2NMVA

Damage detection by the uvrabc pathway: crystal structure of uvrb bound to fluorescein-adducted dna
Total Genus 224
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
224
Knots found
sequence length
652
structure length
620
Chain Sequence
DRFELVKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINKKERQKVVEQMEHEMKEAAKALDFERAAELRDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/dna
molecule keywords 5'-D(P*TP*TP*TP*TP*T)-3'
publication title Damage detection by the UvrABC pathway: crystal structure of UvrB bound to fluorescein-adducted DNA
pubmed doi rcsb
source organism Bacillus subtilis
total genus 224
structure length 620
sequence length 652
other databases KnotProt 2.0: Artifct K 41
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2060.10 Alpha Beta 2-Layer Sandwich Penicillin-binding protein 1b fold Penicillin-binding protein 1b domain 2nmvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2nmvA01
2A7QA 3QKSB 4PO9A 2NPIA 1SKYB 2N42A 1Z2CA 1PV4A 3C7KA 2OCPA 1ZNZA 3UMSA 2ZRHA 1NN0A 1OFUX 2IYYA 2Z4SA 1NRJB 2ZYWX 1FX0B 1G18A 2FFHA 1XPRA 2G0TA 1G3RA 3PENA 4A2QA 5K8LA 3V4RA 1KZGB 1TUEA 1MKYA 3BORA 5CIWA 2XNDA 2NO1A 3L8ZA 3DO6A 3K9HA 3NXSA 2WIBA 2J0SA 3QQ5A 2OCAA 1GRRA 1FP7A 3F3YA 3X1ZA 1J8MF 2QROA 2BOVA 2ZYVX 3AUYA 3LQQA 4F91B 3ASZA 2GK6A 5AJYA 4A6PA 4WZAE 3PUWA 3K9GA 2ZSEA 4YDSA 1E69A 2ZSAA 2YVUA 3IIKA 2E9SA 1IN7A 1WA5A 1ZW6A 4QBGB 1GM5A 2X77A 1FX0A 3M6AA 2GKSA 2NMVA 6Q21A 4OQMA 1ELOA 4IDOA 3J81k 3KXIA 1CXZA 4LCBA 2WSSD 2YINC 5M04A 2NIPA 3AKEA 3W9YA 2HJVA 5LDDC 4HB0A 2UVQA 2BEKA 4CEHB 3AF0A 5KO2A 4YXWA 1XPUA 2OFOA 2AFHE 4GP6A 5JWHA 2WKPA 1NY6A 4HAZA 2F1IA 5BQ5A 4QL3A 3ZGXA 3FHCB 2QBYB 4AKGA 1ZUHA 4M22A 1E2NA 1NLFA 4XJXA 1OPXA 1T3LA 3WBJA 5CLQA 2B92A 2ZYTX 3L0SA 2FH5B 1MABB 3U7GA 1VCNA 4QGFA 3PG5A 5DHAA 1FMLA 3Q5DA 5EXXA 2D7DA 2FZ4A 2YV5A 3BH0A 5EP2A 4CEHA 3LO5A 1W44A 1J90A 1TX4B 1U0JA 3FWLA 4RSGA 3HPRA 4LYHA 1D2NA 4PPNA 2GAOA 3B85A 1ZP6A 2CHQA 3KDSE 3C14C 8OHMA 2P6RA 2QBYA 4OHXA 4NE2A 4Q47A 4KCGA 1JR3E 2IS1A 3ZQJA 2ODEA 1W7AA 3EASA 3MRSA 2DFTA 3U60B 1N2CE 1P4SA 2UZIR 1MABA 3SR0A 2N1BA 4BZPA 2IYXA 4X8OA 5GVSA 4PQYA 3VU9B 1TU3A 1D9XA 2WPDD 2XEXA 1PJRA 3QXSA 1KJWA 2OBNA 4DCTA 4HB2A 4D25A 3EWSA 1M74A 4PR0A 2D3WA 4XVRA 2BMEA 2C9CA 5HKKD 1YRBA 1F6BA 1MR3F 1UKZA 4EPYA 4R9UC 2XITA 4Q01A 2BMDA 3OFND 4C0LA 2HF9A 2CL6X 4U00A 3GFOA 4OQXA 1SXJB 1KZ7B 3D3QA 4ACAA 1FW6A 3P1JA 4ERNA 1LV7A 2YKGA 4N0DA 1Z5ZA 1ZM9A 3WMFA 1D2MA 421PA 3E1SA 1E9BA 3K9LA 3O8RA 1UBEA 1CR0A 2OBMA 2WMNB 3WY9A 4BFVA 2H1LA 1DAIA 1HEIA 3L0PA 2RGDA 4N0EA 2AWOA 1G7TA 1ZYUA 1W0KA 4M8NE 4RKEA 3KTAB 3OESA 3K09A 3BWDD 1SXJA 2CCGA 2PL3A 3KUDA 4MUBA 4IDNA 1XTRA 2ATXA 3V00A 4P4UA 5F98A 3QXXA 1KI8A 4Y0AA 2KE5A 4DDWA 3VNVA 4TLAA 1A82A 3KB1A 4KSCA 2QENA 4AI6A 4YMWA 5D3QA 1KMQA 5FOTA 1AJEA 1IHUA 1OFTA 4R98A 2JJ1A 4E22A 2GXUA 1F60A 1CJUC 3QG5A 3QKTA 3JZMA 4EPRA 1DAMA 1VMAA 4QJ5A 2ZJZA 1QVAA 5H68A 3ZYCA 2C96A 3C15C 2HT1A 1NP6A 3TUJC 3ADDA 1E2HA 3MWJA 3KTAA 1CS4C 1RVDA 2VP2A 1SXJC 3ND8A 2DB3A 2JJ2D 2PLFA 1T8TA 2NOAA 3KJIA 1XD9A 4PO8A 1G1MA 1NKSA 4QXAA 3VX4A 1H8HD 4NYIQ 3DVLA 4EFLA 1VIAA 4R7ZA 1N6RA 2OLKA 4CEIB 3EWAA 5KNBA 2ERYA 4HUTA 5EE1A 2QGNA 4B2LA 2WWYA 4GZMA 2ZAOA 1ETUA 1W48A 1KHTA 3BD9A 4M1MA 1X8JA 4GOJA 4CF7A 2GESA 3GJ5A 4C30A 4DIEA 5DHFA 4D4LA 2IBMA 3FE2A 2GXSA 3KKQA 3GLFB 3EA5A 4B76A 1I2MA 4EJSA 1ZM4A 4C0JA 4B73A 3WNCA 1IN6A 4AKIA 1DS6A 3CLVA 1GSIA 2AD5A 2WWHA 3EG5A 3C5HA 5J5CA 1R0XA 3VQTA 4BLOA 4CEIA 1E6CA 2W0SA 4XSHA 3ZZUA 3BE4A 4KBFA 4IFBA 3WRXC 5FTNA 1EFCA 3W3AA 1PZNA 1MV5A 1E9RA 2WOJA 5CB8A 4V03A 3LXRA 1SVIA 2C03A 4QC2A 2R44A 2XOKA 1IXSB 1YU9A 1OYWA 4B47A 4BQSA 4EKDA 3RC8A 4A82A 5E7MA 4C0SA 4G5GA 4DLYA 2CNWD 4RKFA 5A4JA 1KIMA 2WMOB 1HQCA 2QP4A 2NPFA 3QPWA 3HJHA 2A5JA 5JJKA 3AQ4A 5FH9A 2KB0A 1KI6A 4JT4A 2GJAA 3OEED 4D4JA 1TPZA 1TQ2A 5E3HA 3KXKA 1FTSA 3AKYA 4F4CA 4KO8A 3CPEA 4RD0A 3GLIA 5TXGA 1OIWA 3I3SR 3SNHA 5J40A 2PCJA 3A1SA 4B48A 2IXEA 2QA5A 2IYLD 2FGKA 2RKOA 1KSJA 3E5HA 1VKJA 3AM1A 2CLDX 3FOZA 2V4ZA 2ZI9A 4OBEA 3QPUA 2FPMA 2FZLA 5BYJA 2W6IA 4EIWA 3EC2A 2ZM5A 1GKYA 3H84A 1IXRC 1Y63A 3SU8A 4JL6A 4RZUA 5DE3A 3CM0A 3B8HA 2ZVPX 2C99A 3OEHA 4DIDA 2WTUA 5GJWC 1Z3IX 4KU4A 1TEXA 4P3YA 2J0UA 2J7PA 4KVAA 1N0VC 3PFIA 3I62A 5JZVA 1XF9A 5JEDA 5LD2B 2LKDA 1NG1A 2W2VA 1NVUQ 3K8YA 1RFLA 1KOFA 1NN5A 2AX4A 5EQTA 1H8EA 3NDPA 4PQFA 1E2LA 2O0HA 1KDRA 1DVRA 2VHCA 1XDBA 1OXUA 4RVCA 1OH7A 2ZRDA 3SHWA 2NO7A 3LAWA 1WE2A 2EW1A 1KNQA 1EXMA 1NKTA 3CWZA 5TB5A 1J70A 3U7EB 4C0KA 1XRJA 3CH5A 2I3BA 4TQUS 5E95A 3LBIA 4IOKA 4PZZA 4ARZA 1QBKC 5DN6A 4PAMA 1X8KA 5FR1A 3L82B 2FEOA 3GLGA 3ZZ0A 2ZR0A 4PSVA 3WYFA 4TTRA 3AP1A 1YKSA 2IYQA 2QMUA 3CRW1 1ZBDA 3CRVA 2MMGA 3MUFA 2I1QA 3NIBA 3TSZA 1BYUA 4B34A 4BLRA 4Q4AB 4MRNA 4HUQB 3I5XA 3QIAA 4FMBB 1ZM3A 821PA 4LV5B 2EU8A 1D8TA 2Z4RA 4MGZR 4OQNA 2BV3A 2Z6VA 3KKNA 2JDIA 1GKUB 3X1WA 4D0NA 4M53A 4BECA 3B82A 1WBDA 4AURA 2GEUA 2XTNA 4MKHA 4HDOB 1ZUIA 1T91A 3KX2A 5DYIA 1GZSA 2F9LA 3B1ZA 1EFRA 1F48A 4HAUA 4PFSA 1W49A 4R2IA 5JRJA 1KAOA 4DCNA 1IAQA 5FTLA 4DVGA 2ZROA 5KSOA 1WB9A 5CJ2A 2ZJ8A 4JLAA 1E0SA 2OUKA 2GAAA 4LHVA 4CGZA 3PCRB 3EPHA 1II8A 1SVSA 5KSZA 3IQWA 2A9KA 4LV6A 4L9WA 3THWA 2REBA 2OESA 1N25A 1OB2A 1J99A 1HA3A 1NF3A 3FVQA 4FN5A 3HU3A 2BMFA 1G8PA 1VTKA 1E2EA 2I4IA 3H86A 3IHWA 4IJMA 4JL5A 1W5TA 3RYTC 2FFAA 2P5SA 4TT3D 2V55B 1L8QA 1XX6A 2CK3D 2EFCB 2OV2A 1UKEA 3GJ8A 1KDTA 5CIQA 3CW2A 1P2SA 1GL6A 1TQ4A 1HYQA 4LJYA 4GZLA 3HYRA 3TQFA 4EPVA 2AD1A 4OHVA 1XJCA 4P0TA 2YWFA 4QKQA 1A1VA 5AJWA 4IVQA 3ADCA 4MGKR 1G6HA 1XFAA 4KFTA 5SZKB 1UFQA 4QFMA 2X2FA 4I4LA 3AVYA 2GZDA 2P67A 3CPHA 1NBMA 5GJVC 1FMJA 2SHKA 2J0VA 1KI2A 3B5JA 1FL9A 4AYWA 1P72A 1OV4A 1J2JA 2IT1A 3FFBA 4O3MA 1XMVA 3GJ3A 4HI0E 1JNYA 1NY5A 1XBTA 2DCUA 1M34E 1XEWY 2WOOA 2WIAA 4FWIB 1OE0A 5EP4A 3IO5A 3IPYA 2QQ0A 2EWVA 1E2PA 3TGPA 2GK7A 3LW8A 4D82A 4DT1B 5DNYB 2ZRNA 4JKYA 1GILA 3TR5A 1MH1A 1G8FA 1VG0B 3ZVNA 1G3UA 3GLHE 1JECA 1NN1A 1A2KC 4C0BA 3SJBA 4PHTA 4B75A 3K0AA 4P31A 3AVXA 4GI7A 1T8UA 2JIZA 3GJ0A 2ZS9A 3VR2A 1B0UA 1CRPA 3U44A 3FMFA 5J4HA 1KK1A 3QVUA 2JCSA 1CLUA 3QKRB 3VTKA 1P5ZB 1Q1BA 2ZAMA 3QEOA 1P7CA 2EFGA 2PEYA 1JR6A 4DLXA 2ZUDA 1WMSA 2ZJAA 4U02A 2IUUA 2QGZA 4N3NA 2FEMA 2QY9A 5EP1A 3VHLB 4DWJA 2R6AA 1E1RD 3SBDA 3IGFA 1A4RA 1KMHB 1VDZA 4RD1A 2J59A 2EFHB 5KTYA 1WDTA 2JLYA 2B6HA 4LJ8A 3QKRA 1QF9A 4JBYA 3LRPA 4YDHB 3VNUA 4HAWA 2RMKA 2FNAA 2GJ9A 1M7HA 1ZIPA 1JJ7A 2VBCA 3W8RA 3WBKA 5HZHA 1ZU4A 5B2ZA 4A2WA 3WHLA 2V1XA 3PEWA 1KSHA 2JLSA 2AKAB 4QGHA 5L3QB 1S9HA 2MSEB 2AN9A 2QE7A 2O0JA 4AK9A 4WBSA 1ZJ6A 4DDTA 3ZZTA 4RCZA 5EP3A 2O8DB 1IY1A 2FU5C 5FPSA 2YZ2A 3E2IA 3I32A 1VG9B 2ZI7A 3RABA 4M21A 1FZQA 3HDTA 3VKWA 4WZ6A 1Q12A 2Q3FA 1E2KA 1RIFA 4MQBA 4B43A 1T4GA 4EDHA 2BEJA 1XP8A 1VPLA 3CRMA 2ZJ5A 1DOAA 3O8DA 3FMPB 5BN4A 1E79A 3UWOA 2JLXA 1T0HB 5DGXA 4YONB 2DR3A 2NZJA 1RKBA 3SYNA 1GNQA 2VO1A 4JVSB 2IHYA 3QG1A 1YR6A 1NI3A 3ETLA 2ZRBA 1RYFA 2WJGA 3E70C 3SC3A 2IS6A 3AF3A 4ZDWA 1UBFA 3VHXA 4Q9LA 1AS0A 4XWKA 4ZCIA 1U81A 2ATVA 1JQJC 2WJVA 4AYTA 4ITRC 4TLDA 1NVWQ 3IUYA 1HT2E 1X86B 2IYUA 4NCNA 2Z43A 5KYKA 2RGEA 2QMEA 4Q19A 1NSFA 1TQ6A 1YZQA 2RGCA 1AZTA 3LA6A 5FOVA 4HB3A 2ZRGA 5A5GA 2GVDC 1Z0IA 4D81A 4L16A 3FWYA 1S8FA 4OJQA 1N6OA 3SHFA 1P2VA 4KI0A 3DL0A 4PC6A 5L3SA 3MWKA 1G291 2ZI4A 2CL0X 4W5JA 4A2PA 3A37A 4DKXA 3N2EA 4FCVA 1W47A 4XTCS 3PEYA 1UBGA 1FQJA 1AM4D 4AIIA 2W6JD 2VH5R 2WJYA 4IEIA 4G01B 1TL7C 3C8UA 2CE7A 2OAP1 4NONA 2PJRA 3BOSA 1KI9A 3IBYA 1GUAA 3TAHA 1N6IA 5IK2A 2JAQA 3TVDA 5EE0A 1CP2A 4Q7LA 5AJVB 3KQUA 1KJZA 3U3JA 1YZNA 3ZS9A 3AEZA 1E9EA 1U9IA 2NQ2C 5H8WA 2CCKA 4JBXA 4Q21A 2GCOA 1G5PA 4TN1A 4US2R 1BH2A 4L5BA 2WVJA 1S96A 4K81B 4KXFB 5DO9A 4B6EA 2QTHA 1N6LA 4YQFA 4P32A 1R7RA 2DYKA 1F2TB 2YOHA 5DI3A 2DWPA 1ZINA 1BOFA 1EK0A 3CF2A 4C2UA 2E87A 3PEVA 3EAQA 1TF5A 2G0NA 4BASA 4X8HA 1UEJA 2IA5A 4LHWA 3X1DA 2XSZA 1KI7A 3I61A 4AG5A 4JLJA 2YC2C 3U61B 2H16A 5TMPA 2PLRA 4Q4HB 4A6XA 3A58B 4QGGA 2AFIE 4L4UA 5D3MA 4FINA 3V9PA 2QG6A 2A5YB 1XWIA 5EZ6B 2FSHA 2F1RA 5HE9A 3UATA 4DLUA 4DB4A 4O2LA 1VCIA 3K1JA 1BMFA 1F2TA 4Q1FA 5KOYA 1UEIA 4EPWA 4C7OB 1M1YE 2E1RA 4MYUA 1MOZA 1GITA 1G19A 4LHZA 4FMCB 1MRNA 1E1QD 5L3RA 4AY2A 3CB4A 3GJ4A 1P2UA 1R4AA 1G9XA 4TZ6A 3A8TA 1XXHA 4XSGA 1ONBA 1HUQA 5CB6A 1T3SA 2FFQA 4LBYA 1E32A 2P2LA 2IC5A 4JKIA 3PUXA 3ONWA 5CK5A 3KJEA 2ZTSA 3ICEA 1G7CA 3SQWA 3U5ZB 3GFPA 1Z0KA 2AK3A 3HU2A 3KJHA 3IPXA 3UXMA 4PQRA 4IOLA 4NCKA 5JI3E 3C16C 3RRMA 3WP1B 4ILEA 3U7HB 1CF4A 1E9FA 1ZD8A 2Q3MA 4EPXA 5CK4A 1J8YF 3CO5A 4BZQA 2ZR7A 3G0HA 1ZU5A 2OG2A 1GDDA 1ZUNB 1NMZA 2GZHA 2QT0A 5KSPA 4CYMA 2CJWA 4FMDB 1UDXA 3CIOA 1KO7A 1BS1A 1CJTC 2ZI3A 2VHTA 2HYIC 3QEJA 1E2FA 3W34A 1L7VC 4IKEA 3W5JA 2WWFA 5DH9A 2O8BB 2XXAB 1Y3AA 3IBGA 1G16A 4C0QC 3GPLA 1W4BA 4BFZA 2QAGB 3QKSA 3DM9B 4B3BA 2P6UA 4BWYA 2W2XA 5FBWB 3HU1A 1Z47A 1YZGA 5BYKA 3WNDA 1K6MA 5JI2E 3A36A 2J9RA 1OFIA 4OQLA 2HEIA 3RS7A 2ASEA 1RYHA 4MRRA 3ZH9B 3KJGA 2REOA 1U99A 3WRYC 2ZE7A 4JYBA 1MO3A 4KV9A 1OH5A 4I1UA 1J7KA 1KAGA 4LRWA 1QHHB 2FGJA 4E09A 2XXAA 4WVFA 2Y8EA 4Q9HA 1G8HA 2X8AA 2QAGA 3Q72A 2ZS8A 4FCWA 3T61A 1XCMA 1Z0FA 2J1LA 4LBWA 3MCAA 2CLSA 3B60A 1Z08A 4ZPXA 4TYYA 2O8EB 1F2UB 3G5UA 3B1VA 4QRHA 5AWFC 3RNLA 2OHFA 1AS3A 4LYFA 4OYHA 3FDIA 1SVWA 4HSEA 1UDWA 4W5HA 1RJ9B 3MJHA 5FBVB 1IY2A 1COWD 4UNQA 3THYB 4B44A 1RRCA 1GP2A 3W5IA 2PBRA 1X1RA 3PUVA 4DLVA 4Q4LA 3UMFA 3DPUA 4URZR 5JHHB 1V43A 1Z0JA 5BN3A 3EC1A 4NCIA 3SN6A 4NDZA 1NMXA 1W2HA 2QAGC 4BE7B 3DMNA 4GRAA 2ZANA 4P4SB 1I4TD 3K0FB 5DSZA 2DPXA 3QUSA 3RRNA 2MMCA 4CZ2A 5JRZA 2ZS7A 5KNCA 2FV8A 4IXNA 1S1MA 4CW7A 1U8AA 2PZEA 3FKSA 2BCGY 3BRWD 2VF8A 1W46A 4BFYA 4OL0A 2IF2A 4FIDA 1YZLA 4HDQB 4BFTA 1Q1ZA 1U90A 4LOAA 5JHGB 1TTTA 1VECA 2OO7A 1R2QA 2ZI6A 4LJ5A 3AVWA 1EGAA 2AKYA 721PA 4LYJA 1PLJA 1Q1QA 1AZSC 3KB2A 4P4SA 1TF2A 2J46A 4E07A 1P60A 2IEYA 4PTLA 2XNDD 1AS2A 1Z07A 3LH5A 5B30A 2AXNA 1NIPA 2RGXA 4WXPA 2LKCA 4BPBA 1Z6TA 4ZI3A 3VU9A 2R62A 4LJ7A 2ZE8A 2IYWA 5CM8B 1XZQA 5C4GB 3K70B 1QRAA 4BLPA 4BLTA 4B35A 2CE2X 4RFVA 3IIJA 2ZRAA 1S3SA 3SOPA 1DO2A 1SXJE 3LFUA 1P2TA 2L0XA 3X1XA 4XH9B 1S2MA 1KO4A 2GILA 2Z5FA 2B8WA 1E9DA 2YNMA 1CIPA 1QHIA 1SVKA 1D9ZA 2A5FA 4OK3A 5LBIA 2FDCA 2IHBA 3AV0B 4YXWD 3MFYA 1EX6A 4URYR 5FOXA 1NVVR 2HXYA 4HZUB 3BJIC 4PSKA 4DRZA 2BKEA 4M2LA 3B13B 4GL2A 1G4UR 1G17A 2ODWA 4QJ4A 5G3ZA 4DUGA 2EWWA 4F4IA 1OJLA 4P33A 5TY0A 2A2ZA 2W58A 4XOIA 2G88A 2K5UA 3T1VA 5E7JA 2R6CA 5CDFA 4ABYA 4ZDIA 4ZDJA 4U5XA 4A8JB 1Z6GA 1HH4A 4LK2A 5JWOA 4M9ZA 2DFLA 4IDQA 4RY2A 3NBFA 2C2HA 4BLQA 4TMZA 3P32A 4ZCMA 1KY3A 5FL3A 4LI0A 2EYUA 1D6JA 3K70C 3U4QB 1KO1A 3AF2A 2FJUA 3CRQA 2GEDA 3RHFA 1ZM7A 3FKSD 4WOPA 1FUKA 1SULA 3L0IB 1DAHA 3R7WB 4NPHA 4BFUA 3LWNA 4YMUA 2EFEB 4Q1CA 1E94E 3RANA 1VYUA 1NIJA 3B1YA 3CRRA 3UPUA 1ZAKA 1XJQA 3T5DA 3EARA 4DLTA 5CJPA 4NBSA 5K8TA 4KAXA 5IT5A 1VG8A 1YJ5A 1EFUA 1UPTA 1Z6XA 1TEVA 2CMKA 2ZU6A 2QT1A 3AGQA 4NL4H 2WAXA 4R71A 2NTYC 1E2DA 5FPTA 4UNRA 4FMCF 2WWGA 3KXLA 4G5SA 4DB2A 1Z2AA 3A6PC 3ZLJA 3TLXA 4KFSA 2WM9B 3SI7A 3PJRA 4RD4A 3LW7A 2CLCX 1CULC 4V0NA 3TSWA 1S0UA 2ZJBA 2O0KA 2H8KA 3RRYA 2D62A 4HAVA 1Q22A 2ZSFA 3GLFA 2JLUA 1OLOA 4A8JC 1KYIA 2WKQA 4TYNA 1GL9B 1Z6YA 3GLIE 2OCYC 4MITA 3DM5A 1KK0A 4HLUC 3UK6A 2P65A 4DBLC 1I2DA 4Q18A 1VYTA 4DLZA 5JMTA 1IN5A 4JYCA 1W0KD 1YZKA 4Q48A 2RGNC 1K5GA 3A1VA 5FOUA 5B58C 1W4AA 5E4FA 2ZR9A 5FPYA 621PA 5EZ5A 1SXJD 3CPJB 3QF4B 4M9QA 4NTZA 3IDQA 4V0LA 5DIFA 1KGDA 4BUJA 1YQTA 4TMXA 3ZJYA 2AHOA 1Z63A 3QXCA 3HR8A 1XTSA 3Q7PA 3VX3A 4Q1DA 5B64A 2JJ1D 3W6OA 1KDOA 3BS4A 3KKMA 1PUIA 3W8NA 4O25A 3AVOA 4H1VA 3NEYA 4TQ9A 1OF1A 4D80A 1R8SA 4OHWA 1IM2A 2ODBA 4M0LA 3EZ6A 4FMDF 4R2HA 1GAJA 1LF0A 5AUNB 2G9NA 5AUOB 3VR6A 5TDHA 2P0EA 1C4OA 2GEVA 1E0KA 1JI0A 1T3HA 3QXJA 2X1VA 4XD7A 1N6HA 1YR7A 1DBSA 2CVFA 4KITB 1CJVC 4II7A 2HLDA 1X6VA 1WF3A 1ZC4A 2BVNA 5F9HA 2OSBA 3OZXA 4IOJA 1IXZA 1GOTA 3MG9A 2ZQ5A 1ODFA 3OHMA 2D74A 3T1TA 2X2EA 3GLGE 2NO0A 4LC1A 5HZKA 2OAQ1 1U98A 4BGDA 2FN4A 4CEJB 4O0MA 5F3WB 3QJYA 4IXMA 2J45A 2KJQA 5AUPB 4D0GA 3IHLA 3SJAA 4MH0R 4EFMA 1KO5A 3BH6A 4IVPA 5J4VA 2WV9A 2QTVB 1U8ZA 2C5LA 2FG5A 3NBXX 3QE0A 3TAUA 1G5TA 2KBEA 1WRBA 4M1OA 1TU4A 4MYTA 2IX3A 1US8B 4UNNA 3M0EA 3ZQ6A 3TW4A 3IIMA 2B2NA 4GNKA 1OHHA 1FFHA 4NKRA 3CUEF 4LPKA 2IEZA 1RRPA 1HY3A 3RS5A 2ORWA 3BB4A 1CJKC 2XOKD 4C2TA 4A36A 2BJWA 5HTKA 1EWQA 1E98A 3B7GA 4L9SA 3ZS8A 2D4HA 2F3RA 5JWRA 2GBLA 5LD2C 2GXAA 5FUXA 1DEKA 4N1AA 1HURA 4U7DA 2BBWA 3KUCA 4IEEA 1G64A 4IFEA 5FI0B 4DSNA 1O3YA 4LJ9A 4DXAA 2ORIA 3S1AB 3ZIAA 3HR7A 4V02A 4KFRA 3JVVA 4PPQA 3P4XA 4Q4AA 2NO9A 3BFVA 2IXGA 2ZE5A 4HUQA 2AR7A 4MRPA 4XTRA 4TLEA 3NVAA 2ZITA 3CZQA 3LX5A 3F8TA 4C0HA 4B3GA 4BLSA 1F5NA 2P6NA 3CKLA 4MA4A 3BXZA 1L4YA 4IDHA 4UJ5A 2RGGA 4JVLA 2GBLC 2W6ID 2REXB 5JS7A 1FQKA 2OXRA 1S1CA 3I4LA 1DPFA 3FPAA 2VP5A 3OEHD 3B1XA 1VCMA 2XB4A 5J4KA 2IYRA 1Z28A 4OI4A 2VQSA 1GNRA 2J7PD 2BJVA 1W0JA 4UKDA 1GL7A 4G1UC 3S1AA 1NBME 4XD7D 3T06B 4PC7A 2VF7A 5A0FA 2JASA 1I4DD 3LLMA 2VP0A 4LZZA 1QDEA 1KTVA 4G3XA 4M1YA 1KKLA 4LBVA 3H0KA 5BWMA 5EUMA 3R9IA 1H8ED 2H57A 1E99A 2FA9A 1OIVA 4V0MA 1NL3A 1EX7A 1FNMA 2RH5A 2YC4C 2OE2A 1CEEA 3VR1A 2GCNA 3A4MA 4Z8XA 2C8VA 3I1FA 4KJZA 3DOEA 4TSFA 4URUR 4I1VA 2ZI5A 5SZHB 1DTSA 2GRJA 3TIFA 1Z29A 4M9SA 1XEXB 4Q9IA 1LS1A 2VPPA 1E4YA 5DN6D 2IYTA 4RZ2A 1E0AA 4MRVA 5BXQC 1L4UA 4JLBA 4UXHA 4W7SA 4AD8A 4CRWB 4Q7MB 5SZJA 2ONJA 3TUIC 1GVNB 1U0HC 1W5SA 2ZEJA 2VYFA 1G8YA 4JJKA 2WICA 1G3IA 1OH6A 1KNXA 3DZDA 3OF5A 4TMTA 5C1BA 4PAQA 3GLHB 1H65A 3RSLA 1A2BA 3WP0A 2GJ8A 2BCJQ 1G8GA 2OFXA 1E2GA 5EJEA 2YWEA 2FSGA 2Q3HA 3PV0A 2JDID 2ZETA 4HLDA 1JXOA 5CYPA 1R8QA 2V1UA 3BB1A 1GFIA 3RS4A 4DT1A 3BK7A 2P3SA 3R8FA 4A0HA 5CITA 4TWZA 3MD0A 1EFRD 3KQKA 4O2RA 2BBOA 3DOFA 2ZRMA 2VEDA 2IL1A 1P73A 2F3TA 2WSMA 1M8PA 1II9A 3K0CC 4B2IA 4DHEA 3T1QA 1NMYA 2BBSA 2ODNA 2QSYA 4NYMR 4TZ0A 2V7QA 4M1SA 1XMSA 4GFDA 2G77B 2Q21A 3M4YA 2HXSA 4TLCA 2OEPA 1P3JA 4US0R 1R10A 4NU0A 1KSGA 3EXAA 2R8RA 3C41J 4Q66C 4ZIRB 4S2EA 2ZYUX 3TJZA 1XTIA 2EQBA 4XWAA 3WNBA 1KKMA 4MUAA 2AK2A 1S9DA 3PVSA 1CR2A 1IQPA 1KMHA 2HF8A 2GA8A 3UG7A 2O8CB 2WWIA 2O5VA 1D5CA 3NH9A 1JEDA 2PMKA 5JCZA 1FNNA 1R0YA 3D6TB 3LNCA 2JATA 1NBMD 4G0NA 3AH8A 4I81A 3GCGA 2QNRA 3SJZA 3BC1A 3P20A 3Q5EA 3ZVMA 3LBHA 4I1SA 5L3QA 3EZFA 2VHJA 3H2YA 1RW4A 2FFBA 4D2IA 4PO1A 2OILA 3BIFA 1FP6A 4C0AC 1CR1A 1UKYA 2O8DA 2GXQA 1YVDA 4LJAA 4XVUA 2XNSA 1UAAA 3B2EA 1G21E 4MYCA 3BBPA 5JBQA 4OHZA 2V9PA 1LW7A 2QPAA 4TYWA 1DARA 2WJJA 2IXFA 3RSOA 3EIEA 1XCGB 4UXIA 4PAOA 3R9XA 5JJLA 2JIZD 1Q3HA 4DDUA 1TQDA 2DY1A 1RRGA 3QI2A 1Z6AA 3WYGA 2UKDA 2KSQA 4BFWA 3CNOA 1N0UA 3QOFA 3ZD7A 1W36B 1XPOA 3OAAA 2ZJYA 1N6NA 4ASUA 4IW3B 5HE8A 5BW8A 1NG9A 2PMDA 2R2AA 2ZVQX 1HQYE 2YWGA 3BFXA 4WA7A 3OE7A 2IYVA 1M7BA 3TSOA 2AXPA 3RRZA 3RS2A 3Q85A 2QQEA 3A4LA 1VG1A 3QNUA 4QJ3A 3TRFA 5AK0A 3X1YA 4DEYA 1E96A 4FI3C 4DLWA 1EG7A 3T34A 1GRNA 221PA 1E2QA 2CBZA 2DFNA 4EQ6B 1BKDR 1IBRA 2XZLA 3Q3JB 2GCPA 1JPNA 2JJ8A 3FKQA 2BM0A 2GF0A 4Z8YA 3PITA 2R9VA 4JZKA 2C78A 3EPKA 1T9HA 3I5YA 4YC7A 4LPSA 1DELA 1Z8FA 4I1OA 1E2IA 1FPMA 2DHRA 3EIHA 3ICQB 3DZ8A 3VMAA 3L43A 1RE0A 2QUZA 3W6PA 2GZAA 1ZM2A 4DJTA 3NH6A 1Q3TA 1S3GA 4BFXA 1LFDB 4GOKA 2FMXA 1AKYA 2QE7D 1Q20A 4Z54A 4QNRA 4MRSA 2J7KA 3RVBA 5JSZB 3ADBA 1WXQA 2PCLA 1U8YA 2ANBA 2PEZA 1W36C 2WZQA 1ZNWA 3UKDA 1ZMXA 4UXJA 3SS8A 3EPLA 3B78A 2WHXA 2NO6A 1E79D 2F9MA 5KU1A 1E9CA 2ZE6A 5E7IA 1UADA 5KPDA 1DE0A 2J87A 3CONA 2ECKA 1XXHE 4NZYA 1LTQA 5CM9C 4D26A 5TVKA 2W83A 1NVXQ 2VA8A 5G3YA 5IDVA 1UF9A 5FPKA 4PX9A 1BYIA 1E4VA 5LB2A 5ANRB 3U3KA 3RC3A 1SVLA 1JBKA 2WSSA 4GOXA 3F5FA 4NMMA 4UQOA 5JSZA 2R6FA 1NVVQ 4Q4HA 2XGJA 1P62B 1JAHA 3SFZA 3IO3A 1JB1A 1OKKA 2GF9A 3FHOA 1ESNA 4DSTA 3AVUA 2NZ8A 2NG1A 5JEEA 2RAPA 3EPJA 3U7FB 4C7OA 1GWNA 3K0SA 3IKJA 2ONKA 3N70A 4GSYA 5SZIA 2W0MA 2RGBA 2JLWA 5EE5B 3HP1A 1XMIA 3SBEA 3X2SA 4FWTA 2QZ4A 3GEIA 2Q0HA 5EE9A 5KPJA 3M1IA 2CCJA 2XJ9A 1Z0DA 3I92A 2CDNA 1AN0A 5IK2D 3MSXA 1IJEA 4QBHA 3UIEA 5DI9A 4BZXA 3PIRA 2QEQA 2IWHA 1KY2A 1Q0UA 3AB3A 3KL4A 2ZRLA 1OXSC 1SKYE 2HYDA 3CZPA 4QOSA 4QM6A 4KHZA 3GD7A 2HDNB 1LF5A 1P61B 1TMKA 4CDGA 4KVGA 1QG2A 2D2EA 3AKCA 4DZZA 4QNMA 1P75A 2WPDA 5GADl 1YR9A 3NKVA 4L8GA 4ON9A 5K8IA 4LX0A 1SVOA 1ZC3A 2WJHA 4Q1EA 2RB4A 1V5WA 1G3QA 2GTPA 4B33A 2QRZA 5HKKA 4M1TA 5EXSA 3B6EA 2XSZD 1KSFX 4AG6A 4HEJA 4GMDA 1PVOA 1XTKA 4J0QA 2ZRIA 3BERA 3KQLA 1OFHA 1ZCBA 1MT0A 3OFNA 5C18A 1BIFA 2IF0A 1QHGA 4HB4A 4A0FA 1CJMA 2YJTD 4TL8A 3RWMB 4QG7A 4TL6A 5FTKA 2O8BA 1AA9A 3GJ7A 4EPTA 1CBUA 1Q1EA 3Q7QA 3VR4A 4D0LB 4LHXA 4DEXA 1BMFD 1T6NA 1Z06A 2EVWX 3OIUA 3TKLA 4NYJR 4KBGA 5FBRB 2A78A 1AK2A 1KK2A 1GRQA 2GNOA 3C4JA 2VP4A 3U3RA 2YOFA 2D7CA 2H17A 3TVTA 4LDJA 5IF9A 2FOLA 3I8XA 4MYHA 4Z1MA 2ZREA 4EUNA 5J4YA 1ZRHA 2QMOA 4JSYA 1OH8A 4YMVA 4JLKA 1OKKD 1QHHA 3NWJA 1II0A 3PXGA 2WAYA 1N0WA 4PHGA 2GJSA 3QPVA 4KSBA 1UKVY 3SDZA 1EFHA 3T15A 1S4QA 1I4LD 4KFUA 3NDBB 2ZXUA 4IVRA 4K46A 1Z83A 1F2UA 4B6FA 4CT4B 2GWHA 2O8EA 3ASYA 2GHIA 1WBBA 4TMWA 3THXB 2ERXA 1RJ9A 1XTQA 2XJ4A 4RD2A 4G5RA 4F7WA 4Q7JB 5C4MA 2IS4A 3THYA 2O8FB 4DSOA 4PSAA 2I1VB 3NC0C 2XZPA 2JJ2A 4B3FX 2FF7A 3LLUA 1OIXA 1H8HA 4F92B 3CNNA 3N5CA 5TV2A 1X3SA 4D6PA 3SQXA 1XCPA 4US1R 1K5DA 3K0FA 4V0OA 1K8RA 2XAUA 2B7CA 4TLBA 2J0QA 3MMPA 2VRWA 5DLQC 521PA 4RFSB 2RCNA 4B3DA 4QHTA 5KDLA 2XX3A 2R6DA 4OI2A 4I99A 1DADA 3THXA 3P27A 2HJGA 3B1WA 2W00A 3T5GA 1G7RA 2ZIAA 1JR3A 2O8FA 4OQFA 2BBTA 2PJZA 2ZSDA 2A30A 5HCNA 1NSTA 4TL9A 2OFWA 1KK3A 1HV8A 2P5TB 1P9RA 5JFGA 1ZNXA 1IOZA 3QF7A 4QHYA 1DAGA 2CHVA 4PHFA 1C9KA 4Q9JA 3D8BA 2WBLC 3ZD6A 2V6JA 5J4LA 3DKPA 4RFSA 5HR5A 4JLOA 3A1TA 3KFXA 3BGWA 3ND9A 1E3MA 4OJKA 2VSXA 3PR1A 1O87A 4WIAA 4YLGA 4V0KA 2YHSA 2CL7X 4NP6A 1F3OA 3A4NA 4JMPA 3AVPA 4TTPA 4FD2A 1N5LA 1U94A 5KDDA 2JA1A 4X8MA 3ECCA 3WXMA 5CDFE 1X1SA 2CNWA 4TYPA 4JT2A 2Z0MA 4A9AA 2FE4A 3VKHA 4PHHA 3GP8A 2JLZA 3G82C 3B9PA 3D31A 3HJNA 1OYYA 4OKSA 3CF0A 2ZRPA 4MDFA 2C77A 3OEEA 3NBYC 4Z1MD 4ZKDA 3AVTA 3CR8A 1IN4A 3I73A 1E2MA 1ZNYA 4LJ4A 4WW0A 4M1KA 4D4KA 1KO8A 1AKEA 4M4SA 3CX7A 2QTFA 1Z22A 3V4FA 4KLZA 1JALA 1GNPA 4BEBA 1XJ0A 3C5CA 4HZUA 3Q9LA 1A7JA 5JLJA 1XU4A 2ZRKA 2GDJA 3N2IA 5KSYA 1LNZA 2FSIA 2J3EA 5KUTA 5FBQB 5IRCD 3RS0A 3HYTA 3REGA 5FPHA 3WMEA 3IEUA 2IWRA 2BDTA 3TE6A 4ZO4A 1ANKA 1FUUA 1G4AE 2RHDA 3K09C 4LBZA 4EJSB 4WXRA 4A8JA 4UNPA 1OXVA 2DFKB 1Z0AA 3TUZC 4AKHA 3NC1C 4HLUA 2WJIA 3JZAA 3OIVA 4BEJA 2IUSA 3U4QA 4DCSA 2RGNA 1AQUA 3NBZC 4RD6A 3GLFE 1KI4A 1R5BA 3K53A 1C1YA 2OLJA 3R7WA 4TYQA 2C95A 4OI1A 3W3ZB 3U2QA 4AKEA 2KBFA 4TL7A 1JR3D 1W4RA 5FUYA 1AQYA 3KQNA 2QP9X 1L2TA 4HDCA 2OBLA 2JLQA 1YRAA 4AWXA 5FL7A 2R65A 3BAFA 4WAUA 3L8YA 1KI6B 3AVVA 5LPNA 1XNJA 2H18A 3UG6A 4NH0A 2N46A 2QSZA 3LX8A 4DFCA 4HZIA 2O52A 4IHQA 4KODA 4KYIB 5TARA 2G6BA 2BC9A 4BFSA 3WMGA 3GLIB 2F43B 2V54A 3MLEA 4F93B 4DDVA 2CHGA 2VTKA 3EZ2A 3H4MA 3BH7A 2BIFA 3IQXA 4Q7KA 3BB3A 4B71A 4K8OA 3K70D 1MO4A 4B2PA 1CRQA 4NCJA 4EJSC 3Q8XB 2RGAA 1KI1A 2B8TA 1ZCAA 4DUGD 3ZVLA 1E9SA 2KI5A 2V6IA 1OXXK 2A5GA 4F4JA 2QPTA 1M6NA 2F1HA 4LGMA 4A0RA 4PPGA 1M2OB 3THOA 3SFVA 3CNLA 3UANA 4A92A 2YWHA 2J0UB 4WZBE 3P26A 1N6KA 1NJGA 2F6RA 5LB4A 4NYMQ 2F43A 3QF4A 3T35A 3NG1A 1N5IA 3CF6R 5G40A 3VMFA 5IHPA 4RD3A 5BN5A 1NLZA 4AYXA 1KDPA 1VHLA 4UNSA 5HCIA 3MWYW 4BRUA 2VHUA 4TMVA 1HE1C 4P4TA 1MO5A 2QM7A 1DO0A 2LWIA 5UKDA 2C9OA 3AF4A 3CBQA 4G5QA 3T12A 5C46F 2VP6A 3I8SA 4B32A 4CT5A 1E2JA 3R8CA 3R9WA 4F38A 4TT3A 2CK3A 2D2FA 4PXAA 4ARZB 4Q1AA 2D06A 1XZPA 4JLMA 3U6BA 4ACBA 3PUZA 4GT1A 2EYQA 4QBFA 2IK8A 3UWKA 3GLGB 3FB4A 4GBMA 4DLSA 4PC1A 5KNDA 1JQLB 4JIMA 3FTQA 3EX7C 1HE8B 2Q9BA 2W2TA 5FBLB 1GIAA 2VLIA 3FFAA 3QY0A 4A15A 2XTZA 3H1TA 1NNEA 2Z83A 3SYKA 2JLVA 4FW9A 3TK1A 4ZV4A 2PZGA 1XMJA 3LV8A 2V8OA 3MJRA 1LS6A 3LVRE 1Q21A 2MSDB 3QXHA 4CEJA 1IJFA 2B7BA 1Q44A 1RRFA 2ZRJA 5J47A 5FL7D 1SKQA 1N5JA 2IW3A 4X8LA 3A1WA 1YZTA 3R20A 3FYHA 3GEHA 2VSOA 5JS8A 4DC9A 3VAAA 1D2EA 2HCJB 4LSGA 1NJFA 5F9FA 4EAQA 3MAAC 1EWRA 5ELXA 2IYSA 4KLNA 1US8A 2IYZA 4Q9KA 4JLNA 1EFTA 4JBWA 2X19A 5EUQB 3RWOA 2XB2A 1II8B 4Q5IA 3SZRA 3AKDA 3U3MA 1P9WA 3K9NA 3L2OB 1UJ2A 4JJZA 1U0LA 1LY1A 1UM8A 4LJ6A 2VL7A 3THWB 3LDAA 4HAXA 3RDPA 4TQAA 4HATA 3AUXA 3BFKA 3VFDA 4MKIA 4YMTA 121PA 3TMKA 2IS2A 1P9NA 1QVRA 3L0OA 3W6NA 4HAYA 5JECA 3NHBA 1G5RA 1CR4A 3PQCA 3TW8B 4OI0A 1E1RA 3O8CA 1IN8A 4Q03A 5G41A 2ZRFA 4UJ3A 3LXXA 2JGNA 2JLRA 4PANA 1DG3A 2GVZC 4V0ME 4TMKA 1IY0A 2QM8A 1G41A 2A3RA 2B21A 4OK5A 5KHOC 2YYZA 2HLDD 1BO6A 1QHYA 4RZ3A 5K8UA 2LCFA 2PX3A 2CEAA 1OT3A 3SE0A 3A1UA 5CLLA 4W5WA 4NYIR 1VHTA 4ZCLA 2DWQA 2DWOA 4RZXA 1DAKA 1FTNA 2G83A 3FHTA 1DG1G 3QBTA 2F1JA 3KZ1E 4Y0VA 5AJXA 2UZ3A 2WWXA 3FMIA 3O47A 4IOMA 4JLVA 3JVUA 3W90A 2ORVA 3NTUA 1W2GA 5JCPA 5H1YA 3GJ6A 5DISB 4C3ZA 3UMRA 2H7VA 1LB1B 4JVNA 4XWOA 3K0AB 4QHSA 5L8VA 1OB5A 2C9YA 4A4DA 1AGRA 2ZRCA 3U44B 4CVNA 2OCBA 2HV8A 4IDPA 3SJCA 2C04A 1OHHD 1R6BX 4CIDA 4MGYR 3K0CA 4D4MA 1VYVA 2PH1A 1JXMA 1MO6A 1OSNA 1PLKA 1XEXA 1R5OA 5CYOA 4KYUA 1JPJA 4IRUB 3QKUA 3FPNB 2C98A 1WP9A 2H92A 3KQHA 2CXXA 2OXCA 4URXR 2QPOA 1SHZA 2GETA 1N5KA 3D7MA 1A5TA 5FI1B 1RC8A 2H5EA 2A5DA 4LC0A 1LVGA 5HPYB 2HT6A 4RCYA 1KJYA 2PX0A 4Q1BA 3ZIAD 1GKIA 5FFMA 4B74A 2XZOA 3EW9A 1G3MA 1ZD9A 3GLHA 2G3YA 5P21A 1DAEA 3MGCA 4LHYA 5AJZA 2QI9C 4ZI2A 3HPQA 4A0GA 3AP3A 1JJVA 4PPFA 3TNFA 1AIPA 2W6JA 1TUIA 2FSFA 4HYYA 4GDFA 1X8LA 1G6OA 3TH5A 4OK6A 2BKUA 4LUCA 3DMDA 1SZPA 5EXTA 4PC2A 5AUQA 4URVR 1P6XA 1JEEA 1TADA 1R5NA 3NHAA 3WYAA 4W9MC 4RJLA 4URWR 2WWWA 3LY5A 1M7GA 2HUPA 5FTMA 1E0JA 1W0JD 4Q4JB 2BM1A 2GJKA 2DBYA 2OZEA 1EESA 4ESHA 4LYAA 4ESVA 1YR8A 3GJXC 5FTJA 5DYGA 3GEEA 1SGWA 1Q57A 3CX6A 2V3CC 5FOSA 2J5XA 1W4CA 4E03A 4JS0A 1QHSA 4ZDKA 4DCUA 1QHXA 2FPLA 4LY6A 3IILA 1ZIOA 1WCV1 1AGPA 2MSCB 5F2EA 3REFA 4JSTA 4MGIR 1ZVQA 5G53C 1T5IA 4Z51A 2F7SA 4Q02A 2BWJA 3QSYA 1MRSA 2PT5A 2Q6TA 1T0JB 4TSFD 5H70A 2HCBA 2NGRA 2OT3B 2QU8A 3GMTA 3P4YA 3WHKA 1PUJA 4ZIRA 1XEWX 1QZXA 5FR2A 4Q4JA 1HTWA 3CX8A 4GPTA 2FWRA 2ZJOA 2QP3A 2O8CA 2QL6A 3FGNA 2EFDB 3EA0A 5FUWA 4NYJQ 3KKOA 1OW3B 2VSFA 1YZUA 4FXPA 2BMJA 1YHNA 1VIYA 1T5LA 1RPZA 1GG2A 1JAIA 3CWQA 4G5OA 2IUTA 5L3SB 2R6GA 3U6KA 3ZVRA 3PUYA 2QRNA 1E1QA 3QENA 2G1KA 4M1WA 4PC3A 4BRWA 4JLDA 4JVMA 1QG4A 4QM7A 2OM2A 1OXTA 2QORA 4GMXA 4H9GA 4XIGS 1GTVA 2QN6A 4DSUA 5AR1A 4PZYA 1XTJA 3MWLA 3PEUA 4M9XA 4POAA 1XD2B 3DKVA 3HWSA 1KI3A 1NN3A 2ZU0C 3K0EA 4HLCA 1WQ1R 5FUVA 2FX3A 4C4PA 2ZUBA 2Q9CA 5JJIA 3GQBA 1TNDA 1N3BA 2GCOB 2J41A 1XD8A 1G20E 4B3XA 2V7QD 1E9AA 4LV8B 5DI3B 1TAGA 4NHOA 2YOGA 3EZ9A 1R0WA 3DEFA 2JEOA 3RAPR 3AGPA 3OIWA 3TR0A 3VKGA 1SHKA 1N6PA 2CVHA 1XD2A 3B9QA 2Q9AA 2PT7A 4H1UA 4NCHA 1IONA 4EQ6A 1XB2A 4L15A 1SQ5A 4YMSA 5D3MB 5C2JB 3CR7A 4A1FA 1B23P 1DAFA 2VHQA 1PLLA 5L3VA 2ZUCA 3LD9A 4OHYA 4FCTA 3KFVA 3DDCA 3NEJA 3ZDQA 4E5UA 1ESMA 5KDOA 2QAJA 3IEVA 2F55A 2VP9A 4PZLA 3LBNA 4MKFA 1QHNA 4ZKEA 3TBKA 1U9IC 1SVMA 1UBCA 1XXHB 2TMKA 3DHWC 2ZSBA 4Q00A 3EZ7A 4JL8A 4B3CA 2BHRA 2PZFA 1CU1A 4HLQB 4JLPA 5FOWA 2RHMA 1FOEB 3EIQA 5EE3A 4QGAA 1ZD1A 4GP7A 2ZJ2A 1TF7A 1W1WA 3VR3A 3ADKA 3VR5A 1CTQA 4AC9A 2ZPTX 4XVQA 3RS3A 3AVQA 5EXPA 3SEAA 4C9BA 3FMOB 1G7SA 3SYLA 3O8BA 3T1OA 2KWIA 3I72A 3TQCA 1NLYA 2G1JA 3OIYA 3OAAD 4ASUD 3LVQE 5B57C 3CH4B 3QVVA 1COWA 5GJBA 2XTMA 1XEFA 4DLRA 4QBIA 1RZ3A 3OE7D 2AL7A 1HT1E 3AP2A 4DCVA 3KKPA 1YE8A 2WKRA 2ANCA 3QBVA 4EFNA 3LQRA 4LWZA 2VIIA 4TTQA 2CJWB 1U2RA 3RLFA 3F0TA 2AWNA 1CKEA 1VCOA 3AF1A 3U3OA 5GJCA 1R0ZA 4S35A 2FPKA 3GFTA 1W36D 5GVRA 4MDEA 4MKGA 2QMHA
chains in the Genus database with same CATH superfamily
1Y6ZA 3EDOA 3H6HA 5HQ3B 1Z35A 1DDIA 3ZDCA 2N42A 4GICA 3C7KA 2OCPA 2JFWA 2VT7A 2Y93A 1OFUX 3DAHA 1NRJB 4C14A 5ESDA 4II2A 4GR9A 4QVGA 2ESRA 3RROA 1M6HA 3NBUA 5BVHB 2Z5LA 2F9FA 1B42A 3PENA 4WBXC 4FFLA 5IAKA 1GPBA 1V8FA 5K8LA 2QTWB 1NYRA 1TUEA 1ISSA 4DV6B 5FNZA 2XNDA 3HN2A 1CUYA 2NO1A 5I01A 1X7XA 3MS7A 3DO6A 4X91A 5JVDA 2MDTA 3ACCA 3GCWA 4ISCA 4I55A 2OCAA 1K8QA 3WGIA 3RU3A 3X1ZA 1J8MF 1U2ZA 1Y1SA 2BOVA 2P9JA 3LQQA 4WINA 3ASZA 4F91B 3LQ1A 2H9AA 3CR3C 4W1QA 2ZBFA 4LFBB 1XNQB 1G66A 3PUWA 4L85A 1H1DA 2ZTMA 1E69A 1AU9A 3TRIA 5KOJA 1RTTA 1UBHS 3BHJA 1EEXB 1JHMA 4LJSA 3TLEA 3ZK9A 1BDIA 2GKSA 1RBMA 5BVHA 1SY7A 4OHUA 3S1LA 2WNHA 4S1TA 2VHWA 3KXIA 4EELA 1M2KA 1B14A 2H6EA 4V0QA 2ZOSA 3IKLA 2BEKA 3PQ4A 1KC3A 1JHZA 2EQAA 3AF0A 4FOLA 1DBPA 4RLHA 3IHTA 2BKLA 2OFOA 5HF8A 3VR5H 3ZNPA 3ZLUA 4Z6KA 5ED0A 2QJRA 3ISJA 4TWAA 1R50A 3S6JA 4NC9A 4OQYA 1RQRA 4QL3A 4PYRA 1ZGCA 2ZIUB 3PEFA 2XGMA 4BYMA 1ZUHA 1R3DA 5A7FA 3M3PA 4M22A 2B61A 5KYTA 1A76A 2HBZA 4FEEA 1OPXA 3WLTA 5E2IA 3GVHA 3JWHA 5CLQA 2B92A 5DYYA 3TR6A 3SZMA 3U1VA 2FH5B 3P45A 4AXBA 4U8GA 1T5DX 1DJQA 2NZVG 3V8NA 5IBCA 4XZ3A 1M6WA 2B3DA 4HNHA 4DLAA 4Y2SA 4N3CA 4QTUB 1P77A 1XDDA 1KH1A 2FZ4A 2FUKA 2YV5A 4HQNA 3OZRA 3ULKA 3PICA 1QYIA 3E4DA 1PNVA 1B8PA 2W2LA 1J90A 3U4HA 2ZTLA 4DMCA 4P0QB 1PFUA 4RSGA 3SF8B 3ZBQA 3T8YA 2PE5A 4YUYA 2DBVO 4PPNA 2GAOA 3LUGA 1FZTA 1ZP6A 2CHQA 4G9EA 5IDXA 4OHXA 1K4MA 1PZGA 1JR3E 3M1LA 5IKXA 2BI4A 2PMFA 3N86A 4JITA 3B8EA 4RPIA 3NVKI 4TLMB 3M49A 5EXEA 3TZCA 2H4XA 4PQYA 2WJ4A 1D9XA 2AI2A 2GZRA 1QTIA 3E27A 4EG3A 4NU5A 2A1UA 3MXOA 1V26A 2GN4A 5BMVA 2Z57A 1FCJA 1M74A 4PR0A 4C20A 4XVRA 2CHUA 2E5LB 1C7IA 1NR1A 3H9EO 2H8GA 1YRBA 4KPEC 2CHEA 1W1IA 4C78A 4K88A 1JHQA 1BHO1 2XITA 1P18A 1JDSA 4WKCA 1Y1KE 2P91A 3FKJA 3MD9A 3UFBA 4FONA 4C0LA 2HF9A 1E3IA 2Q4BA 2VNJA 5AK4A 2W71A 4U00A 5F7ZA 3VR4H 1SXJB 4A16A 3QEAZ 3PXCX 3WXBA 1YK0A 4FFPA 2C8JA 2AZ4A 3PGLA 3FI0A 4HGNA 4ACAA 4BJ1A 2IKQA 4JXZA 1A5ZA 4G07A 1JHRA 3QNMA 2C7RA 3AINA 2V3VA 5A06A 2WU8A 2B20A 3SHQA 2C7OA 3S7ZA 4N0DA 1Z5ZA 3HL0A 1N4DA 1OXBB 2AOTB 2GZ1A 3S28A 2I34A 2X2OA 4X3CA 2OB1A 3OUZA 1UBEA 1CR0A 1WCWA 4LFCB 2E4XA 1CT9A 2EG9A 1YI1A 4JYAB 2NU9A 2WMNB 3LQ2A 1TEHA 4V39A 3WY9A 4BFVA 4JI3B 4U63A 4EHKA 3AI3A 2AWOA 4N0EA 1KVQA 3JQFA 1W0KA 4M8NE 3KTAB 2DLDA 3OESA 4M7RA 3R7DA 2QD1A 1SXJA 5HBGA 1GN8A 5HA5A 4IDNA 1GTL1 2ATXA 3CQ9A 3V00A 1RU3A 3NTOA 4J1NA 4OV6B 4WDRA 2W98A 4IIXA 4TLAA 2VNKA 4EFKA 5B3JC 4O4LF 4YMWA 1QH8B 3QVGB 3OFVA 1T2UA 5FOTA 4EVSA 3ODPA 3PU6A 1G0OA 2AOTA 4GI3A 3MUOA 2B69A 1SU4A 2GXUA 4S2UA 3DQQA 1ORWA 3JZMA 4RO0A 4NOLA 1V3UA 1IEWA 3R5JA 4IWYA 1R0CA 3NOVA 1IQRA 4QJ5A 4V2UA 1I0IA 3M5WA 1K7FB 5H0IA 1SBZA 2C96A 2O1WA 2REQA 3VRHA 3E7PA 2HT1A 1NP6A 3MWJA 3KTAA 5IKMA 4F21A 2C9BA 3VSBA 5K09A 1LQTA 2Z9CA 1A9XB 2LW7A 2NOAA 2O6LA 1XD9A 4PO8A 2PR7A 2FQ1A 5EIWA 4J4BA 2I91A 3NOXA 1H8HD 1U8EA 3PFGA 4FR5A 3WAKA 4BNUA 1UANA 2B0JA 1YRWA 1BE8A 4U2FA 1XCJA 1Z4OA 1WLYA 3EWAA 4LF4B 4N40A 1UIRA 4HY3A 4M21A 1NXQA 4HUTA 4WLEA 1LLDA 3I2GA 2QGNA 1X1EA 3L40A 2GEJA 4C7XA 4D8VA 3OZWA 1Z5PA 2B83A 4N03A 3TKAA 3MA0A 4ZGWA 1X8JA 2YCLA 3JYLA 2WTBA 3GJ5A 3GLFB 4MWDA 3LUKA 2A9VA 3BK1A 4B76A 1A9XA 2MTBA 4GM0A 2HWKA 3Q40A 4C0JA 3CPSA 3WNCA 2G5TA 4UUQA 3L07A 3S99A 3COZA 4AKIA 5KKNB 1IIRA 1O4VA 1DS6A 4Q7EA 1VLVA 2G9QA 2DVMA 3G9QA 3AW8A 5INTA 2QE6A 3MFQA 3F73A 1R0XA 2WSLA 4MW7A 2MYTA 4XARA 4OB7A 3WRXC 4PRKA 2VYNA 5L6MB 2WOJA 5HVNA 2E48A 1SVIA 1ZESA 3BEOA 3ID6C 5FBZA 8LDHA 4QC2A 1DJMA 4NENB 3GRUA 1IXSB 2AC4A 3RC8A 3B36A 4HADA 1GPH1 4A82A 3A6HA 4G5GA 4I50A 4BL5A 4U2DA 4HYTA 4DLYA 2WMOB 2CSUA 2BEWA 1E66A 3TXXA 3CHYA 5JJKA 4K40A 2KB0A 4BRSA 1KI6A 3OQBA 2GJAA 1N33B 1H2ZA 2E85A 5E3HA 1A4XA 1TQ2A 4JXKA 2PRZA 1I9GA 3WGKA 4F4CA 4KO8A 1KU0A 1QIJA 5ELLA 3GLIA 3G85A 2ZM6B 2GI4A 4X90A 2QUHA 3LCJA 5JAIA 2IXEA 3SQOA 3KJXA 3D8RA 3WJ7A 5CGZA 3H7AA 4LTDA 3G7NA 4IIJA 4J7XA 3U9SA 1VKJA 3ZVKA 3NEAA 2CLDX 4NENA 4H35A 4UCFA 1FSZA 1EUDA 3OZSA 4JJGA 2FZLA 3JYPA 3OJFA 5BYJA 3EC2A 1E3JA 2ZXFA 1L5ZA 4CMIA 4QJIA 5DP2A 1VE3A 2BZGA 2O07A 5DE3A 1QH1B 2WSYB 2WA2A 3NTRA 4DIDA 5B55A 3LGXA 4QOJA 1M2NA 1AQLA 5GJWC 1XZ8A 1TIKA 3CB2A 2AI1A 1SZCA 2FR1A 3MOIA 2PVPA 5JPDA 2AOUB 3PFIA 1V95A 4OSOA 3I62A 1ZL2A 3IUMA 2LKDA 1V4NA 2XRZA 1NVUQ 4KKVA 6LDHA 1DO8A 4ARIA 2AX4A 1HC7A 2PPVA 1H2YA 1BDJA 1J9EA 2AR9A 2ID7A 1NYQA 4YT2A 4K0KB 1QMPA 3DOUA 1BFDA 1E61A 5DB4A 1W88B 2PL9A 1WV0A 2XIJA 4GYYA 2UUCB 2VHCA 1CJCA 2EBFX 4UZFA 1O95D 1PKXA 2ZRDA 2WF7A 2WLSA 3C45A 1OUMA 4DUPA 1WE2A 1YR1A 1NKTA 4C0KA 3JQ7B 4U6QA 3OE1A 2I55A 3CEHA 4JVOA 4EJFA 3TECE 4HWSA 2I3BA 5AXDA 1MVOA 1QYRA 1FFYA 3G68A 1S7GA 3PS9A 1QBKC 4FEGA 4PAMA 3KWLA 3L82B 3OMXA 3GLGA 4HAOA 2CLLB 1O96B 3UENA 2ZR0A 2C1EA 5CFQA 2B1RA 2J9GA 3A2NA 2KMLA 4QXPA 2XUGA 4K3VA 1KYZA 1YKSA 3C6XA 1SK9A 1QGOA 4QQFA 1FFXB 1DI0A 1W76A 1O0BA 3EA4A 4MHSA 4P4NA 3S70A 4BRZA 3PF8A 4MRNA 3I5XA 4OFZA 2UYYA 4FMBB 3SY8A 3RNOA 4P2GA 2EU8A 4MGZR 1L5QA 4F04A 2CY0A 4OQNA 3DDSA 2ENUA 4OXXA 2BV3A 4O4JB 3KKNA 2YRXA 2O19A 4QDJA 5IAEA 4DQUA 1UOPA 2Y2VA 1JP7A 3SOZA 3CN7A 2W48A 3GJRA 1WBDA 4JNKA 1TT5B 3WLNA 3CV3A 3UJ7A 2B9EA 4NNPA 1ZUIA 4I2VA 1JAZA 1L7AA 3EJWA 1FFXA 1G2IA 4HAUA 1OCEA 1KR2A 2C20A 2Q3EA 3U09A 4I2NA 1CUGA 4M1EA 1Y8CA 3GH1A 3CVYA 1BQEA 2ZROA 2PVCA 2JA2A 4ZMRA 1WB9A 3N8NA 3O3NB 1T5TA 3FTFA 3DZFA 1K7XB 4CGZA 3N5KA 4ENWA 5KSZA 2OHXA 3HRKA 3H04A 3IQWA 3DL2A 4LV6A 2X0EA 3THWA 3ANMA 3RH0A 2REBA 4TWJA 1HA3A 4MQFB 4TVKA 2CB0A 2H7CA 2R7LA 3A6FA 3FWNA 4Q3KA 4QFDA 7MDHA 1NQOA 1KMIY 4IJMA 4NZZA 5EWMB 3F8WA 3RHZA 2H5JA 1RWXA 1W5TA 3VSAA 5ES4B 1NT2A 3HXLA 1YGYA 2HSEA 1IY8A 2P5SA 3D2AA 2O57A 1M6YA 2DBQA 1MX1A 1L8QA 2RC6A 2V55B 3GJ8A 3LCVB 3ZCXA 5KNDH 1ND5A 3VUEA 3D3JA 4ZU3A 5CIQA 4LJYA 3TQFA 3QFCA 2EKQA 4HNUA 4IO0A 4GNRA 4P0TA 2VBFA 1SCBA 4XJSA 5AJWA 3L1KA 4IVQA 3ADCA 3OKCA 4AF8A 4KFTA 1UFQA 3G2MA 2GZDA 2DAPA 3CPHA 3UYLA 1A9TA 3KEQA 4JB2A 1KI2A 3WL7A 4MQFA 1GADO 2JGFA 4XDHA 4NZ9A 4AW9A 1OV4A 3EXHB 4YJKA 1SIWA 2GAJA 1H0KA 4HI0E 3LKBA 1FPQA 4HXFB 4B82A 4G37A 1RWOA 1VL0A 1XEWY 2PQ2A 4I5EA 4JBNA 2Q99A 4J49A 2WIAA 1TJ5A 2XYHA 1JIIA 3VOSA 4ZRNA 2QQ0A 1H4QA 3AUKA 3TGPA 3E9RA 2Q46A 3K8QA 2P68A 4DT1B 5JD4A 4D82A 5DNYB 4JKYA 1GILA 3BFJA 4E2YA 1G8FA 1WXWA 3RAFC 1TZ2A 4IVNA 1G3UA 2R47A 4PQGA 3T7IA 3TLJA 3WGYA 1NN1A 1A2KC 4PR3A 4FJ0A 4IP0A 4P5PA 2HFKA 4E2FA 4Q4CA 3ACDA 5A04A 3K0AA 3TLCA 5A2QA 4MLDA 4RVUA 3T94A 3BXXA 4LS3A 1T8UA 4HDNA 3GJ0A 2ZS9A 3VR2A 3HXQA 2FW9A 5JW6A 2Z8ZA 4MDYA 3TL2A 3DE2X 1R6VA 3T0GA 3NEPX 3WSWA 1I30A 4HT3B 2JCSA 2WPNA 2XQKA 3L8CA 5AHXA 3L6RA 3C97A 1P5ZB 2R8OA 1Q1BA 1U3WA 3TLKA 1DCTA 4DR2B 3QEOA 1P7CA 2J5RA 3DEKA 4GXTA 5BUCA 3QEKA 4YCNA 2PEYA 4G23A 1TMOA 1ONPA 4U02A 4IS3A 5FBKA 2J3MA 2PGDA 1VGVA 4IXWA 3H2ZA 2HIMA 4CQLB 4YMLA 2VNHA 1H1TA 5EYPB 4DWJA 1E1RD 4W5RA 2BTQA 3Q8MA 3AERB 1KMHB 4RD1A 5ER9A 4BO4A 5B7NA 4NZMA 2WP8J 2KLBA 1N2ZA 4ZC8A 2C2XA 1YDWA 2QTAA 4OA8A 3K4PA 4MR9A 4LJ8A 3GC6A 1EGHA 4JBYA 3VNUA 2JL1A 1QG0A 4ATNA 1WPQA 2FNAA 2GJ9A 3B12A 1ZIPA 3HR4A 3CX3A 4ZGBA 2VBCA 2XVXA 3W8RA 1KP9A 3WBKA 2NV6A 3PEWA 2JLSA 2AKAB 4QGHA 4R5MA 3TJMA 4TM7A 5DFAA 2AN9A 2IPXA 4IKPA 4DRXB 5A4MS 2HA0A 4CQLA 2QE7A 5G2OA 1JXAA 2O0JA 1Q7RA 1XNGA 4PO3X 4AK9A 1ZJ6A 5B4UA 3HYSA 5T7BA 5EP3A 2HU5A 3KQPA 4CLDA 1JR4A 1RLOA 2BGUA 2YZ2A 3ZDAA 1H1LB 5FPQA 1PW5A 1A5SB 4MIOA 3W5AA 4MW0A 1E1LA 4AL4A 4B43A 1SU7A 4FYVA 1KRWA 1VI6A 5AVXA 1NR5A 1V7PC 2QR3A 2RK6A 3EMDA 3K1AA 3O8DA 4J0FA 4LF5B 1XTPA 1ADCA 2JLXA 4YONB 1EK6A 3E8XA 4LSMA 3EQ7A 2XECA 1HZJA 3HCNA 1JVSA 3OETA 1KY5A 5DM0A 5FIUA 3FWPA 4BYGA 1VJ5A 3PDIB 1VHJA 3ETLA 2BP7A 3OQ6A 3WLEA 1FTGA 4Q4DA 4HEHA 1MB0A 4D9JA 4Q24A 3H1PA 2GM4A 4NZPA 1SHUX 1GZ5A 1TKCA 2NTNA 2ZT5A 4ZDWA 3W9UA 1AS0A 4EHJA 2Q49A 1H1LA 2ATVA 3ELYA 4ALKA 5FLYA 2WJVA 3QE3A 4M7OA 4GI2A 2H1CA 3F7OA 2WZBA 4CR6A 1X15A 3IUYA 1X86B 2J09A 3ZHUA 3O0DA 1ODIA 1I01A 2WABA 4JP1A 4LAFA 3FVTA 5K3AA 1HMYA 1YZQA 4YJ2F 1AZTA 2JGKA 2P9EA 3DR5A 4FC7A 2GVDC 2GFIA 1Z0IA 2PYDA 4IQGA 1G21A 4L16A 5HFAA 3RSCA 1A69A 3N7TA 3NYIA 2I67A 4AJEA 2GQ0A 3COPA 3FI9A 4NBTA 4WUVA 3R3ZA 2CL0X 2C2BA 3OU2A 3PDIA 3D3WA 4KOAA 3OOEA 4EA7A 4BNFA 3X1KA 1AUVA 4BVGA 1W47A 2QJOA 9LDTA 1UBGA 1UPCA 4N8SA 1QPZA 3N7AA 3FB1A 5TSDA 3TX6A 1X8XA 5JR3A 3L84A 2W6JD 3RYHA 3UK0A 3GGDA 4G01B 5IYZB 4LXIA 1Z4KA 4L2IA 4KB5A 4N54A 4IXTA 4NONA 3HC7A 1IVSA 3IUQA 2J6CA 2JAOA 3IBYA 2ADFA 4MROA 3ANLA 3PYLA 3TAHA 5JPCA 1ECFA 1N6IA 5IK2A 4P80A 3C7TA 4R69A 5EOVA 2F64A 3FR8A 4BX9A 3UC5A 1J1IA 3A1DA 4N6NA 4ZHQA 2IGTA 1Y3DE 4Y9TA 3U3JA 2W7TA 3QH4A 5IPFA 1YZNA 1ZW1A 1UT8A 3ZS9A 3QU7A 5CFRA 2ZUEA 2EL7A 4DA8A 1UC8A 3K16A 1YFKA 4R8RA 3DZGA 3U13A 2C4WA 5LM3A 5K4GA 4YUVA 1G8AA 1BCRA 4JP5A 4TN1A 1U9JA 2GDZA 2XNJA 2H4HA 1S02A 1EK2A 1E3SA 1GV0A 2QTHA 2BONA 3V33A 1R7RA 1N75A 3G9XA 1F2TB 1K8ZB 1PWHA 3P9QA 5DI3A 2IYAA 5IYZA 3RJ9A 2QN2A 5EMNA 5ALYA 4I6GA 3IQEA 2E87A 2O2XA 1ZITA 3EAQA 2G0NA 4HMQA 4X8HA 1AK9A 2R8PA 4LHWA 3CF4G 3PC7A 5IDQA 1QDLB 3WOVA 4GU5A 3U61B 3CLKA 1F0KA 4K87A 3QMPA 1DZ3A 3R2JA 1CERA 5CDSA 3E9ZA 3PNSA 4RACA 1O97C 2W42A 4FINA 1L7MA 2QG6A 3U81A 3AFGA 2SECE 4CMHA 1HNZB 2PXCA 5HE9A 4YR7A 2O48X 2GGSA 3UNXA 3OTHA 1F2TA 1WX1A 4J0IA 4MCJA 4Q1FA 1ISFA 4EPWA 4XX0A 4C7OB 4R41A 1ORRA 2CVQA 4WT7A 4E4YA 2E1RA 2PH7A 1YIAA 5CLFA 5L3RA 2YJ5A 3CEMA 3EOBI 3M6IA 2JJQA 2OG1A 3KBOA 3P9IA 3TVYA 3LUCA 5HZMA 2Q2QA 1QHEA 3CBGA 4B84A 3HEMA 4LNAA 3VXKA 3ZI7A 3A8TA 4TZ6A 2DR0A 1VIMA 4WVLA 4XSGA 3GU3A 4IFTA 2BFAA 1KPHA 1JZQA 1LZLA 1Y9DA 4HJRA 10MHA 3DQZA 2GLTA 2H85A 4IEFB 2ZIWB 3I09A 3ONWA 3KJEA 4HWPA 3FPBA 3B9RA 4DBVO 4PS0A 3NQ41 4KXXA 2XNHA 1R00A 1CB0A 2YRFA 1A50B 3BTSA 1K88A 3IV9A 4LKRA 1J25A 3UXMA 1RXSA 4IOLA 2OXEA 4YJ3B 5JNLA 3DWGA 1RYEA 3RJ5A 3U7HB 5LP6C 5TS2A 4G9GA 4JGGA 3WIEA 1JKFA 1Z13A 5E9QA 1CF4A 1U7ZA 2XA9A 3GXBA 4MVJM 2PV0A 4JJ4A 2ZR7A 1XLWA 3INTA 1ZUNB 4B4OA 1NMZA 5CTAA 1FLAA 3BREA 1T9ZA 1U1DA 4RDCA 5IN5A 4RPGA 4Y6PA 1KQNA 4CYMA 3IFSA 2CJWA 4DA6A 1UDXA 1YQ9A 1KO7A 2H2AA 1BS1A 1IZYA 3WRYA 4X62B 3F5DA 4B3TB 2HYIC 2HU2A 1SM4A 5AM5A 1E2FA 5KQSA 4R1LA 2O2IA 3W5JA 3E05A 4HQLA 5DH9A 2VF2A 4G0XA 3SXUB 3RBXA 4J4HA 2I5PO 4FWBA 4I9GA 4C0QC 5J5AA 1ZVVA 1W4BA 2Y1WA 1YS7A 4IBOA 4ZV9A 3QKSA 1OZFA 1RP7A 1OAOA 3DM9B 2ZGVA 3WLHA 4AF7A 2YRWA 2LZ0A 3DP9A 1K2VN 4G6ZA 2QDKA 4NWIA 4I19A 3VHXA 3W8FA 5FI3A 2Z2ZA 2LV8A 1WXGA 3WNDA 4P3NA 3H2SA 4RHCA 2VF4X 4RL6A 2CSXA 5JXWA 1ZGBA 3RSQA 2ASEA 4J2HA 2ZJ0A 4CV0A 2NZ2A 3K0HA 3PQEA 3G2NA 4Z4HA 4H7HA 4Q12A 5EAIA 2ZE7A 3GUYA 2H0AA 4DA7A 4B6GA 4I1UA 1OH5A 1J7KA 3LL4A 4O63O 1ULUA 3S2UA 4LRWA 5K0GA 1A98A 3D5TA 4H18A 4N7JA 5JQWA 2CJFA 1G8HA 4GEGA 2X8AA 3WB1A 3JPYA 2DTDA 2YBDA 4DMMA 4EO9A 2GK3A 1PRYA 2OCDA 1Z0FA 2CNNA 4LBWA 3LRXA 3EMVA 2CLSA 1LRJA 1Z08A 4TYYA 1F2UB 5AMXA 3R44A 1AV7A 5J63A 3G02A 1VPWA 1NX6A 4KQIA 1AS3A 2PUJA 1DKNA 4LYFA 5TMBA 1E6KA 1UDWA 1ZH0A 3DNPA 2Q0QA 3W6UA 2V03A 3QWFA 1TZCA 1QFSA 2FFJA 4B44A 3W5IA 3LHSA 2PBRA 4LECA 2NO4A 1JEOA 3MT8A 4DLVA 4ZVTA 3UMFA 2QN3A 2QLNA 2AUTA 4OFWA 5CR9A 4DC0A 1X7GA 4JKOA 2FW1A 4GI5A 1BMQA 1ZN8A 1NMXA 3SN6A 3SX4A 3T1NA 4YRMA 4QDZA 1MIOB 4DQVA 3ZLBA 3ZCPA 2ZANA 4FB4A 1V37A 2FVYA 3K0FB 4PE5B 3RRNA 2WYOA 1V3QE 2GD1O 5GINE 2QRHA 1L3BA 4HRXA 4OJYA 5KNCA 5J1SB 1NI5A 1U8AA 3USES 2PZEA 2VF8A 2IF2A 1U5BB 1GGFA 1YHZA 3Q3HA 3VZSA 4BFTA 1U90A 3NIWA 1MLDA 1R4MB 1CQIA 3LUFA 2J32A 1LBTA 2ZI6A 8AT1A 3JRNA 2E3JA 1Y3HA 4EW2A 3K05A 4XWWA 5K9ZA 5CX4A 3HCWA 5JYEA 5ICCA 4KE6A 5F5NA 1RBZA 1SZJG 2LD4A 1MIOA 2ZCJA 3K20A 3UHOA 2ZBDA 3QITA 1TF2A 3HKBA 1P60A 3D43A 3HXMA 2B2XA 2RONA 2XNDD 1QH0A 3LH5A 5AHRA 4TMFA 1AUXA 1NOJA 2AOVA 4U3JB 2C83A 3WK7A 3O1HB 1IDN1 2NTJA 1EWVA 1W9HA 4ZI3A 2JC3A 3L8GA 4OGGA 4CV3A 4LJ7A 3C5WP 2IYWA 5AW6A 1ZGJA 1EPUA 1R4MA 3OJ0A 4HDKB 2PL1A 1ZA1A 4ZN6A 4B35A 4ND7A 4UE2A 2ZRAA 2VVTA 5B3AA 2XLBA 3LFUA 1P2TA 3FVVA 1BWSA 4H7DA 4XH9B 2GILA 4MV5A 4XKJA 2MCFA 2Z5FA 2RGRA 3KZVA 2B8WA 2YNMA 2CMGA 4K9MA 4X24A 4DUZB 2A5FA 3MRVA 4BATA 2PS3A 2YS6A 3IQZA 2WIGA 4IJQA 5AVRA 3ETCA 4IR7A 3AV0B 4U3JA 4XD2A 1O4WA 2WM3A 3AWDA 3E61A 4OSEA 4EUEA 1SPXA 3AF6A 2PX6A 1NVVR 4FFRA 3TJRA 2OFFA 3BJIC 2WWRA 3PC2A 1RXWA 1TYBE 3AUUA 3HHEA 1UWKA 2PUBA 3F9RA 1H2BA 3HWX1 2ONZA 4QOHA 4WX2B 5CDHA 4Q3OA 1IJBA 4QJ4A 3VU1A 1AHHA 1YAHA 1T6XA 5FCDA 5J1TB 4EZEA 3A6EA 4YRIA 4QT0A 3VYWA 1GCGA 3EVAA 1C1XB 3VBEA 4JB3A 4AN0A 4X3PA 2RH8A 3AL2A 1FDOA 3SEFA 4E7PA 4B1FA 2AZMA 2PH5A 2QL7A 1Y33E 2I3ZA 1TT7A 1ZH8A 3BIWA 3BJRA 2W8BB 1D4FA 1VBNA 2W2LD 3C1AA 4Y1GA 4A8JB 4BX3A 4ZYTA 2KQUA 1UZNA 4LK2A 1NASA 1CVRA 4M9ZA 4IDQA 2XUHA 3EGDB 2ZXUA 1IIBA 2HUNA 2I2BA 3U0BA 1TFRA 5FL3A 1S5PA 3V8BA 1KEPA 2EYUA 4GBGA 5EUBA 2B4QA 3K70C 5IDWA 1KO1A 1NJ6A 1DC7A 1TCAA 2FJUA 3FPLA 3C6MA 1SCQA 1U02A 3EGCA 3NB0A 3W05A 1JH9A 2UXCB 3TTUA 1N1EA 1JWAB 1DAHA 4M49A 4NPHA 4U8HA 1DRKA 3GDHA 3N8DA 2AOXA 2WJ3A 3BK2A 4QU8A 2KM1A 2ZR8A 3MCTA 1KOLA 4B6PA 1VYUA 5K0NA 1NW7A 3ZWYA 3B1YA 3HEAA 4ND6A 3I64A 2YJ6A 1E1DA 4E51A 4BXOA 4KC0A 2CF6A 3RU2A 1YDMA 1DFGA 5EHXA 1E8NA 3O38A 4N5NA 1FRZA 3IDSA 4XAQA 2BLNA 4B6JA 2ZU6A 1Z6XA 3AGQA 4BP1A 4BC1A 1KC1A 1YBMA 1EDDA 2RG1A 3F4LA 3RU7A 4P38A 1KHHA 3DW3X 5FPTA 1WCXA 2WWGA 3KXLA 3WRVA 2BR5A 1HLPA 1Z2AA 3BWMA 3JQGB 1EJ6A 3TLXA 1AMNA 5CNMA 4O2BA 5DNVA 2CFOA 3VVMA 3PJRA 3DDHA 5ALEA 2M1XA 4RD4A 3V2HA 3DEIA 1CULC 3SS9X 2O0KA 2H8KA 5CXSA 5IC5A 4JJ8A 5BOSB 2ZSFA 1DAPA 4K6KA 4QOIA 3QVOA 1RAEA 2ZDQA 4JOBA 3GFFA 1KYIA 3EMBA 3SZ3A 2WKQA 4TYNA 1Z6YA 1Q6YA 2X5XA 3AM4A 3C70A 4BMDA 3DM5A 3KB8A 4DNQA 3UK6A 4AECA 2P65A 1I32A 4KQXA 4DGQA 2WC1A 3R5KA 5JMTA 4JYCA 2VDUE 3L7YA 3RFCA 1W0KD 4BQOA 1E7MA 4Q48A 1GCIA 3HCEA 3S44A 2FPUA 2VTDA 5DYNA 1RQGA 621PA 5EZ5A 1SXJD 3CPJB 3ITNA 3QF4B 4CKBA 3JQGA 4HVCA 1VP3A 2B25A 2ZYGA 4H15A 2Y67A 1BU8A 3RKUA 4IKOA 3AOGA 1LLUA 2E4YA 2VA9A 4AF6A 3G6WA 3SAJA 2MOKA 2IZZA 4TMXA 1YSCA 4INOA 1XTSA 3E7WA 3HN6A 1NVKA 3D8UA 4PZAA 2E2WA 3R40A 1G60A 1PUIA 3W8NA 1NLMA 4ZK2A 4H1VA 3NEYA 9ATCA 3H3JA 1OF1A 2Y9PB 2YWDA 1ZA2A 2ODBA 4YXFA 2XT0A 5C5DA 3E8MA 4JI8B 2FQQA 4M0LA 3EZ6A 1I7DA 2NQTA 5AUNB 1LF0A 5LNK1 5JSYA 1BGXT 3PXAA 1JI0A 4PNZA 3BMNA 2X1VA 3H6GA 3IOEA 5THQA 4RTMA 2WD7B 3Q3VA 1MJNA 1N6HA 1YR7A 2I54A 3L7DA 4Y2JA 2I3DA 4U0JA 1WF3A 2BVNA 4JC0A 3AV3A 2VCHA 3F90A 3OZXA 3T95A 2XUKA 2YV3A 4EA6A 3MG9A 2ZQ5A 3A28A 2P0AA 3OHMA 3T1TA 1TYCA 5JDIA 1GJRA 2X2EA 4KDRA 5MHTA 3AEUB 3WNQA 1ZN7A 5DTIA 3HCRA 3MTBA 3SMQA 1VLHA 2R1VA 3PC4A 4KMRA 1DTEA 4BCCA 1U98A 3HGTA 4DV2B 2FN4A 5AIAA 3LDUA 2FLWA 3DT8A 1Y80A 4O0MA 2J67A 1OI7A 5AUPB 4RF5A 4YP7A 3UB2A 4D0GA 2XKAA 3ETEA 1LGYA 3HDGA 2G72A 2XGOA 3BH6A 4IVPA 3WL5A 1I2CA 2FG5A 4XDGA 1JPVA 3GEPA 3PRJA 2CFRA 3BA1A 3BILA 4ZVLA 2IYOA 4KWIA 4ITVA 1SG0A 3TAUA 1XVUA 4OKNA 1CETA 3GT7A 3OCVA 2KBEA 2X3UA 4LSZA 3W3AH 2GUGA 5KKAA 2A57A 5CBKA 4HFNA 4S1WA 2RGUA 4UNNA 4ZYXA 3E5RA 2VYND 1SN7A 3GJTA 3DDUA 2B2NA 3IP5A 1AH2A 1FFHA 5G0TA 1M1ZA 5BUQA 2IEZA 1RRPA 3RS5A 1T24A 1GA6A 4C2TA 5I7WA 2BJWA 3BMQB 3FTNA 4GQAA 2WB4A 5DXAA 4L9SA 2C3YA 2HLNA 4EECA 1MDBA 1NAHA 1TK3A 3LGSA 3LTEA 3P5BA 4CM8B 5LD2C 4G4SP 2ERCA 1UDCA 2B6NA 1WMAA 4JJIA 4U7DA 2WVHA 3T1YB 5AI9A 3A25A 4AX4A 3DHNA 2F8LA 4IFEA 5ITSA 4RX1A 4K1LA 4A0SA 1URPA 4DSNA 3IUEA 1B1AA 1V6CA 1O3YA 2FMIA 5BRJA 1WOYA 3GYBA 4EL0A 1F20A 2OM6A 2HD4A 3O6VA 2X6QA 3F8SA 4D6XA 3EGXB 4KFRA 2X76A 4KRXA 3P4XA 4IQ4A 1AURA 2ZE5A 3OIGA 1ECLA 1YT5A 4TLEA 3NVAA 2XWSA 2EZTA 4URHA 4DWOA 4EJMA 4B3GA 4C0HA 3DPIA 4BLSA 1OX6A 1F5NA 2C5AA 3IB6A 1VSUA 4IDHA 3RV3A 2JIDA 1WUIS 4AN4A 4JVLA 4CM8A 1MJGA 2OFPA 1R0KA 2QX4A 2REXB 4RPJA 4Y2TA 4ZT7A 5DNAA 3UKJA 2QMQA 2VYVA 2O5EA 4JQYA 3CNQS 5FNVF 5EPUA 2VP5A 5ARDA 5KMGB 1NVDA 3IYLW 4OIMA 3X1MA 3D8TA 1EFKA 2BKVA 4L3VA 1RKVA 2VQSA 1AY0A 1OTYA 3LHFA 5AICA 3OFJA 1GL7A 4DCOA 2ZATA 2XVZA 4GW3A 5IN4A 2VF7A 1YCFA 1IOLA 2G17A 2JASA 4UAGA 1LPOA 1W85A 2VK1A 3FNQA 3LLMA 2VP0A 4UBJA 4LZZA 1QDEA 3VV3A 5EIEA 4EYKA 4TKVA 3WQRA 1O0CA 4F9FA 4X85A 1PI3A 5H59A 3O0TA 2AMYA 4BMXA 4PZPA 4R7GA 4RANA 1XWFA 2H57A 1RKQA 3BULA 4MI6A 1P8AA 3OWXA 2ACVA 4V0MA 2C5FA 3GMIA 4JX8A 1JEJA 2RH5A 3TQHA 4CM4B 2F4VB 3VR1A 1PBNA 3LYAA 2FRXA 3H8VA 3CZ4A 4D7AA 2CJPA 2EBUA 3QUBA 4URUR 5CPFA 5HF6A 1DQNA 1DTSA 1T36A 4GOLD 1C7RA 3G49A 3TIFA 4JWTA 2Q6LA 5KMGA 3C6YA 3PNKA 5EJ6A 2Y4OA 4ZTBA 5JTUA 1GZ4A 1RQLA 1ZR2A 1EU1A 2WTXA 1ISHA 4RMIA 5I4BA 1C7EA 1GPAA 2XPCA 5CVDA 4W7SA 7ABPA 3T4UA 3KKEA 2BFWA 5SZJA 2VG8A 2ONJA 3EZYA 5KREA 2ZG6A 1W5SA 3URMA 2VYFA 1TVCA 2A0FA 2WICA 4GBED 3DT6A 1KNXA 3OF5A 4IHJF 2RKWA 4TMTA 4PQEA 4RHFA 5DWDA 4CM4A 3M33A 1GFWA 1DBIA 2OTCA 2P90A 3GXOA 4PAQA 3RSLA 4DBZA 4FDAA 5KEIA 1A2BA 4YLEA 3ZJVA 1MW8X 2BCJQ 1G8GA 1DWQA 3GGCA 3V8RA 2FMFA 1HNXB 3PV0A 3TGLA 2PFGA 5T3UA 1IB0A 4HLDA 3VH2A 3VR0A 4C6HA 2RHTA 1S3FA 2CLHB 2Z4TA 1L6RA 4FN4A 1V7ZA 2P3SA 5IJAA 4HNTA 2Q07A 4EGSA 4A0HA 3N6XA 4H1TA 3DMYA 3HB0A 4RGVA 3HGMA 1PTJA 5H7XA 4ZEOA 2BBOA 4U2CA 5JS6A 3DOFA 1GQSA 4HNAA 3WL3A 1V2HE 1D4OA 2JJYA 2VEDA 2IL1A 1ULHA 3Q87B 5BQPA 1AHPA 3IEMA 3R3JA 1ZEJA 2F3TA 1V1RB 2QUKA 1M8PA 2I7CA 1GG5A 3FSGD 4JP2A 4B2IA 2IY9A 3T1QA 3IP9A 5JALA 3GJZA 1GNSA 2QSYA 3SX0A 1WMFA 3NV7A 4Y2HA 1XMSA 3ZE7A 1MJGM 5ALLA 3F4KA 4QAJA 2G77B 5KCZA 3R3XA 5DLYA 1IBKB 2OEPA 4UMVA 1DV2A 4XLZA 3EXAA 4G25A 2WTNA 1TEZA 1AHNA 1W93A 4S1OA 4PLHA 2VUHB 3GHYA 1AB6A 4GMGA 3QFTA 2EQBA 3WNBA 1HDIA 4KTVE 4LVUA 4OFBA 2GNAA 2FX5A 2C7PA 2HH9A 4J0GA 4MUAA 2AK2A 3PVSA 1CR2A 1IQPA 3I76A 3I5UA 2GA8A 4UHEA 4ZVQA 3RASA 5LXTA 2RI1A 1D0SA 4Z4GA 5EZQA 1D5CA 2RG7A 1JEDA 3RGGA 4WRRA 1R9MA 1MUUA 2PMKA 4HXEB 4JOQA 5JCZA 3T1HB 5D3KA 1R0YA 3LDGA 3M5DA 5FXMA 4PBRA 2J30A 3LNCA 1J4AA 4PNPA 3UJ8A 2NACA 3AH8A 4RXTA 2I6SA 3GCGA 5D1NA 5H4GA 4YAJA 3ILYA 4Z7JA 2LNDA 3Q5GA 3SJZA 4GZ3A 5KYVA 1OGJA 1UAGA 2QXTA 1DCKA 1ZUWA 3OJLA 2ZULA 2VUTA 3OZUA 4CM1A 3EEOA 1RW4A 3EXIB 1KY4A 3DHYA 1V0JA 3JWGA 3Q7SA 4FOOA 1E1YA 4G97A 4OAPA 1YVDA 4LJAA 4TMYA 1H69A