W4IA 1C7EA 4ECEA 4NIMA 4BE9A 2DWPA 3QXCA 3R3HA 4PSVA 2PUDA 1G8HA 1E66A 3DHWC 4WEQA 3HBNA 2E18A 4GZ6A 1P0IA 2K2WA 2J7PD 8ATCA 1EFHA 2IEYA 3RRMA 1AO0A 1VMAA 3K8OE 4LDAA 2IYSA 4U6SA 5KYUB 5IDXA 1ZN8A 2R66A 2V3WA 3L7CA 2F9MA 1NOKA 1W88B 2F1IA 2ZE5A 4HGYA 3DPIA 3PJGA 1RIIA 4TSFD 1JIUA 2O1XA 5JDCC 3GEEA 4KBGA 2CJPA 4DMRA 4UOEA 2WJJA 2H57A 3RIGA 5AQ1A 5EWMA 4NCIA 4A0HA 5JWHA 1VPWA 1Z47A 1AZTA 1GNSA 2PZFA 2YHUA 3IV7A 3LUJA 4RGQA 4U4AA 1I4DD 3TQFA 3QUSA 4H0FA 3PNLA 1O54A 4ZEMA 4WY8A 1CF9A 2XGGA 3JRXA 1GGHA 3LO5A 3OT4A 3B5JA 5TQ0A 2C96A 1C1YA 4TTPA 1AZSC 3L46A 2AFHE 4WLNA 1QM5A 5FUWA 2QRGA 2JLCA 2YY7A 5K3DA 1T5IA 3I52A 3CU5A 3EIOA 2ZCUA 3UWSA 2ZG6A 3G17A 4BFWA 2FPRA 5TQ2B 8GPBA 4W5JA 2ZJ5A 3FLAA 1LK5A 2BBWA 4H1HA 4ZOLF 1XF9A 4JUCA 1MZVA 4ROTA 3OPXA 2CUKA 3OZCA 4UJ3A 1UK7A 1J22A 4NFYA 3REGA 3M81A 3ILXA 3MS2A 4YCJA 1LFAA 5T4HA 1WBDA 4OP3A 2WG2A 3N2YA 4GVLA 1BMFA 3RAGA 4BAUA 3AP3A 3U6KA 2UUAB 1DKNA 3D59A 1K8QA 1VMKA 3IR7A 2QLJA 4PAGA 3CYFA 4CF7A 3KLPX 2CBXA 4Y30A 3VA7A 2VRCA 2W0SA 4GMXA 4JDPA 1UBLS 4OIMA 1AN9A 2VWGA 2ZJFA 3LYHA 4GGMX 1Z16A 2HPHA 3LZ6A 5KUTA 2P9BA 3D1VA 3B6JA 4RIIA 5COAA 1O2DA 3AUKA 2FRXA 1KU0A 3BXZA 3DT9A 2A5JA 2FPIB 1BEUB 2H4ZA 3Q5GA 1QV9A 2ZTMA 4FN4A 1FMLA 4PCVA 4PG5A 4Y6PA 3ZYZA 1SUSA 3SHTA 4HQ6A 3T7SA 4PLVA 3ZU2A 1SN7A 2NSHA 1QYRA 1NBMD 5F73A 3SC3A 1NQTA 3O94A 4WESB 3FPJA 3EEQA 2J3IA 4RORA 5DF1A 1PGOA 4BLPA 5HUQA 2IIQA 3VKUA 1PG2A 4MSUA 2MR5A 1WOMA 4YALA 2YYAA 3ZOZA 4CM3A 2GH1A 1I24A 4MDYA 1RJEA 4TXLA 5AI9A 1RCUA 1EUDB 1G5RA 3IUBA 3NP7A 1WB9A 1I3NA 4Q4JA 2JAUA 1FLDA 4TQGA 2OHFA 3LDFA 1Y6FA 3FUVA 3JVEA 4B8WA 4NOMA 4U7JA 2VHVA 3MINB 4UHEA 1E1CB 2ZPUA 3HSKA 2WD7B 4RVFA 5LYJB 3CINA 3NKFA 2QWXA 2ZSIA 3SJZA 2AXQA 3TG8A 1L5WA 1ADFA 4NQZA 4D6XA 1PZNA 3AI7A 3DCIA 3TLJA 1SIWA 2V65A 2XLCA 1V6CA 3H11A 3BRQA 1C50A 4DIBA 2JJ1A 5ITZB 1TT7A 1Y6QA 4HS4A 3JD3A 4EI8A 1FX0A 1TW2A 3D6JA 2G5PA 3PUJA 3T06B 1YWGO 1V9SA 4KHZA 4ZDWA 4L5AA 4RPHA 1QZTA 3K9FC 4KMMA 2E82A 1IUKA 1JHDA 1Q2XA 2E4AA 4BWVA 3UC9A 4WCFB 5CXUA 1UR5A 2DZDA 4KH1A 1AHPA 2AF4C 3JZAA 4CKEB 2FPLA 4ZYLA 3M5DA 5G0VA 3HXTA 2VXYA 4NS1A 4F6CA 3QF7A 1JE1A 4AZ3B 1XB2A 2WFMA 2OBNA 2ZUSA 4N39A 1FXWF 4DNFA 3GLRA 4D0NA 1NPDA 2GN1A 1GTL1 5FI0B 2CLEB 1MG0A 3TLGB 4CFSA 4XWKA 2RBKA 2VI5A 3RIEA 3RJTA 1IHDA 3SGLA 3PQ2A 1Z68A 3FUUA 4LNAA 1YE8A 4GG1A 4OCZA 4PLGA 3WMGA 2VH2A 2VHQA 4FWBA 4WXMA 3ZXSA 1A5BB 4C0KA 4ETIA 4ALJA 2EV9A 4MI3A 3JYLA 1EK0A 3UWDA 4WX2B 3U39A 1HTBA 4B48A 1U7HA 1YGPA 2P3QA 2PZBA 2YWCA 3EXG1 1UJCA 3OSZA 2AG5A 4UUBA 2G8NA 2K7ZA 3MCZA 2I8AA 4G4SO 2N3ZA 3DZKA 3JRNA 2L0XA 2CD7A 4Q6WA 3P0EA 3VTFA 3VR5H 3FZYA 2JVJA 3DOCA 1G5FA 5E1BA 3RQSA 1RR6A 4HRYA 5DCYA 1KBOA 3DXYA 3LUDA 3U60B 3WNBA 4GKJB 1H6AA 2H3EA 4JC5A 3RU9A 1E2BA 1SCJA 1VZ2A 4NYMQ 4NAHA 1DMRA 2CZGA 2NVUA 4B35A 1T2FA 1V3VA 2YHSA 3P2YA 4I9GA 3SF8A 4DNPA 1B41A 1BE1A 1FA9A 3LPNA 1K7CA 2W2QA 2HF8A 3NGMA 1CQXA 4N3CA 3H6GA 5TJHA 4CKZA 5K0JA 2QR5A 4CKYA 4JUFA 2GZ2A 4CNQA 1C3LA 2GVDC 3KYIB 4JGBA 2HTEA 4JODA 2DH6A 3AINA 2JAPA 1X1EA 3ODGA 5JRJA 1TEZA 1N8TA 4CEIB 1C7ZA 3DBHA 3CKMA 1N2IA 2HF9A 4YAFA 4M22A 3TOCA 1YS1X 3VFDA 3VKFA 4WN9B 5F3WB 2F59A 4HZUB 3VR6A 4B44A 1D6NA 3FSGD 3HE3A 1RWNA 1II0A 2RKBA 1E62A 1CUFA 1QHEA 4IJKA 3UGKA 4PLZA 4XLZA 3WB1A 1XCJA 3PQ8A 3E3LA 5J9FA 4CN9A 1XNQB 3A9UA 1H8ED 1H94A 5BVHA 3DONA 2HZ7A 5IW8A 4UNIA 4ZQBA 3BFPA 5ILQA 3E9QA 2QP9X 2QRQA 2XKJE 5E95A 5F3RA 1LDGA 4XM2A 2PE5A 1A2BA 4CZ2A 1T4CA 2RGYA 3G0GA 4ND8B 1UJ4A 2FWRA 1ZZEA 3HCCA 5ERXA 4XRRA 5KHAA 5EXDA 1UPTA 4NBKA 5M29A 4YRTA 5JJKA 1IRXA 4LWQA 2BBOA 1EG7A 4F0JA 2AN9A 4DQKA 1ENZA 3GRAA 4OATA 1E3EA 2CBGA 4GYKA 3JQCA 1JKJA 3VGJA 4ZQHA 2CFIA 1RABA 4RPKA 2AVNA 1T9HA 2GEDA 4L6IA 16PKA 2ZUEA 2O0MA 3FCCA 5DN6A 3K0KA 3IAAA 3KL4A 5T4FA 4QBGB 1SQFA 3AUSA 3JQBA 3QVTA 3SHQA 4YRGA 1C3JA 4C6TB 2VP3A 3IA7A 4HX2A 4D92A 4EQ6B 1W0KA 4OMCA 5LFAA 3ZVRA 5KTKA 1FFWA 4X7RA 4JITA 1AGNA 3DBRA 3D3QA 3AK4A 3QYAA 1K97A 4P58A 4D42A 2I62A 5DNUA 3BTUA 1N2CA 2GN9A 1XOIA 2GZAA 2NU7A 1SA0A 2XVZA 1EVLA 1UDXA 3B9BA 3QENA 4AIIA 4BKMA 2LRHA 2OYSA 1UBCA 2PRIA 1KGDA 2Z2KA 4UPVA 4UXIA 4BZPA 2CE2X 2FGJA 2XYRA 5IT9A 1EVZA 1SCNE 1FFDA 1H5NA 1V16A 5FFMA 3C6YA 2C5EA 1IN4A 1AGYA 4LJ6A 5SYNA 1N77A 2X4DA 4TUYF 3BEDA 4TUYB 1UJBA 4L0QA 2RGAA 4MP3A 4Z9FA 4DGQA 4EEXA 1P9RA 1RKQA 2A4MA 5EP1A 5DTMA 4Y2GA 1E0DA 1KOJA 3TB6A 3HN6A 4JNCA 1HRKA 3QELA 4ED9A 1YB2A 1WDWB 3TFWA 4A26A 3NASA 2HA4A 4ZOQI 4MHSA 2O0LA 1QHHA 5CHEA 4BNNA 2AW3A 1KRWA 2YZGA 5LQUA 2A1TS 5SY6A 3ECAA 3GFSA 2WHPA 1M1ZA 5JNVA 4ZU1X 2YRWA 4HN4B 5K3BA 3AY6A 2J3DA 2AUTA 5ICMA 4J9UE 2E85A 2IFTA 2FW1A 3FWHA 3DAHA 2O7SA 3HPQA 1FZQA 1WBJB 3FXAA 3ZCSA 4Z4HA 5JD3A 2BTQB 2AEEA 4WXEA 3GLKA 4DCTA 4LNUA 3IEXA 3PUKA 2P4EA 1FVXA 2PX4A 3NHUA 4HGQA 1F0PA 2QX6A 2LPMA 2FDCA 1GNLA 1QGZA 1D6SA 1DG9A 2WNIA 3JQAB 3PTLA 4L28A 4CM1A 1C7QA 5B2FA 5KTPA 1CQJB 2R2AA 3WGJA 4DDUA 5HS4A 1SQSA 4JAVC 4BPRA 3FUCA 5EPEA 5H59A 4RGVA 1XU7A 2QMYA 3B6MA 3TTYA 2AI2A 3UTCA 1XZFA 3LMKA 4QC2A 3Q7TA 2B21A 4S1WA 3KB8A 2FOIA 2LVBA 4HF7A 1RCTE 2EJWA 3LT0A 4IH4A 1N7HA 2OEPA 1J06A 4RKFA 3O4GA 4QO7A 4E94A 1A4RA 5B7QA 1Y7IA 3P1JA 4WINA 2C2OA 1BHO1 1Z3IX 4N7JA 4CU5A 1OREA 3LCMA 1YR6A 1E6UA 1GQSA 2J0VA 2FEWB 1H2YA 3PNKA 4P33A 3Q9NA 4UQPA 2BJVA 1BMFD 4J6EA 1KR5A 4KVGA 1GGVA 3V4LA 5IT4A 5JU6A 3GLGA 2PFKA 2W0MA 4PWYA 5L3VA 4FYMA 4TLAA 1CQWA 1PJBA 4FDMA 4MV3A 4ZZ2A 2XZLA 1JDVA 2I0FA 1OROA 4FI3C 3PBKA 1KGSA 2MSWA 2DT8A 2XF8A 1NYQA 3SJ7A 3U7FB 2I4LA 2PKCA 2GF2A 1N3BA 3BEOA 1VKZA 4OH1A 2X8LA 2D13A 5EC8A 1FNSA 1CEQA 2NSYA 1Y48E 1FDUA 3L02A 1WUKS 1DFHA 3H9BA 4MAFA 4FJ0A 4FYVA 3W3AA 2CZQA 3PGA1 4LS3A 2BIFA 3MWDB 2GFIA 4M0FA 3UAVA 2CXNA 4RV5A 3UJNA 2A3RA 4N0PA 1D03A 4NTZA 3T8YA 4WFJA 1MX3A 3ZHYA 2Y68A 2OSVA 4DJAA 5JNLA 3KQLA 1A1VA 1QRAA 1YRHA 5L4SA 1O97D 3I9FA 3DZJA 1OOEA 3JCZA 4ZQEA 5KYYA 1OC2A 2I55A 4Y6OA 2R6GA 3QVVA 1LI5A 1ZS9A 1NQOA 1YJ5A 2KB0A 2QXYA 4PYLA 2WEKA 2VK4A 2WWTA 2WJZB 3E8MA 1QIJA 3SJAA 3VDRA 3RNLA 4BGDA 2J87A 3ZV6A 5KX5A 4ENVA 1QG0A 3P9IA 4CL8A 2P8JA 3SBOA 1M76A 1UT6A 2OGUA 1C0LA 4ENQA 2WLSA 2X7XA 2IPLA 3VVMA 3CVWA 1GPLA 1QMPA 3QBEA 2C78A 4WIAA 4XAQA 5HMMA 3RBVA 3FFBA 3WXMA 1LBHA 2NN3C 3LBAA 2VZEA 3PWSA 4PYIA 1T8PA 1CUUA 4OHKA 4XCVA 3CEHA 2JJ1D 4K6GA 5H83A 1CCWA 5CIYA 3QEOA 3GGCA 3WRWA 4OI0A 4F97A 2BGMA 5JZVA 3P9XA 4ZWNA 1YBMA 3E82A 4I2NA 3KQYA 5A3QA 2PH5A 1O0BA 4CIVA 3DZIA 4KI7A 4TVKA 4YK7A 2J8ZA 3T9AA 4CVNA 1AB5A 1G2QA 3G6WA 4MXDA 4P4GA 2W2OA 2FSHA 1Y9AA 4FC6A 1CRQA 2RH8A 3FFWA 4PRYA 4QUDA 5BN3A 5ALPA 2O6HA 4TYNA 1RJFA 2AOWA 5KYVA 1RI4A 1X8XA 1OH5A 1G5PA 1QIEA 2QZZA 2QMHA 3QBJA 1QP8A 1TTQB 1MB9A 3DXZA 4PM4A 3WG9A 3KU1A 1Z26A 1OFUA 1QORA 4OMFG 3BRWD 2ZS8A 4NKRA 1WDLA 1AO3A 4LYGA 4PVCA 2O7VA 4LMRA 1G3IA 1DFGA 1SUFA 2R6CA 4LI3X 1F3OA 4CCYA 1JLHA 4OQZA 3JD2A 4FOPA 3UOAB 2FWJA 4IKOA 1BQ4A 3NRCA 4Z1OA 4MMZB 3T5AA 4DR3B 4AAYA 2PUWA 4QIHA 3QVJA 2J9ZB 3I62A 1BWPA 2VSOA 2YC4C 4FGJA 4HN2A 4LKOA 1JJAA 4MW0A 3RANA 3TNYA 2M6KA 5D5PA 2X9NA 1PHRA 5J4YA 3ZEAA 4L3OA 2LTAA 1E7MA 5JYDA 5LOVA 1J8FA 2IU3A 3M33A 2D0OB 4O4JB 2CWWA 4CUZA 1VG1A 2IH4A 3E2IA 3JXEA 4U02A 2IZ0A 5CLQA 3WX0A 3OE7A 1CK4A 1ZNWA 3GBVA 1QF6A 2Y8EA 1KI8A 3CX4A 3H9EO 3PYXA 5AVYA 2P5TB 2YY5A 3OCJA 5IKPA 1NWHA 2OCKA 2ZXUA 2X40A 4ZPXA 3NAZA 3W2IA 3EISA 4AIRA 4EL5A 4HAIA 2WKWA 4ND3A 1PO7A 4Y1FA 5DYYA 1S3IA 1JQLB 4Q9KA 4DT1B 3GRCA 4MVJD 5IK2A 1N6HA 4HI0E 1IY9A 1MNQA 2BGWA 5JJBA 4M21A 3DXFA 3HACA 2RHGB 4OHBA 2EVWX 2XCSB 5BPFA 4OXQA 4WVFA 5CLIA 5IG2A 2H2DA 4OD0A 3CRQA 5CDSA 3KYDB 1K0FA 1UINA 2WSMA 2QVGA 3D8NA 2P6OA 1M67A 3S8YA 3PDJA 2JBAA 3GLIA 2X6QA 1JJFA 1NXVA 4WJZA 3OPNA 2H65A 1TPZA 4TQ9A 1LD3A 1OT5A 4B6FA 3HVUA 4WY2A 2PWAA 4E5VA 1TRHA 5INTA 2CCJA 4OREX 2G09A 3RIXA 3WOHA 3LUPA 5CM8B 4I5FA 5K8JB 4GXRA 2WINI 3LBFA 4DEXA 4DMMA 3IJPA 2PDAA 3ZW9A 4C76A 4F84A 2EKLA 4PLTA 1AXGA 2P30A 2YV5A 1PG0A 4QOEA 4C1BA 4UVEA 1IBMB 2OHHA 4O25A 4FYPA 4IPTA 5AI8A 3QU5A 4BO6A 2PJRA 4ABTA 1QIHA 2WYVA 1L7QA 4MJXA 4BMCA 1C3EA 4XWYA 2NYUA 1IHUA 4G2TA 4Z4EA 1QGUB 1SVKA 2XA9A 3K1YA 5D51S 2IUSA 1PWEA 5EKXA 3VKVA 4XUEA 4BL5A 4XGIA 4HNSA 3DB2A 1A3CA 1RQGA 5DN6D 2OD2A 4CMAA 4C7OA 1WUTA 3JZIA 3W6NA 1D4OA 1NVVQ 2QQ0A 2HK8A 1RAHA 2GN4A 2H4WA 1MTOA 1IG0A 1W0KD 1PWHA 4X8HA 2BRUA 4KXQA 1T0JB 4PFKA 1W4LA 2FPXA 4DV5B 3V4OA 2ESRA 3WSVA 5A4KA 2UZ4A 3IOMA 3H6HA 5HJ5A 2IYQA 1SXPA 2GA9A 3WBKA 1R6BX 3BB1A 4L9WA 1TJ4A 2DBYA 1TVKB 2JIDA 2YN4A 1M1UA 4ZAVA 4IDPA 2NPFA 3A04A 3A4MA 2GM9A 3NBMA 1SU8A 2PLFA 3C3EA 3ZXXA 2YS7A 3NOVA 2B2NA 3FNHA 1PUIA 5F4BA 2VK8A 4HEQA 3U49A 1ENYA 1JIJA 3A7EA 1PTKA 1R37A 2VNAA 3IVGA 3AXSA 4AJPA 1QTQA 3AM3A 4F5YA 3NRJA 2E21A 1C30B 3TIXB 4GXNA 2Z0MA 1M8FA 3FZNA 1HH4A 1NVWQ 3KK0A 3DDZX 3FJOA 5H4HA 3PJRA 2P90A 3ZX4A 4Q12A 4KXNA 3QYJA 5KBYA 4BFZA 5FWNA 1JTEA 4KQCA 1CZNA 3HCRA 1OILA 4HOYA 1RI5A 5BWOA 1NUAA 2EBFX 2HLNA 3HYNA 2QY6A 2TECE 5C34B 3WZ2A 3CEMA 4B43A 2PO7A 3CF4G 3DMTA 2IQIA 2OP0A 3ZPXA 1CF2O 1C1XB 1M34B 2NO7A 3FGZA 3EUFA 1JFFB 1YDEA 1NASA 2VJBA 4M1KA 3PNVA 5F2EA 3ZDZB 1J07A 2CLMB 2D7JA 4ZCMA 3E9MA 3INTA 4I9HA 3LWNA 3I2KA 4RADA 3I5UA 5LQCA 3URKA 1EM8A 1MH1A 4LHYA 2O2DA 1RPJA 1RQNA 3PRYA 1OYWA 3D64A 4KYTA 1HF3A 2X6TA 3U4DA 5KC8A 1T13A 3L5OA 4JLVA 4X71A 4Z1MA 1U9JA 2OOSA 3ES9A 3T94A 5BXYA 4LDQA 1OBOA 3BJZA 4R2LA 3ZLUA 1W25A 2BFFA 5LA6B 3GB9A 2ZP1A 2QUJA 5E9WA 5JVDF 2W37A 1ZVMA 3EYWA 1S6YA 4DM7A 1DSSG 2P62A 5D6OA 1IVSA 4QXOA 1C3OA 4TTAA 3KKEA 4BNHA 1UZAA 1QHIA 5EIOA 4DCSA 4UM7A 3NHBA 5D7BA 5EIBC 2H92A 4IM7A 4ZVLA 3UYLA 4TTQA 2NVOA 5KYNA 2PD4A 5JZ9A 5I7OA 4I1RA 5F7JA 1IJBA 3C8DA 4L0MA 1GPAA 2XECA 2XUPA 3VOSA 1U90A 2DSNA 1TIPA 3NT5A 5CPBA 5A71A 4K8RB 3O0TA 1QKIA 3HI6A 1EXNA 1QWOA 3BMOB 3C85A 3EAGA 2XA2A 3FBWA 3BFJA 2FEAA 2AKYA 1NW4A 2J6IA 1DTSA 2X0EA 3SSOA 4F12A 2UU9B 3B2QA 1XCLA 1DX4A 1OXXK 4RSGA 2HU2A 3HGMA 5FA8A 1VP3A 2PQ2A 2H4JA 2HF2A 5ES4B 4GI5A 2VJCA 4C0HA 1XHFA 1Y1KE 4IZHA 5BMVA 1P5HA 5JANA 5ALEA 5I6DA 2ZQYA 1I3OA 3UCEA 1UF9A 1C0IA 4HGZA 3NJ4A 1E94E 1HTTA 4UD6A 2OCXA 2XZOA 3AUFA 1M8KA 2XEXA 3EC7A 2OVFA 3ESDA 5DXAA 1Z2DA 5AOVA 4CUJA 2AG1A 1QQ7A 3U9TA 4OQQA 2B34A 2A0WA 2H0QA 2WU1A 5HIMA 1SIUA 4HMPA 2VBCA 1EMDA 4UE3S 1M8GA 2R68A 4A8JA 1TUIA 5EWMB 4QICA 2VH5R 3K4HA 2CKMA 4N5HX 1Z34A 2ECOA 3UA4A 6NULA 5KAMA 1R10A 5CFMA 2WJHA 1E2DA 4HEJA 2OHIA 1PDWA 1E9AA 4DUPA 3KJZA 3B3QA 3GP3A 3QWFA 5TQ0B 4TOIA 3WGNA 2PZMA 2NUPA 3GJ4A 2PGDA 2A86A 4GOXA 2HGSA 4GR5A 3T3PB 2N46A 4DBLC 4RQBA 4MUGA 1MRZA 4Q24A 2QA5A 4BMZA 2VK1A 1Z4OA 2BGJA 3MWFA 1U99A 3HYCA 3NTLA 3PXEA 3JYPA 3PD1A 4PHGA 1XZ8A 2PYDA 2FX3A 2YNMD 3AFIA 2IYEA 3FOAA 1F2TA 1UQTA 4RDIA 2EP8A 3ROTA 1XPRA 1OYYA 2XD9A 5DHQA 2HK9A 4IFTA 3IPRA 5CTAA 2OLKA 3FWYA 4MJLA 3ORFA 5H7XA 1A76A 5GAJA 3DLCA 4U2FA 3PFWO 2NG1A 1NJ1A 4XFJA 3V42A 3M4YA 5F23A 2MSLA 3TTXA 5A7GA 1XKXA 3DJYA 4XVRA 1YA8A 1I8TA 1ZRHA 3E61A 2D62A 4MRVA 2YH2A 2OENG 5HZHA 1BGWA 2GUGA 3KQSA 4LVUA 5D85A 4B09A 3W5VA 4K46A 4RZHA 4FR0A 6ABPA 1JDJA 1D2RA 5FUVA 3IPLA 1H22A 4MWZA 2FPUA 4HEA1 1P0FA 1LVHA 4S2UA 3QWHA 1W8DA 2PA0A 3A32A 1GARA 2YJZA 1JHQA 3HG7A 1JLRA 1S4QA 1J2EA 1FVFA 2GWRA 1P6UA 4MW7A 4RZXA 1HFWA 4NOJA 1QTIA 5KKAA 2ZVPX 1DMSA 1G8PA 1LA2A 2CL5A 3FLEA 3MJCA 2PX3A 4KWHA 4TMZA 3SQNA 4BLTA 2XQJA 5B1SA 3LYLA 4B79A 5FX2A 4HY3A 4XB2A 3GT0A 1VCNA 3HXKA 2AB0A 1J6UA 2BGGA 4REQA 3SC4A 2FXVA 2WLTA 5ESRA 5EJ5A 3T4XA 2C5LA 1J7KA 3MUOA 3OE7D 3RFVA 1XAGA 1FBNA 1O4WA 1VL1A 4QODA 1HE1C 2CJWA 2EZ9A 3IP1A 4Q4JB 5JCZA 4QDTA 4MVJE 4X65B 1F8YA 3RABA 2WHQA 2K87A 3GUUA 3HV2A 3HBAA 1ODSA 4YBZA 3PGVA 4BPBA 1TYEB 3U17A 1KEKA 3DAFA 4AJNA 1I3KA 2FUKA 3TEFA 2QUZA 1NN1A 2JGMA 1DCTA 2WIAA 3PVCA 4JZYA 4KR7A 3KXKA 4FINA 3H11B 2C4WA 4DIEA 3EBPA 3WK5A 3OHSX 4IIJA 1FX0B 2RKWA 1XZNA 5SZKB 3RRZA 3R1IA 2VWPA 3W7VA 1BEEA 2GQ0A 5HQTA 2Y27A 4LSGA 3DM5A 3PYMA 1P2TA 2QL7A 2HLPA 3CF2A 2Y2UA 3FG9A 3NNNA 1BW9A 1OIVA 3NTVA 4JEIA 4TT8A 1I4WA 3NEYA 4HTFA 4J4TA 3MWEA 4LZZA 5FWYA 4BU1A 1I6LA 2R11A 1KOLA 3ZUGA 2JAOA 3NGLA 5E8JA 1IPEA 2VDOB 3DL2A 3K30A 4LBWA 5I8ZA 3V8MA 2Z1MA 3WADA 3P94A 1O94C 5ENDA 3NDIA 3WE7A 1T3SA 3S55A 3DUFA 3NUQA 4Q9HA 2N75A 2AFIE 3N0RA 3AF2A 1XLTC 4PZAA 3JZMA 2VZ8A 2J4DA 2XOXA 1EZ1A 1G7SA 4BRSA 3NTQA 2XNDA 5E0KB 1EI9A 4E12A 1TD9A 5A6SA 4UBNA 5TS2A 1LV7A 2XA1A 3E3NA 5BUSA 3B9QA 4QKQA 3ONDA 3RRJA 1PU2A 4INAA 3NFYA 3S2UA 4RTRA 2HU7A 3NVKI 2ODQA 4GDMA 5UKDA 3C41J 2XBUA 2ID9A 3C6KA 3GROA 5JSFA 4DQXA 3Q7IA 4EHJA 1GZVA 1LV8A 4XVUA 2NVUB 2WW8A 4A5SA 5BSTA 3SF8B 2ZCJA 3A1UA 4JV5B 1NAHA 2ZOSA 4X6UA 3R75A 4L8YA 3TCNA 5J4VA 3RUHA 4QOGA 5BQXA 4QM6A 2GNAA 4AK9A 2M1XA 5HJ2A 1KWGA 5BV2P 1DVRA 3PJEA 4M1EA 4DABA 4E5MA 2O5CA 3GEGA 4MQ5A 1SKYB 3DBHB 1Q0TA 1I4OA 1SVMA 1BRTA 3J81k 4GICA 1O5OA 1JS1X 1MO2A 4GM1A 2GEUA 3VNSA 3B1JA 1ODFA 3H6KA 2P2GA 1F1BA 3A3KA 4MYDA 4R9UC 1RM0A 3D3WA 3PTAA 2R7MA 2Z4TA 2UV8A 5BVHB 4QYWA 1SCUA 2Y67A 4GLJA 1P1CA 2GCIA 3D2BA 4GQBA 3KUCA 4G1FA 2H3HA 1CUGA 1QFYA 2ISQA 1T4CB 3VR6H 2YHAA 4DPMA 3FA2A 4BVBA 5A4AA 3MWJA 4LHVA 1KAEA 2CEKA 3D3EA 1AGPA 2CY0A 4MWBA 4NBTA 1JALA 1X1TA 1YHNA 2ZYAA 4HKTA 3O3OB 4AG3A 3PUHA 3DL7A 1A5SB 3ZQKA 4AT1A 3ORRA 3I37X 3P9YA 4XD7A 4XYEA 3QF4A 2B99A 2PKEA 1SAYA 2ISCA 1JKJB 2QIPA 3A9WA 4MUNA 2R2GA 1BJRE 2HF7A 3HCPA 5HCIA 1IZ7A 2AMJA 1HEUA 4FZ5A 5CB4F 1AS0A 3TSWA 1ZJ4A 3VC1A 2XRYA 2EW2A 3LGAA 4HQFA 3AJRA 3IUQA 2BPOA 3VKWA 3R9KA 4HVCA 2FUG1 2P5UA 4J0IA 4HDRA 4QBKA 4BFSA 2ZUWA 4DL9A 4ZCQA 5A1TA 5FAKA 5DXFA 3X3HA 1R6VA 1BVRA 3LQ2A 4I46A 4IH1A 5IAKA 1GYQA 3DBRB 1WZCA 5FDFA 1K86A 3QMVA 3KCQA 3AUAA 2QT0A 4GPAA 2JEZA 3AIMA 1N2CB 2ZYVX 4FNGA 1E9FA 1PV2A 2AN1A 4WRRA 2NU7B 1DBRA 1SA0B 4BVHA 5K99A 1P3DA 1XNHA 5K6RA 1G7TA 1K9VF 2IYYA 3JVUA 4IFEA 2C7QA 1QU3A 2OBFA 2ZB8A 3EHEA 3ZWMA 1YDMA 1QFZA 1XFAA 3SLGA 4G0ZA 3C0KA 2KPOA 3DFUA 4DANA 2GBGA 1V16B 4NNOA 4CM4A 3DGFC 4BMSA 5A9SA 5HQ3A 2QYOA 5KYWA 2BD0A 3DD5A 1Z6ZA 1UXKA 3CT4A 3DEHA 3QVUA 3WIOA 5IH3A 2PMEA 1IQ0A 3GEPA 3FRJA 4B3RB 2B4QA 2DQSA 5CDUA 1Y3HA 3THYA 1DLJA 3AVYA 3OJWA 5HQJA 3KJEA 5HOQA 2E4ZA 2DFPA 3QELB 3EEBA 4O1MA 1TOAA 2JLVA 4LG1A 3PR1A 4ZVUA 1GPH1 2H8GA 2DFDA 1UPUA 4YDRA 2D1TA 3N59A 5EPOA 1QHHB 2OLEA 1U0FA 2BKEA 4NY1A 2OXEA 3NW9A 2R1UA 4UBOA 5I9IA 1YCHA 2AWOA 4CGZA 2WHPB 4JLDA 5LQJA 3ENKA 5GY7A 3U4CA 4DR5B 4H59A 3TL3A 2ZIUB 2H1CA 2WVJA 4KG7A 2H48A 1I6MA 1XG5A 5LC1A 1R6AA 1UFQA 4ZXFA 4URXR 4LNUB 5T5QA 2VF7A 1V39A 4LCEA 2GNOA 3EGXA 1LRLA 2NLOA 4XIIA 5HIKA 1RWVA 2PG3A 3GLSA 2H4XA 2I1VB 2CJYA 2QT9A 3BCUA 1GGFA 5AHXA 1BOFA 7ABPA 4RV4A 4UTZA 8ABPA 2J45A 3TGWA 2WJPA 4FW9A 4L22A 2ZQ5A 5IT5A 2BSQA 2AC7A 4AO6A 4AP9A 3SVLA 4TWIA 5DISB 2JFFA 3N39C 4UDYX 5CYFA 1Y98A 1ACLA 1N36B 1Y4SA 1T3LA 3KT6A 3OVMA 3Q7PA 3AEQA 5JDIC 4DQVA 2IXTA 2DM6A 3EW9A 2IY8A 3FLBA 1OTYA 1ZJJA 2ZUUA 1V41E 4KFSA 1K66A 3ELWA 4F93B 1UIRA 4UW9A 5ALFA 9MHTA 4U2CA 4N01A 5I51A 3QYPA 2FN9A 2AJTA 4RK6A 4EO4A 1XTVA 4TKLA 5IDYA 2IU0A 1MC5A 1N6LA 1IN6A 1UC4B 1DDOA 1NNLA 1YZQA 3CF0A 3RUIA 2N9UA 5JARA 1M54A 4W1RA 5GADl 3GLGB 1C1HA 1Z0UA 3DV0A 2YHBA 3OWOA 4UTXA 2J7KA 5FCDA 4ARBA 3EDMA 4M99A 1A5ZA 4H15A 3ANYB 5H3CA 1Q19A 3L7DA 1UBEA 4II2A 4P4UA 4E4YA 3BWBA 4W5QA 3X2SA 1N7IA 2K4MA 2GJKA 3D8BA 2ZUCA 1GAXA 4RY0A 2CWDA 4ZMRA 2O54A 4F71A 4FB4A 4GZ5A 2V7TA 2PWPA 1TX4B 5DK4A 4B6QA 2FXIA 4BNFA 1MO5A 4UUNA 3DLHA 1TEVA 4FHDA 2DVMA 2C99A 3IKLA 3K73O 5KDOA 4FGLA 3MELA 1NVAA 1I7DA 4MRSA 4IO1A 3Q6MA 4ZC1A 3W3AH 5KYYB 4ZEOA 4BMPB 1DKPA 1QF7A 1YK1A 4LUCA 2HUPA 5LDHA 1QRTA 3T7RA 2VJPA 5KX5B 4YQZA 3PNMA 4KQGA 1XO1A 3UK0A 1XRLA 3GRZA 4P35A 3NHFA 4YJ3A 3UJHA 1XA3A 4UREA 3W8FA 4YMHA 3QUQA 5L51A 2IUFA 1XA0A 2V7UA 4RLFA 3GN1A 4E4TA 4D4HA 2R96A 3D43A 1FU8A 3ADPA 3M70A 2J07A 3PHBE 4K8OA 4OXXA 4UARA 2WZQA 3L79A 3VZDA 5C1OA 4L2IA 1NQXA 1RP1A 2AR9A 4H6PA 5EEGA 1VCHA 5BV8A 3CONA 4RF3A 4Q9LA 2EEZA 1TYCA 3H5OA 2ZVQX 1K8RA 2YVQA 3CX6A 3L9XA 1K06A 2HJVA 4AICA 1FDRA 5BUZA 3ZHBA 4FGWA 4CFZA 2QKYA 1R74A 5C2JB 3MTBA 4EKDA 2BELA 1NQAO 4N0QA 1WKBA 1ETUA 1JKIA 1WXDA 2OZKA 4UOZA 1VBNA 5BN3B 1P9NA 1YMQA 4NP6A 4O2LA 1AQNA 4UBKA 3PWTA 1YAJA 1GZSA 1ZHOA 1QOQB 5I3ZA 4M4SA 2Q8PA 4INZA 1YZVA 2I34A 5DIZA 2PX2A 1CQPA 2CJFA 3TQSA 4E6PA 3A26A 1PFGA 1FFEA 3T9DA 3W9BA 2O7RA 4P84A 1V45E 1RXIA 3UWPA 1DQRA 2HAEA 1MJ5A 1Z0KA 2B3TA 1G5HA 1AQ6A 1JU9A 1SZCA 1F4LA 4JLWA 1RYNA 1G5TA 3SLKA 421PA 5L8VA 4PC6A 3ZUPA 1BJTA 1Z5UA 3GZ4A 1G21A 4YAEA 1VE6A 4F5DA 4B8YA 1LB1B 3LPMA 3WYBA 5LOVF 5K0TA 2HREA 1NVDA 1QB8A 3BJEA 4WA8A 5BW6B 2HRQA 5LOVB 5J2TA 2ZEJA 1X80A 4CTNA 3UG6A 3VKGA 3KHSA 1YASA 1KY2A 3OEHA 3T61A 5LKRA 4ZYUA 3IKJA 3N53A 5BWCA 2WAYA 3AB8A 1ULBA 1RQRA 4CL2A 1AUPA 1N1GA 4WOJA 2AR0A 1LNZA 3DE1X 1Q20A 3P19A 5LZ8A 3ZU5A 4KNYA 4G63A 3BM5A 3TINA 1JDUA 4I3HA 5JAOA 3ER9A 1QYDA 3E7WA 4NZMA 1MT3A 3EC2A 4FCWA 1ZGAA 3TAXA 2BM1A 3WO0A 2QD4A 4J1NA 2ID4A 3RSLA 2NP7A 3L7NA 4UMFA 2I3BA 1TAHA 1WHTA 2P9GA 3D7NA 1XVAA 1EXDA 4C6HA 1SC4A 2EC5A 1P7CA 3VMMA 4CWAA 2J4CA 3F6EX 1EIZA 2QX7A 2NUTA 3RRFA 1GKUB 3NVAA 5FV7A 2X4GA 3BWVA 1Z8DA 5A6VA 1V8DA 3RSZA 3GLIB 2B5OA 1XQVA 1PHPA 2ZU0C 4KO1S 2PU5A 1KI6A 3AQIA 5K3FA 1NLUA 1RYEA 2D3TA 4I8DA 2JHCA 5ABPA 3WDMA 5A4DA 5HUHA 4MHTA 4O2BF 5FTKA 2Q5IA 3HUUA 1OA1A 1ATZA 2EIXA 5D2CA 4ALIA 5JSHA 3UBTA 3TN7A 1BCSA 5HMLA 2PD6A 1U7ZA 4G0MA 4XD7D 4DCOA 2FWIA 3DEAA 1JR6A 3AJDA 3ESQA 4R1SA 4C0QC 2Q5OA 4ZDIA 3PLNA 1AUXA 4EB0A 1MO4A 1H3NA 2IOQA 3A4VA 3O03A 5DHUA 3R9XA 5GGXA 3SKVA 3SJCA 2PLRA 5L45A 4KO8A 4TTRA 3NTXA 1N6IA 4IL5A 3RFTA 4GSYA 4P93A 4C7OB 2JBWA 1XD8A 2FLWA 2GPTA 4GM4A 1KS9A 1AK2A 1PUXA 2HK6A 1NVTA 3GZNA 4FD2A 4I0WB 5LD2B 4EUSA 4TKUA 1M5TA 3X1DA 3GPIA 2WQ6A 3FOWA 1WIWA 3ANLA 2P9TA 1T36A 2ZUDA 3NDRA 3OZFA 1OXMA 4V03A 5HF6A 3BCRA 4O4HF 5G2OA 2VLIA 3MAAC 1CY0A 3IYLW 1CJCA 2G7MC 3LL4A 3BFKA 4IUDS 4QX6A 1E3LA 4X94A 3S8MA 1GUBA 1JQEA 3H5TA 4EENA 4Q5IA 4X64B 1LBSA 1NOJA 4BX2A 2GSDA 3DE4X 1E69A 3G5TA 2J9RA 4RGYA 5FJJA 4K05A 4TS4A 4L0DA 4DDKA 1TU3A 1KYQA 4DDWA 3UMFA 4QHSA 4PBRA 2WJIA 1TU0A 4DDTA 2WD9A 1Q7CA 2GS9A 2ET6A 3ETDA 4KO4S 1K6XA 4I50F 3VSAA 1KJWA 3SNHA 5CT8A 1Z62A 1K7FB 2JVKA 1L4KA 3LWBA 3ITEA 5EGSA 5U4XA 2ZSDA 2RBEA 3AKYA 3QVGA 1A5TA 3F3YA 3J81A 1XCPA 2FH5B 1ZITA 3P9NA 2Y1WA 4B7ZA 2FWPA 1SPXA 5FO0A 3AI1A 5D8DA 4RMNA 1PJLA 1NJFA 1E9CA 1TB4A 1UADA 1T1EA 1VGVA 3LQFA 4MS4A 1CRPA 2L42A 4KZPA 1R0KA 5AUQA 1KQFA 3ZWPA 4E5DA 2OD7A 4KRYA 4LF7B 3F0TA 4NVRA 4RTQA 1P31A 2B4YA 3U7GA 1EFLA 2EHDA 3ZTYA 5CBPA 1EM8B 2BZ1A 1QO0D 2MYNA 3H9GA 1BVUA 4BQRA 3KWJA 3TM4A 1EWKA 5FL7A 3GFOA 5EKDA 2BFFB 4Q1DA 2E1RA 1ZCAA 1ZP6A 3C3WA 1RM5A 3MUEA 4PSAA 3WHIA 3CNQS 3ORQA 5K05A 1RAFA 3CS3A 3IDFA 3PLRA 1U7WA 2Z2XA 3HXQA 1C3OB 4NYJR 3W1WA 4YRJA 1DRVA 2OXRA 1WHSA 5DVZA 3HJAA 3L0CA 3ZN2A 5HUJA 3K9GA 3B6ZA 3AM5A 3W5SA 1EX1A 5CGQB 1B6TA 4BX0A 3I28A 4J0QA 5BOVA 1U0TA 3AX6A 2EAUA 1H6DA 2RGWA 4MGKR 3MGKA 2AMYA 2ZJ3A 3R44A 3GLHA 3O1LA 2QNRA 3ZHZA 1E2NA 3EGWA 2XJ9A 4K1XA 4D1YA 4DOMA 5JD4A 1AKRA 5M04A 2VRBA 2DPXA 5J63A 4B0OA 2CF5A 4ITVA 1MFPA 5E4YA 1QONA 5LM3A 1R16A 3SSAA 1O87A 2LDXA 4DIOA 3BMCA 1OPRA 1W44A 1RQPA 3FOCA 2VA9A 3F7NA 3MIIA 5J5CA 3WWEA 5C9ZA 4YXFA 2SICE 4JBYA 4EECA 2AQHA 1I01A 2FLVA 3ZVLA 4TYWA 3L8FA 2PXXA 4L5JA 5ICCA 3WGYA 4MUFA 4KLRA 3BGDA 3H5WA 4MRPA 5BMVF 4D8YA 4OAPA 3ASZA 4OB8A 5BMVB 4UZFA 1CR0A 4UNNA 3UGTA 3KKLA 2FMHA 3WFIA 1J39A 2FZCA 4RF4A 5CDYA 4GX0A 2R8XA 4C14A 1UXOA 1G3QA 1AE1A 4MCHA 2VSNA 4C3OB 1QSGA 1IN7A 1OV4A 1VMIA 3OZUA 4DB4A 3MTJA 5HJEA 1P18A 4WBNA 1I4TD 2CKDA 2X9VA 1HQKA 3LQ4A 1L4LA 4JKYA 1P2GA 1EE2A 1ZH0A 3OOHA 4ZO8A 5CW2A 5HPYB 1LPPA 3PFKA 2HQ1A 1AV7A 2NXJA 4A8JB 5GJBA 1NRJB 1ZKDA