2X4IA

Orf 114a from sulfolobus islandicus rudivirus 1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
Knots found
sequence length
112
structure length
105
Chain Sequence
NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGHDSTIQLINSLCGTTFQKNRVEIKLEKEDKLYVVQISILTLEEILKLYESGKVQFFEIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords UNCHARACTERIZED PROTEIN 114
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus islandicus rudivirus 1 variant xx
total genus 25
structure length 105
sequence length 112
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08960 DUF1874 Domain of unknown function (DUF1874)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x4iA00
2J6CA 2J6BA 2X4IA 2J85A
chains in the Genus database with same CATH superfamily
2AQKA 2EP7A 2JGEA 3TLBA 4BE7B 1PDOA 4R2LA 4YBZA 3KL4A 1MU0A 3OFJA 5AKHA 2XUZA 1EIZA 2NW6A 2GI4A 3T61A 3IEMA 4EA8A 2FWPA 1O0SA 3L0DA 4BS9A 4X7BA 4Y6LA 1ZL0A 1CJSA 4I99A 3QNMA 1UMCA 1AHPA 3T0IA 2R47A 4WVFA 4X95A 3HGTA 1EDDA 2AJTA 2I3ZA 5G1NA 4DLUA 2XOKD 4PLVA 3TNDA 1Z6QA 3LYLA 3TBFA 1BWSA 1VJ0A 3O83A 1Q7TA 5DX8A 3KT3A 3FUTA 3TG2A 1PUXA 3EQ9A 2XZTA 5EE9A 5F35A 1C1DB 4DV2B 2WD9A 3D1JA 4YPVA 4D26A 2NUPB 3BTUA 1RKQA 5JLAA 2P11A 5B37A 4BNIA 3KJQA 4O33A 3AVOA 2WT8A 1XJWA 4JD5A 1YA4A 3KE9A 1I0ZA 4NYJQ 4OV6B 3C3XA 3AUJB 1KYWA 2A88A 5JMPA 4CMEC 3D7RA 2GBLC 4KGXA 1TC1A 3O8LA 2FMTA 4DLBA 1U0SY 2DWQA 2HMUA 7YASA 1DMRA 1EI9A 2WIKA 3KLPX 5T4BA 1X7DA 2J45A 1NBAA 2CGEA 3LKZA 4QOJA 3VDNB 1ECLA 2FWNA 1R5JA 4OVKA 4Q12A 3WLEA 2JLYA 1WR8A 5CJPA 5LQKA 5BMVB 2VDKB 3LBIA 3FWKA 3GVHA 3OT1B 4L5BA 2LDXA 2QDKA 4I8IA 4M83A 4RAOA 3B70A 3FBWA 3A9SA 3H4MA 4OK5A 2BKVA 4R31A 3UHPA 4ZK6A 4G4SO 1EWKA 4JITA 4PX5A 2C83A 4M1TA 3D3JA 1I3KA 1UXIA 3LKDA 4Y1RA 1RXSA 2NUTB 4PTLA 5A5DA 4QU5A 3UFXB 1OC2A 3DXZA 4RYDA 4DCVA 2JCVA 3G2NA 1PZFA 1X7XB 5CP8A 1OCEA 1G3MA 1ZW1A 3QU4A 2BLNA 3QFHA 3U37A 4A0GA 1O77A 2EJWA 4EYQA 5L4NA 4L78A 1PF7E 2N3ZA 2C99A 2JB9A 1HFKA 2O14A 4G9BA 4NBNA 4D0GA 621PA 3V1TC 4OF4A 3VVCA 3UGJA 3AONB 3OU6A 4IHJF 5CVJA 3UB3A 1W5BA 2VSXA 3QMVA 5L6MB 1RS0A 1XEWX 4FE3A 3JQQA 2X23A 4PRZA 2QVGA 2IBMA 2QX9A 2WM3A 4G41A 4LGVA 4J0JA 4WK4B 5DHQA 5DW3A 5LZ5A 4CQNA 1VYHA 2W6QA 2XQJA 3SOZA 4DAEA 1DQRA 1AXGA 3ZJ5A 3S1SA 3LJKA 1TCVA 1UT6A 3BSWA 3K72B 2BFBA 2Q9UA 3H3FA 5JR3A 3VHQA 4ZCPA 5HJ7A 2NSJA 5L4LA 1H0HA 2BMFA 2Q21A 1QKJA 3I09A 4IFBA 1BHJA 3ADCA 3ZWAA 3GJXC 3EEIA 3K0FA 5ALJA 2FOLA 3OPMA 3LPMA 3FTCA 4J6FA 4NOKA 3KJHA 1QO0D 1T9BA 5D01A 4F5WA 3AESB 1PV4A 1PSWA 4JI7B 2C7GA 4G5HA 1Y5RA 4Q1FA 4KHZA 1XTSA 2ZUWA 3IV7A 1I01A 5JTUA 2IPAB 2NTNA 3E5RA 2W42A 5BYJA 1ZA2A 2HSGA 4HQNA 2IW3A 4HUQA 1JDJA 2HL6A 2V9ZA 3NPAA 3DLHA 4FB4A 2XYGA 3VNSA 4G97A 1ARZA 1EX1A 1FNDA 2CFIA 3EVZA 3T3OA 3TR5A 3EPKA 2SCUB 5CGZA 3PR2B 3BTOA 3WYDA 2VWPA 2WU1A 4ZYLA 1N6RA 2CHQA 2ZSIA 3EQ2A 3FTDA 1SUDA 2Q3CA 3GEBA 5BQFA 3NH6A 5JFTA 3DWGA 1E6EA 2ZJ4A 2CHGA 2UUBB 1TQ6A 3L7MA 1QYVA 2OT3B 1ZCAA 2IHYA 1N5DA 2CZQA 4U9HS 5LP6C 2E9SA 3AEKB 2VYVA 3UOAB 1LZKA 5DTEA 1P17A 4ZJZA 4HDMA 3U9SA 1J97A 4P5PA 1T3TA 4ALIA 2R8BA 1W4CA 3A26A 3T3MB 3DEKA 2NVUB 4ZCRA 5EJ8A 4PLTA 1CUYA 1BYUA 1EWYA 1AUOA 4CKWB 4X3PA 4DCJA 1QRDA 5DTRA 1HT0A 2QT1A 3R24A 5GJWC 4G84A 5D8DA 3R7NA 4ER7A 3L7LA 1A96A 3A32A 1A8SA 3DKRA 3GUCA 1PD1A 4HLQB 3ILYA 4CLOB 4U2FA 1AQNA 1EG7A 4HC4A 5EJ5A 1RD4A 1LSOA 1UBSB 5DI3B 5JTTA 4MWEA 5C1IA 3DDOA 4QGBA 2PYIA 3VPXA 2YUIA 4AWBA 4DIKA 1J2YA 4EY7A 5HR5A 5L6LB 4RXMA 4UUPA 3DOFA 1VLMA 3KOYA 4WRRA 4ZXPA 2HW8A 2C58A 3PS9A 3SEAA 5BT8A 3MS4A 1E4VA 1II8B 1TJNA 5JAOA 1AQLA 2IUTA 2WWYA 4H3HB 2XB2A 3AZQA 3WNQA 4INOA 4YRBA 2GVZC 4F9EA 3FMIA 3D5QA 4RVGA 4QPCA 4WZBE 1MB4A 5I8WA 2XLCA 3K8OE 4BYMA 3DGEC 1JXQA 3DXYA 3JQ9C 3W90A 3E9NA 3JQFC 2XCSB 1XAHA 2G4CA 1GT6A 4ZZ3A 2EGHA 4DHEA 1M6VB 2MYUA 3N8HA 3R44A 1R6TA 2QPAA 3T54A 1Z4NA 4NZOA 5EJ6A 1JFLA 2IODA 3A6GA 4KQ2A 1ZBDA 2GFIA 2H1RA 3AXTA 4JC8A 4LE1A 4HH3C 1WBDA 3SXJA 3RS8A 1LS1A 1YJQA 5J5AA 2DSTA 2YFQA 2ZDHA 2BHRA 3KD2A 1X87A 2YIMA 5JYBA 4U7JA 1NXVA 3IBTA 4Y3UA 5DSZA 4JEMA 4DBLC 1YSCA 4LBYA 4N3GA 3QVOA 4YIKA 2C03A 3KEQA 2QNBA 3Q7RA 3WJ7A 3GFTA 7REQA 4XFDA 2JARA 1CERA 4NDAA 3DSRA 4MVWA 1QRAA 2BEWB 4Q7MB 1QUFA 1XKLA 3GA0A 3OF5A 4ZO6A 3WYGA 1LGYA 2DWCA 4IDCA 5DP2A 5CB4F 3TYXA 1O94D 5JBIA 3ENKA 1Q21A 3CWQA 5ALRA 1Z22A 1ZK4A 1ABEA 3EMBA 4QATA 4P8RA 2HWKA 1TJ3A 1VA4A 3H19A 4LJLA 5EZ6B 3UMGA 3QVVA 2V7WA 4ZT7A 3HVKA 1I3NA 4YACA 4FYVA 4JXJA 5GWXA 2J4CA 4CWAA 2ZPUA 1MC8A 1Y3FE 3LY8A 2QY9A 1RRVA 3LA8A 3PQEA 3GRRA 3QE4A 2NUAA 1M73E 4EARA 5JC8A 3K2IA 2IPXA 5EQFA 2D8MA 3RV4A 1A2BA 2ANBA 3MWDA 2ONKA 2JLWA 1YB1A 2RSLA 1L3IA 3D6UA 3OQHA 3PDWA 5BYAA 1P1RA 3QNUA 3N2YA 1V37A 1J25A 1TO2E 1DJQA 1NUAA 1LTKA 3KLBA 2IA5A 3BXFA 4JELA 3RRBA 1K9SA 1KBQA 2QENA 2RHLA 5CPBA 1GNTA 1JLHA 2Y0PA 2H4HA 2J30A 2J5QA 5GV7A 4LCBA 1ZAKA 4CLRB 5KYTA 1ULAA 1XZIA 3GOQA 1QU3A 1M8PA 3SEQA 3QW4B 3T5CA 3T4EA 1Y6JA 4EQZA 2C2BA 3HBMA 4TS4A 2W2XA 1WCWA 5CT9A 1NV9A 4Z7JA 3QPBA 1MF7A 3F7NA 5E6SA 5KWIA 1TKBA 3NBAA 2EATA 3DMPA 3PNOA 3W9YA 3B3GA 5SYNA 5IJ0A 2HA7A 2ZKLA 1ECCA 2E6KA 4F4JA 3KD3A 4CR7A 4WI1A 6AT1A 1ZUNA 3QHQA 1S0UA 1XMQB 1C3OA 2VLBA 1J07A 1Q0QA 2YS6A 3E53A 1YBHA 2LDBA 5EOVA 4OBBA 3ESYA 1GNVA 4Q1VA 4EYSA 2ZT7A 2DUMA 1ZP6A 2XUGA 3DHEA 3H86A 4KV7A 2ZJAA 2GGSA 4RJJA 3ZBQA 4V1CI 1KC1A 1YCHA 1M2KA 1Z35A 3RAGA 4EZBA 1NVAA 3T1YB 2FCRA 3BJEA 2WTMA 1VL2A 2DAPA 1C2TA 1FUYB 2PUJA 2D6FA 5SYAA 4G5SA 4C7OA 1ZJ5A 3IOEA 4JL8A 4DNQA 1I7QB 1HE3A 1ML4A 4RTNA 3W3AD 1MZVA 4E5NA 2WBLC 2CVHA 2P2LA 2AJ8A 3NW9A 3OQMA 3U7IA 2MSDB 1Y9DA 4UEQA 3WK9A 3K73O 4PANA 2PL5A 4MWTA 4LHVA 7MHTA 1SOMA 3NNDA 4A16A 1C4KA 3Q7PA 1EE9A 1ACJA 4JUBA 1KHTA 2IP4A 5KIAA 1LW7A 4DWVA 1SB9A 2J3JA 2RCYA 3BFXA 3FPFA 2KYRA 2ZT6A 2WIBA 3O9ZA 1A9TA 2BFNA 5DLYA 3T0FA 2VZEA 1AJEA 1SUSA 1P2UA 2BGKA 4M1ZA 5F5NA 1T4CA 4E09A 1A2OA 4D81A 5HBRA 1N2JA 5KSZA 2V58A 3CKKA 1DRWA 1IQUA 2CJWA 5AKIA 4ZVUA 3I6BA 2J07A 3NHJA 2ZCVA 1SG9A 1G5PA 3JWIA 3OZTA 3CZQA 1GEGA 1Z6XA 4U39A 4B83A 5PGMA 4CLXA 2WU8A 4D8UA 5HTOA 5DNEA 2HHHB 3I1FA 2PZJA 1DPGA 2P4EA 5HCNA 5JAUA 5CEJA 4E14A 2NV6A 4WOKA 2F4NA 3D5TA 3HDYA 1E3IA 4YLEA 5JSUA 2Y1LA 3WGGA 1FP7A 1WVIA 3E18A 3U7EB 3WA7A 1V9LA 2OM6A 3E2MA 4RTRA 1GPMA 4CLHA 1YL6A 1YFJA 2HYIC 1K92A 4GICA 2WD8A 2CHFA 5B12A 2QROA 1E0SA 2M1ZA 2JCXA 2ZJ7A 4X66B 1OXTA 1N7JA 2FG5A 4E30A 4WIAA 2VQ6A 1R18A 5C37A 2C7RA 1Z12A 1JDTA 1X7YA 1FU7A 2DHQA 3AKDA 3OE7A 4UU0A 4LBVA 3WLIA 1A3CA 2ZUSA 3EFOA 3IILA 4GI2A 3ROGA 3BFJA 4KN5A 4N03A 2WYUA 1XKTA 2QD5A 2JK1A 1BROA 2WKPA 3IGFA 3K9CA 4KDFA 3BVPA 5DVZA 4BB6A 2I2AA 4X0EA 2P78A 4U5QA 1KEZA 4ZVNA 4C4AA 4H17A 2FR8A 4E5KA 1IN4A 5KQMA 1RKXA 3HRHA 2ZRLA 2O19A 4TTPA 1SZJG 4NV1A 3DNPA 5BN4B 1PK9A 1V2GA 4NHOA 5T3YA 5BN5A 4RS4A 3RU9A 2O5RA 2PWZA 4N8DA 2Z04A 2G36A 4GX2A 5A4MS 4G0UA 4IQGA 3CJTA 5JYEA 1FDIA 1C81A 1VE9A 2O4CA 1XWFA 3P52A 1ZQ9A 4KRYA 5IXJA 2FQWA 1N36B 3CEMA 4QQRA 2HOQA 2PSSA 3EIFA 4BNFA 4IIUA 4UU1A 5K7SA 5F2KA 1YAJA 5ED0A 4KR2A 1BS2A 2Z58A 2UV8A 3NHAA 4WACA 1DJMA 4ENSA 3HCAA 3R3HA 2Z95A 3VKHA 2G06A 1EKXA 1TJYA 5FP0A 5J59A 4EKEA 2ZREA 1ZK2A 3SR4A 2VVTA 3AH8A 1H6AA 3KKEA 2JH9A 2QJTA 1QQ7A 1QGED 5C35A 4MWBA 2ZDQA 2PH1A 1SOAA 2PMKA 4N3NA 1Y8ZA 2ONZA 2ZAYA 1WPXA 4CNBA 2A0FA 4HBZA 5TS2A 4DJEC 4RXUA 1GZSA 1A1SA 3MN1A 4H60A 4XYLA 1PJQA 1D7AA 1T91A 1KZ6A 3ICQB 5IULC 2BGNA 1RTKA 5JJLA 3N2KB 3Q10A 5FBVB 1OPRA 2NO7A 2QV0A 2OESA 3IKLA 3B8EA 3G2QA 3O6VA 1OZHA 3QVLA 2G7MC 5ED4A 1KEVA 2GASA 5I4CA 1S3SA 5HF5A 5AI8A 4EITA 2MINB 4O3FA 2FMUA 1P2DA 5ICMA 2QN6A 3I92A 3K1JA 3DCNA 3I2HA 1Z2AA 2P9CA 5EJ7A 3FNBA 3O2QB 3V9AA 2D2FA 3O2SB 2JH3A 3WL4A 4IHQA 1GT91 1T8YA 4EYKA 2W58A 2PRIA 3PIDA 3PHLA 4M8LA 4NE2A 2VYVD 5DWVA 3WB0A 2FTKE 2ZBUA 3GZNB 3VH3A 3VPDA 2H4FA 1NRIA 1RQPA 4OYLA 2PKRA 5JZMA 3KCNA 1HE8B 3I6YA 3M6XA 1GG8A 4QVGA 4OL9A 1I9CA 3WZ2A 3LD9A 5H9VA 5DK6A 1KZ9A 5BSGA 1M2OA 2FG7C 4W8OA 1HDEA 1I1NA 2JK0A 2OO7A 3HSKA 4Q3CA 1NQVA 2RDMA 4COOA 4EW6A 2PIDA 4QOSA 1U65A 5AUNB 2A78A 2J59A 5D5QA 3O8RA 4PO8A 3I4FA 1RFGE 4K1XA 2B9VA 2BL4A 3V3KA 1JQ3A 3E61A 1LDBA 2ETXA 1AGPA 3OQIB 4I08A 5G0WA 2HLHA 1NKVA 2H2HA 2C61A 5FOQA 3QVMA 1Z5OA 2D13A 3PG5A 3EGWA 5JI2E 3FDIA 4KO2S 3FOAA 5EIOA 3VFDA 4GUDA 2NUBA 4TTVA 4RIGA 1IN1A 3F78A 2EBWA 4Y6QA 1X42A 2I7CA 1VG1A 3FGZA 4AYWA 4BWFB 1RWWA 5BWBA 4YRMA 2CVZA 5FD8A 2G07A 4NMHA 3PHJA 3PNYA 4NS4A 1PLJA 1TFRA 2Y1CA 1WW8A 4ZT5A 5HE9A 2QRVB 4AP6A 4DM4A 1A5AB 1K8YB 3F90A 3VPHA 2B1QA 4BMDA 2ZJOA 2NV0A 3SZRA 1R0CA 2VSFA 4K86A 1ISSA 3IAEA 3MT7A 1EUZA 4QA9A 2I4OA 4ZI7F 4ZYYA 3EXHB 1ELOA 4M9CA 3HNPA 3HKCB 5IAJA 3RS9A 3G8CA 5HG0A 3U4MA 3NHUA 4B3GA 1Z15A 4OREX 5CA0A 2NXEA 4QBGB 5E4FA 1IB0A 2AV6A 4B2PA 5HIKA 1P6QA 2HMVA 4DJFC 1OB5A 1OXSC 3QY0A 2D4HA 4Z1MA 1P0PA 3RVRA 4EW1A 2WTAA 2YHIA 3ZGOA 2HJHA 1TKRA 5FA8A 1KI9A 1EZ1A 4M8IA 3DFMA 1JG4A 1AM4D 1LNQA 3AUSA 4LFCB 4OD0A 3OEYA 3DLIA 1E3TA 2V59A 3WR5A 3ZNQA 2E4XA 3WGHA 1YFKA 3L4BC 4BBPA 1TNDA 4MQUA 4CV0A 2WV9A 3Q2OA 2DULA 1P45A 1JG2A 1VRWA 3OX3A 4EHLA 2WZDA 2CNNA 2CEAA 2D1YA 2NVWA 5KMGA 1G5TA 1WF6A 1YHZA 2PX0A 3IHWA 1IZ7A 3DMFA 3KCQA 4PYOA 4C1BA 2Q6KA 2V7PA 3S40A 5AW3A 4E2ZA 1ULBA 1YNSA 1ZRHA 4XWTA 1QDEA 2G17A 5MN4A 5CUQA 3BKWA 1UFRA 3V00A 1ZVVA 1QUEA 4O4JA 1Q11A 1IBSA 1QTNA 1RVDA 2WU0A 3ANTA 2FRXA 1D07A 1FW8A 1AF7A 3EGCA 4LCEA 4MRRA 4BAZA 3IQZA 1U1IA 4ZGGA 5LKRA 4QUIA 5CCBA 1JLLA 1JEDA 1KI6B 3V8EA 2YX1A 2PV7A 4J3JA 4EB0A 4MVJH 1WU8A 2ZYVX 3AKCA 3N05A 2A8YA 1LW6E 4O4LB 1XXLA 3N07A 4D97A 2VAXA 4F72A 4BV2A 1US8A 4GSYA 4AW9A 5H3LA 4RJTA 5ITZA 4NU6A 4R1TA 2ZRJA 2RGXA 3DP7A 2V9PA 2YV4A 2ZR8A 3FFWA 2IXTA 4I6EA 4Q66C 4RK6A 4CR8A 3TMKA 5AFSA 2F62A 4UEOA 4KAFA 4Q1BA 1IEQA 3KQYA 3LUHA 1RAAA 1WU7A 4MS4A 4E5SA 2JLVA 1Y7TA 4YAGA 3H13A 1OFGA 1ZJYA 1E2HA 1F8YA 3KQTA 4MP6A 5CDFA 4D9FA 4KAJA 4RHCA 5JXIA 3H83A 1DIRA 1GEEA 4DQLA 3GCXA 4TKLA 1SBCA 3B6KA 2JDIA 2YINC 3ZZ1A 4JJFA 2JAOA 2VK8A 5JUWA 1C9KA 3WOVA 1X1TA 8ABPA 2OCDA 1CY8A 2GN6A 4YREA 4AM8A 1VIAA 2XE6A 5JNTA 4D4KA 4ZGBA 3ZCVA 5TQ0B 3JR3A 4I1OA 1BN7A 4EJMA 4IX9A 2ZJYA 1XJCA 3ACBA 3GP5A 3RVJA 2RD2A 4QRDA 4TV8A 3JQCA 1XO1A 4MVJI 5D87A 3ZOKA 4EQ6A 4F4UA 4R2MA 1OX4A 3ZJ4A 3L4SO 4R2XA 5HQJA 3TQQA 4YRIA 4M55A 3KZ1E 3Q5DA 1RBYA 5LLSA 4H27A 2XKAA 4HCJA 4QD3A 4UZEA 3TZEA 4ETNA 1QHYA 2LP4Y 3ROKA 1CZNA 3AEQB 3G8DA 2PT9A 4OBWA 4H7DA 2R7LA 3RFCA 3RTAA 5A9RA 3SWWA 1H6BA 3O3MB 4I1RA 2GJ9A 4PSVA 3MUEA 3JVDA 3JYNA 4IIBA 3SFZA 1GPJA 3EPPA 1P6XA 3VC2A 2DQYA 4BFUA 1V5EA 2ORED 4UVEA 3PKJA 4ZHQA 5CLLA 1NGSA 3F96A 2YVAA 4WERA 1Y5LA 3CISA 3ENQA 1BMFA 1R5OA 3DO8A 4N4AA 2GRAA 4BLOA 2PEYA 1VE7A 3JVEA 1VM6A 2V5AA 1ONOA 2W2VA 4J4TA 2FWJA 3RO7A 3FPSA 1PWXA 1Q20A 2EKDA 2CL0X 4ZO4A 4BBJA 2C82A 5JANA 2YFYA 1O9BA 1FRQA 3WBBA 4PQRA 1EVJA 1T0PA 3BTVA 4UPDA 2PLFA 4CL8A 1X14A 2NYVA 2WKRA 4FJ2A 5EWJB 3VC7A 4B3BA 3K8QA 1Z0DA 3HMKA 3GLFE 1R9JA 3D7KA 3JYOA 1P7CA 3KUUA 4BNWA 1JU9A 2IUYA 1EDEA 2QQGA 3KVRA 4HDRA 4LHSA 4YRCA 2AFIB 5TJ9A 1L7VC 1O5OA 2CLCX 1D8AA 4QYMA 1K5HA 1SVNA 4X60A 5KJ1A 1IVYA 5TC4A 1JFFB 2GWRA 3ZWOA 4E4TA 4MYUA 3DAHA 5CXUA 3L01A 2DWPA 3HKEB 2F7SA 3MAJA 5CT4A 5EYPB 2X0NA 4Z3KA 3KUCA 4BKMA 1EEXB 2CCJA 2PBLA 2X5KO 4EPVA 4YP6A 1SBZA 3U61B 5E2BA 3OE7D 3A1VA 3CSUA 2GX6A 2E82A 2Q4BA 5TE9A 4EUEA 2B6NA 2GKGA 3OIWA 2WWVD 4DDWA 1TT5B 2PGLA 1B23P 5FBZA 3DE5X 3PUVA 2JD2A 4KXQA 5FR2A 5BSMA 4MGZR 4GQAA 2VRNA 2XYRA 3DVLA 3VX3A 1Q0PA 1DDOA 1T2EA 4FNOA 4YXWA 4C20A 3EVCA 4BX8A 3AVQA 3M4YA 3EZNA 3IIIA 3D02A 4LF5B 1KVSA 4UKDA 5KTRA 2HEGA 3IMFA 3LW7A 4OLFA 1ORWA 4PU0A 1M0EA 5LYJA 3T7DA 2YNMC 4N3AA 4B5KA 4LNHA 5T4HA 1E0DA 5IRCD 5U4QA 1ZH6A 1W94A 4KWEA 1EDBA 4QPNA 2POCA 2UZ0A 3QYAA 4MWGA 2CLLB 2JLSA 4YX9A 4WBNF 2PD6A 1N5JA 5E4TA 2Z6AA 2C5BA 3HYRA 4F93B 4MCHA 2IBTA 4DCCA 1EB8A 4NL4H 4ZQIA 4CKEA 2C7QA 3AY3A 5ENZA 3BGSA 2YHBA 3RS7A 4RY2A 2GZAA 4LCJA 2F17A 3L6EA 1SIWA 2QZ4A 5DT9A 4E94A 5C8YA 2GWHA 1ULZA 3AUKA 3EGDA 5IVDA 4FNMA 4X1IB 3TLJA 1I2AA 3PYLA 2C78A 2WKWA 1YR7A 1NC3A 4RVHA 4M1KA 3P9XA 4UUAA 2JZNA 2V55B 3GBPA 4TV9A 4F6RB 2A9RA 5I8PA 5A06A 1GPWB 2AF3C 4NE9A 1W52X 3PQ5A 3UWPA 4EFNA 3DV0A 1UCFA 1ZI8A 2H9IA 4NP6A 4IIJB 3ROZA 1UF9A 3EXEA 3P0JA 4JVSB 2RHJA 3STHA 1WHSB 4FFPA 2YUTA 4RMIA 3MGBA 5HZMA 5LDHA 3TBHA 2OZEA 2R1VB 4HYYA 4B6SA 1F8XA 5E8RA 2C8KA 5LQDA 3BK1A 1UP6A 2GF0A 3K1TA 5DLPA 1LPPA 1WDTA 1BMTA 2QSYA 4LISA 4R69A 3VU9B 4XRRA 4DSUA 3CT4A 4NZYA 1OZGA 3BIOA 5LR6A 2CNLA 3AFIA 3KFXA 3RARA 2Q3EA 2HSZA 4A15A 2YJ6A 4WY2A 1I4LD 4OP1A 2I6TA 2W22A 2FDRA 2XX3A 2HBYA 3I28A 1NM5C 4GZ6A 1CE8A 1ST2A 4E1BA 2HR1A 4YP7A 1W75A 2EZ4A 4IJKA 1EVKA 3IHTA 4EMBA 4BMZA 4LX8A 2PTGA 1VCHA 4B3JA 1S2DA 3EMVA 4XVUA 2IH2A 3KZKA 3SVZA 1RRGA 3LH5A 3CIFA 3MG9A 1Y3DE 3P5SA 4UATA 2BHLA 4MW1A 1BDJA 1FNCA 3FPAA 3L7YA 1HM5A 2GPWA 2KBEA 1KJYA 1E2DA 2H52A 3PENA 2PM8A 5B30A 2IDZA 4J7AA 5AJYA 3E58A 2RB5A 3WGKA 5A3RA 5JWOA 3SSNA 2G77B 4X94A 3P9CA 1NURA 1L7BA 4B85A 3R6TA 4CTJA 4Y18A 4CW7A 4CCSA 1V6SA 3BT7A 1F3LA 3H0CA 3HE3A 1E2IA 5B57C 4DR4B 4AY6A 2AI3A 4YJKA 3GLGB 2QS9A 1QYWA 4IJMA 4BNHA 5BPFA 4MV5A 3EXIB 1GZ7A 3RAEC 3GUHA 4JVNA 2IU4A 1NUTA 1KETA 4LAFA 5ALOA 4RLHA 2I22A 3M5CA 4J0QA 1NLYA 4N9QA 1FX0A 3AVWA 2OYRA 2WKSA 4DGQA 1UP4A 2WSYB 3ENWA 1X1DA 3FZQA 3U3XA 2EGUA 2IY8A 4KJXA 4FKBA 4I6JA 1WY5A 2GBPA 2ZU0C 1T8TA 3E3AA 1SCUB 2VEOA 3NAMA 3OTWA 4YV1A 1QP7A 4IIYA 4NFYA 1YK0A 4LTNA 1GTZA 3OSZA 3TUZC 3W6PA 3HZHA 5I51A 2QW8A 5H16A 1Z7WA 4CGZA 4PHHA 3SIWA 1I80A 1WE2A 3CNEA 5JALA 3KU1A 4V03A 3TECE 3H2YA 4PAMA 3WK5A 4I55B 2NACA 2QU8A 3B3FA 4ZGWA 3R0QA 4M88A 4PEVA 3K0CA 2ZBGA 2PUHA 4BFCA 2Z56A 4MA0A 4CTOA 3V2UA 1XRNA 1RWOA 2FPPA 1KAMA 3UJ9A 3MELA 4LJ9A 4WOJA 4H7IA 5KDDA 2ZB4A 4DWWA 3IPCA 3AERB 3IAS1 3UHFA 4NCJA 3AMVA 1TM1E 4HTFB 4PZ0A 5IARA 1W1WA 1E9SA 3A3OA 4L22A 4TKUA 3RRFA 4EVIA 2REBA 4PAGA 2XYHA 1COZA 2QPTA 1LBSA 1T3GA 2WF9A 3LT0A 1IJEA 2W71A 1H9BA 1I4DD 4ABTA 3AB8A 1ZVMA 1HH4A 3MIZA 1HTTA 2A9QA 4P4SA 4XIFA 1TEZA 1UWCA 2O2ZA 4CEHB 4LG1A 1BEUB 5G4KA 2GFQA 4W82A 2RCNA 1X80B 2N1BA 2FWRA 3IB6A 2AN9A 5HF9A 1ODLA 1P1JA 5KPJA 4Y6OA 3ZE6A 2WSMA 2WZBA 3NC1C 2JGLA 2R5WA 4JQYA 4KTTE 3ZR4B 4M86A 2NTJA 3RU7A 1RZRA 3WLLA 2DUJA 1PFQA 3WAJA 1LLDA 4Y2YA 4LRWA 3DEJA 2OFFA 1LC3A 1ZQ1A 2AK2A 5CLFA 1RI5A 3NDBB 1P72A 2X42A 1U6IA 4K0KB 1ZHHA 3GGPA 1M1YB 3W8FA 2B8WA 2J9ZB 3EDRA 4RPHA 4ERXA 1C1YA 2OO5C 2QI9C 5KCMA 1G7TA 4A5OA 5IZ4A 4WZZA 2IH4A 4MOWA 3BMCA 3T3IA 1NLMA 3O95A 1D1TA 5HRAA 1J2TA 2CZGA 4P92A 2DR0A 1G64A 2GZ2A 2J48A 2JDID 2EHDA 3L8YA 4R3WA 5FA5A 3CZMA 4EUHA 2FVXA 3AJRA 1QQ6A 8ATCA 2G0AA 2JASA 3RUEA 3IFSA 3PBKA 4QDUA 3IAUA 1ONSA 4BLPA 4HAYA 4CMAA 4KQ1A 3IQWA 4HDNB 2C7BA 3AUUA 1UPUA 3KYIB 4HGPA 2XXAA 3YASA 1WLYA 1ZG3A 2L42A 4YJ2F 4CM8B 3S2ZA 5HIJA 2XA1A 1WABA 5JSYA 3UC9A 3WRYC 1IM2A 3DBOB 4K9NA 1N77A 3LGSA 2ID7A 4BNKA 3AVYA 1KZYC 5K4GA 1K63A 2BBOA 3HA5A 3EXFA 3EC1A 2J5XA 4ANFA 3LF2A 3LECA 3G5TA 3PIIA 2PFGA 1K08A 4FD2A 1FXWF 2GZMA 3HB1A 4FEYA 5FPPA 4O2BF 4KWIA 4F7DA 1YJCA 2HWWA 3ZV3A 3L06A 1JLKA 1BWPA 3OHMA 4DMHA 4HRVA 4HWPA 5HWSA 1VLLA 3FR7A 4QJ4A 4QXAA 5I5EA 1DOZA 3LM8A 3G3EA 2Z43A 3F74A 1UZUA 4M0CA 2OZPA 3UK0A 4DADA 3FVQA 1OYWA 4QLOA 3EPHA 4J0GA 1W46A 1BMFD 1FFAA 1XYVA 4EHFA 2ZJBA 2A0WA 3N7UA 2H4JA 2HTFA 1VHJA 2N0SA 1JA1A 4F86A 3QXHA 1ZSYA 1Z7GA 4ZTUB 2ZT5A 1BVUA 2JGRA 2ISCA 2MIIA 1S2MA 5CCEA 1G1AA 2F1OA 3NC4A 5EKUA 1UBGA 2CF6A 1KS9A 2GN2A 3FWPA 1XVVA 4IKOA 4OFBA 1ZM2A 4YCJA 421PA 1YF3A 3M8KA 2B35A 4MW2A 6ABPA 3RC9A 1E32A 2QMYA 1EGAA 1F20A 2LXNA 2YWCA 1Q1EA 1TQDA 2C9CA 3N74A 4S3MA 3B5IA 3JQDA 1LJUA 3HKBA 2WHYA 4IXTA 5ANRB 2NU9A 2Y0DA 1JI0A 4PFSA 3E35A 2X0FA 4WFIA 3SZGA 4AJHA 3KQKA 1SXPA 1IK6A 4P4TA 3WIOA 2SBTA 4QHSA 1OZ0A 4DS3A 4N3BA 2W0SA 1GZHB 5FR1A 3G2JA 4BMYA 2FCAA 2OLKA 3NHKA 4A8PA 3DD5A 3TRJA 1DCMA 4KNVA 3ESRA 4LOJA 3SJ7A 5F3DA 1EQUA 4OOEA 5IDQA 3HO8A 2SICE 4TZKA 2IUFA 2J6IA 3ROFA 1W19A 1M6HA 2HKIA 4QWWA 1TZ2A 4UARA 1EBFA 3VO8A 3FJOA 5IT0A 3T1OA 1NW8A 1F2TA 4BP1A 3IUJA 4N7MA 4J7CA 4NNOA 3ZDEA 3EGXA 4C3VA 4E5MA 1V2HE 3TX2A 1PNRA 1GCOA 5K0BA 4TQAA 4LHXA 2AFHE 4YXWD 5BSTA 1RJ9A 2YRXA 3L8ZA 5DU2A 3TLYA 5KSOA 3GR6A 2GJKA 2XGMA 1ESMA 1G8AA 4BO0A 2UZ4A 3BFVA 3L9WA 3UXEA 4O2AF 1FMLA 1N1EA 1ZCJA 2FE4A 1XF9A 2Q6OA 2Z83A 4FDAA 4HO1X 4R98A 1B0AA 5B3JA 3UEOA 4QZVA 4I1SA 2PO7A 2X77A 3HGMA 3QBEA 2VQEB 3RYFA 4NBTA 2VHUA 4AX8A 2BFDB 1NNEA 1E3WA 4W5QA 1JW9B 3F3YA 4J03A 2AUNA 2DY0A 4DQVA 1KQPA 4UHBA 1RRKA 1T3SA 5A6SA 2IPNA 2XNHA 2DR3A 3JV7A 1UQRA 2AQHA 3NIFB 1Q6YA 1K1EA 4TRMA 5EZYB 3VQTA 5G3ZA 3HJTA 1OGYA 3G2HA 3I9LA 3PXUA 1KTIA 3LP5A 5T57A 4ENQA 2BM0A 4ARBA 4B17A 3V97A 2PWPA 1L3CA 4FTWA 3U3ZA 1IHUA 2JBAB 1NI3A 2WIDA 1AO3A 1W47A 4BVHA 2FR0A 3L41A 4Q1CA 2BUAA 3GT0A 3FDZA 5JJCA 1OYVA 1QG6A 4DMUB 2XODA 4R81A 1XZLA 3OO0A 3QWIA 3G9XA 4RHXA 1VI5A 5BO5A 3HZOA 4YT5A 2DLCX 3LSYA 5AVXA 3OAAD 1TT7A 1UKCA 2AK3A 2AMJA 4B84A 1LK7A 2PPVA 1AQYA 2AEEA 3O21A 5ISMA 2L2QA 4RZ3A 1VL1A 4KRXA 3OKAA 2ASEA 4II2A 3T7TA 4EKYA 1IDN1 4PBRA 1VHTA 4MR9A 4D2IA 2EGGA 1M74A 3B5EA 3O3OB 4F21A 3C6QA 4I5GA 3U4CA 5BQPA 1DIHA 2YC2C 1C2YA 3A1NA 2QG4A 1OXUA 1UC5B 2VDJA 2VPIA 3ID6C 4PNHA 5IKPA 4QT0A 1GYQA 2MR6A 3TQHA 5ES4B 2WUDA 1HI9A 1EFDN 1E1MA 5AJXA 3LPLA 5BSUA 5FDFA 3USES 4B6OA 1IU9A 3NHLA 1OVMA 4GRIA 4KIWA 4LWOA 1PHPA 4R01A 4ETIA 1ZVJA 4BMSA 1DX4A 4WZ6A 1NSYA 1UPTA 1GQOA 3PDIB 2YXLA 1TFUA 3HXKA 1KVUA 4CIWA 2DUWA 1K9VF 2OC4A 5EL0A 3BMXA 1WXFA 1T9CA 1UC9A 2XTMA 4K88A 4L73A 1FVOA 1NYQA 5ALHA 5JBQA 3RUCA 1Q1NA 2AX3A 1GG2A 2IT1A 2J0VA 3KRTA 3UMFA 2BEVA 4EY6A 4D74A 5D1NA 3TW0A 3UAVA 1NVDA 2J3DA 2QN8A 2GDZA 2YFHA 1NMSA 3RC1A 2RIPA 2ZQZA 3UM9A 4Y2RA 1AZLA 1N34B 1J6UA 3AX6A 4KMRA 1M34E 2OE2A 3K30A 3FW1A 4GT1A 4O2RA 4PG6A 4XSVA 4YJHB 4L76A 5P8WA 5KU1A 4GM0A 5TPZA 2XZOA 2XXBA 3AETB 3ZZMA 1ZICA 4CM5A 1GCIA 4TXMA 3OUZA 4N40A 2PEZA 3ZD6A 1F38A 3IPLA 4M9RA 2PUVA 3NNSA 4RJ2A 4ESEA 1RMTA 5CB4A 5HX7A 2YXBA 2O0LA 3CUUA 4R05A 1PJSA 1BO6A 4PNZA 4WKGA 3UZUA 1T4DA 3CH5A 1DRJA 3IPYA 3BMOB 3GLHB 2FY8A 4K6GA 1XEXA 3AHJA 1Y4DE 1GZDA 2OM2A 4QYTA 4EGJA 2G1KA 2G83A 1R9NA 3OURA 4QJ3A 1ORVA 4LGCA 2NNWB 5ARDA 1CUUA 3N7TA 3PC2A 4ZQEA 1OXBB 3SS7X 1G98A 5FJIA 4BV3A 3IH5A 1I7SB 1U4SA 1HNZB 1Z56C 3UPDA 4O6VA 2QTLA 5EUCA 1E99A 4IX1A 1O6FA 3LDFA 3FDJA 3ZE7A 2RI1A 5E9QA 4WLEA 1TD9A 4B6QA 2DPLA 2W4QA 2I3GA 3W7VA 3T35A 4XASA 3WKCA 2ADMA 1S8FA 16PKA 3O7WA 4YQYA 1S3FA 3QVGA 1LDEA 2JLZA 1UBLS 3M34A 3VJMA 3SHVA 2PYDA 4ZOEA 2M6LA 1NAHA 3OO1A 1K97A 1PWHA 2AMFA 3ILXA 2PD4A 2G9NA 1PBTA 2I1WA 1IUOA 2OGTA 4K6OA 1KY4A 3TH5A 2XPCA 4ZJYA 5FH9A 1E6WA 1NJFA 5H83A 4ZA2A 5L7YA 1DEAA 3URMA 2QLJA 4OHXA 2P79A 4LECA 2PKCA 3QKWA 2R1UA 1NY5A 3QXSA 4L8VA 5JRJA 1AHNA 3HJUA 3OIGA 3OM8A 4YUZA 3K9LA 2PR2A 1VYUA 2Q1XA 3MK31 1DJLA 3FYTA 3DB2A 1E3SA 3Q3IA 3VNBA 4LNUA 1X7HA 4QGGA 1S3GA 3RIXA 4BB0A 2CWDA 3DTVA 5BMVF 2WJYA 1T8SA 2Z5LA 1V6AA 1XA0A 2QUIA 2WTXA 4F3RA 2P9QA 2WFLB 2XI4A 4WNYA 2J3EA 1Q7CA 3EPRA 4KBYA 4NSNA 3DLTA 4A26A 3NTOA 2NZUG 2OHXA 1RZRD 2NG1A 2W6CX 2H2IA 3GGGA 3KR9A 4Y2UA 2GEJA 3I5UA 4FFRA 1L7XA 3LWBA 4MV7A 3PC4A 5JNUA 2RHWA 1JHZA 2PZKA 3C74A 3EG9A 4IQ4A 2PJDA 3QFCA 4Q37A 3K5WA 1SCJA 4UQOA 4D46A 2G09A 3SQNA 1ADGA 3WRWA 2VDMB 1RU3A 4Z0NA 2FG6C 1NJ8A 3N76A 2WD7B 4XFJA 5ER6A 3SDSA 1JFVA 4GZLA 3QV1A 1GUBA 2VOJA 1VPTA 4EFLA 1VRCA 1CVRA 6YASA 1CQZA 4B2YA 2WPDA 2O5VA 2Z0MA 2WIJA 4CM4A 4P3YA 3EEOA 1YBAA 5HZGA 3IIMA 3VKUA 1Y9JA 4NG4A 2Z30A 4CIYA 2YIVX 5JCZA 1FBTA 4QUEA 4MYCA 1NY6A 1QONA 1C30B 1CHNA 3DTTA 3LFHA 4ZJUA 4CTMA 4X97A 3EA0A 3SBDA 1C8LA 3M1YA 3SXUB 4FHDA 2MMGA 3VZBA 1JNYA 4H4EA 1HZJA 4I36A 4PN3A 3DYVA 4FWTA 3L1KA 2AQIA 3D6JA 2HJRA 4JYCA 1LJ8A 1FSGA 1SZCA 1VG9B 1YIDA 2JHGA 1L5MA 4GOKA 4KN9S 1WW2A 1TVKB 3GGOA 4NYIR 3RANA 1OWPA 4M89A 5C8DA 1PNOA 3T3NA 2BFCB 2YV2A 4NE7A 3TJZA 1GGMA 4KYVA 4CKCA 2WDZA 3O38A 4EB3A 2UZ1B 2PQMA 4JBYA 3P0RA 2FPRA 3UMSA 1K7CA 3LKBA 2UYOA 3KX2A 1Y7HA 3ND9A 2PZ8A 1OJLA 1PHRA 2GRJA 4R2KA 4JB8A 5JO0A 5EWLB 1TQHA 2I3BA 3JQ7B 2PSFA 4R9RA 4MGHA 4P3OA 2QP4A 1WMBA 2FPIA 3L79A 2E5FA 2VRCA 1YHYA 3LO8A 4IXDA 4JDUA 4YRTA 1UJ5A 4E7OA 1N6LA 4PPQA 3VSBA 3ZCUA 4WADA 1H1LB 3DDCA 1WB9A 4YWHA 4WK2B 4LTDA 2X15A 2OA0A 5JPIA 3RTCA 4ZK2A 1TVCA 3OPNA 1R0BA 3CPJB 1UZAA 1P0MA 3OSUA 3V7NA 4JL6A 5SY9A 3UJCA 1DXYA 4URUR 1L7EA 3P2MA 4J9VA 1M2VB 3OEEA 2C94A 1K3UB 2CUZA 1ZMRA 3FLMA 1C7JA 2HRZA 3NHZA 1TUEA 2JIZA 1BW9A 1W2GA 2VH1A 3EIOA 5IKOA 3VZSA 4OI0A 4JP3A 3PFCA 3OPXA 3UAOA 1JZTA 4EECA 1TL7C 1RRPA 2ZTVA 1H0RA 3W34A 2FZGA 1DFIA 3BGWA 2BBTA 1SD1A 1G2PA 1EX6A 2FPMA 3K0BA 3S7TA 2CB9A 1DAGA 4Q7JB 5KNDH 1FMTA 2WRZA 2ZSAA 5A5EA 5F9FA 1XXHA 5GJCA 2Q4TA 2QG6A 4X54A 3I39X 3EXHC 3ND7A 3JVIA 2X4LA 1I0LA 3STWA 3NANA 3TSAA 3SNKA 2J7PA 3F4LA 2VDQB 2GD2A 2WWIA 5KOHA 5IJ9A 1B00A 4MXDA 3UUWA 4Z4GA 2P9BA 2ZANA 1U2DC 1GQFA 1SKUA 4ZIRA 4I0WB 4DJAA 2P0EA 3PHCA 2D7CA 1KI1A 3IXMA 4HQRA 3AP1A 2FEAA 1OY1A 5AUPB 4DV4B 1PNTA 1TQ8A 1HNWB 2AG8A 2W2MA 5JAIA 3I72A 1XEWY 2CFCA 3EUWA 4DLWA 1L4EA 1PTKA 4RQTA 1DWPA 5A1JA 4HAUA 3R9IA 4M9XA 2WKQA 1SK9A 1P9WA 1N2BA 2JIPA 2OUIA 5EAIA 1JEYB 2PKQP 2HA3A 1TTTA 4FE4A 3CNHA 2GS9A 3USZA 4IUYA 3LY5A 4GGPA 4Y7CA 4AL4A 2VC2B 2JGKA 4AQDA 4EHIA 1SULA 3SD7A 1DIGA 1QC5B 1PVVA 1O96B 3IDSA 2BCGY 3CVJA 2HIGA 1Z6GA 1NJSA 1GCUA 1YONA 1FLVA 2F2TA 1J1IA 2DWOA 5BV0A 1AGYA 1L7RA 4C0WA 4HUTA 3OQOA 1V1RA 2P9JA 4DANA 2R1TB 3ND5A 1UFOA 5JFOA 1CG6A 2ALJA 5LP1A 1HEYA 1ECGA 2WYHA 1TZJA 4H6WA 4ZVRA 3C1TA 2X7JA 1Q7BA 1Y34E 5B2FA 4KPUB 3BK7A 4U2GA 1MXFA 3D64A 4UTVA 5FNZA 4F5DA 1N57A 3A2MA 3EN0A 2P8SA 3DQQA 1R8SA 3FPBA 4FMBB 4J3FA 1GNPA 4MI6A 4AFNA 4C2AA 4II3A 1QCYA 2XEXA 2Z8ZA 5K3OA 3A6LA 3GH3A 3LY7A 4K9OA 2WLTA 3K2BA 2W93A 2ZS8A 4Q01A 1QWOA 3M89A 1MW8X 1EXDA 4EJSC 1P19A 3W1EA 2QD4A 5LP6A 5K3FB 5GINE 4G0QA 3FN4A 1S8OA 3FUWA 1A9ZA 3QLUA 4O4HA 5A04A 4KXFB 1DG3A 2GEDA 1Y9ZA 3ITEA 3RBAA 1XDUA 1YACA 2BFFB 2OQRA 3OKFA 4MZDA 4R7TA 1U5AA 2FF5A 4OP2A 5LA6B 1P2GA 4DR1B 3A6EA 1P0FA 4MRNA 3IEPA 4RIHA 4CQJA 4UQPA 3BCRA 1IOVA 1O4WA 1GTL1 3IBYA 3O94A 3O2NA 3V2HA 3LWZA 1ZIXA 3CUYA 1ZJWA 2FDCA 4Y0NA 3UK1A 5HJ5A 1E63A 3VGJA 3CVVA 3N2GB 3OWOA 4D3YA 2HX1A 3Q0TA 4K9MA 1N0UA 4B3HA 1B16A 3IIEA 1KJQA 1YQXA 4CU5A 1FP4A 5FLEX 4WNAA 2O8CA 1P80A 2G0TA 4PY2A 1LF0A 1ADCA 1NN5A 2JGJA 3CURA 1SQGA 1E4EB 4FVTA 5ALIA 4ZI5A 3KWMA 3W5HA 4PQFA 3PZBA 5HM6A 1R8YA 1SQFA 1XVUA 2BEUA 2JLRA 2W7TA 5DHFA 2HJGA 5ARCA 5TPZD 3T9FA 3ZCQA 4EUFA 1FSZA 3H7IA 1BRTA 4W1QA 1CZHA 3RRXA 4C7BA 1N1DA 1JFTA 3D5EA 4PLPA 1DMSA 2Q2WA 1R0RE 2QW0X 4DLXA 3JU3A 3JQ9A 4L4YA 3MWLA 5DBGA 4QXPA 4X6LA 2ES4A 3TCNA 1IEVA 4C6HA 4TLAA 4BIIA 1U2GC 1C14A 4LOLA 1HEUA 2G80A 3NBFA 1JU4A 5EQTA 1R0KA 2OG1A 3OD1A 4KB5A 3A2NA 3FAKA 4MKFA 5KVCA 5I7EA 3KJIA 2COUA 2XE4A 3ZU5A 3QX3A 1PLLA 1U3DA 3X1YA 3WGVA 1V3QE 1QVAA 2CXUA 5L3SA 4YONB 1XFDA 3CF4G 1RVV1 2ATVA 4QYSA 2XRMA 4TLEA 5EMNA 1UBOS 3BMNA 1SC9A 4U9IS 5F78A 3IPAA 5F73A 1D4AA 1UOEA 2X9VA 3TE6A 4YBRA 3WK6A 3ZV6A 4EY4A 3GZTB 4YCCA 1A9RA 1O2DA 1JQEA 4RWZA 4RESA 4ZO9A 5DWDA 5GGXA 2QBYB 3S7ZA 3IR5A 2FP4A 3AFHA 3VRHA 4YCNA 3DCYA 2OVFA 2XQKA 2X86A 1RPTA 5ITVA 2VG8A 1EGVB 4NU5A 1UIRA 3AVVA 1FUEA 1LFAA 2JFFA 5JJBA 1P81A 3CLUD 2EJBA 2Q3HA 2PNJA 1L2TA 2OFWA 1IJKA 1Z17A 2B7BA 1KH1A 4BE4A 4MMYB 4ENVA 5CDGA 3BD8A 5AJHA 5K01A 3P5BA 3CZAA 3QA3E 5JNSA 3JALB 3MIIA 4LC9A 1XX6A 3MJRA 5A9TA 3AIOA 1K6IA 1SC1A 4XYEA 3LDUA 5FI3A 3GZ4A 3WWYA 1A9XB 2PMCA 2ETVA 4LQ4A 3BJZA 1INLA 5C5DA 2EFYA 1E7MA 3RK4A 4B6JA 2AOVA 3IR7A 4TTQA 1E7SA 3QU9A 2CHVA 4F9TA 1HSZA 3DTVD 4MJLA 4QJIA 4FOPA 1JBKA 1KA9H 1WNTA 4FR2A 3ZHUA 1Z75A 1U81A 5JADA 3WV5A 5HNKA 2D3TA 1AN9A 1HG1A 2LGJA 1H85A 4AO6A 2EAUA 4FWBA 4BRSA 4L4UA 4AZVA 2I6GA 5DM2A 2HRDA 4EG6A 5JU6A 5K8CA 1DJNA 3ZTTA 4M6WA 2DERA 4DPLA 3WLMA 5KWVA 3VPBA 2C00A 1E2LA 5DGDA 1YTLA 1IUKA 1NF2A 3FPGA 3NB0A 5I3CA 2IU0A 3ZK9A 4XR4A 1O9GA 4B9EA 1PJ2A 2TMGA 1MB0A 3PFWO 1CRWG 4V3BA 2MWMA 3KKLA 2IBSA 1QMPA 2CLDX 2WPDD 3UMJA 3BL5A 4UPEA 2IYLD 2FXVA 2Q9CA 1S7CA 2VXOA 1S2LA 1SXJE 4KR7A 2AB0A 1GM5A 4AS1A 2CEKA 4KYUA 2G67A 4H08A 4JLSA 4MICA 4RCZA 5JY1A 2W70A 1ZK1A 4NVRA 1QDLB 1X13A 5KREA 5C46F 1HK7A 1W0KA 2Q5OA 4G37A 4GXRA 4Q18A 5EXDA 1KWKA 3OPYB 2Y66A 4ZQBA 4GMDA 4RE5A 3LQYA 1CR6A 2QLMA 1CNFA 3FYUB 2I54A 2FETA 4HN4B 1E3JA 1I6LA 3G1WA 4HL6A 4GPBA 3B9RA 4WQMA 4WXEA 5KTOA 1ZS9A 1UMDA 4DV5B 4LOAA 2HUPA 2FSIA 4TXHA 1EM6A 5C7YA 2O05A 4M1MA 5CLHA 4QLBA 5DHUA 1ZMBA 3MPOA 3SICE 3DHNA 1H1TA 1LF5A 1SURA 3KB1A 1Z6ZA 2ZGVA 1DTEA 3RUIA 1H65A 1WUIS 1TTHA 3GRVA 2HJ9A 3JZFA 1ZGJA 3QVKA 4QNMA 4R5MA 4GC5A 3SNHA 1E5QA 2JLCA 1GN9A 1PU2A 4R2WA 4B09A 4B8WA 3H18A 2WMNB 4D9CA 1LBQA 3OPVA 4BFSA 1KORA 4M9ZA 1U11A 1SH7A 4BMXA 5IT5A 5LMCA 2VPZA 3S5JA 5IS2A 5CCDA 4MPRA 3RUAA 4QEDA 2QN9A 3V33A 3PSAA 2Q3JA 4BWGA 2VRCD 5DTMA 3GBVA 3HB0A 1TMOA 1HL3A 4LSGA 4JJZA 1SBTA 3GT7A 1ZK0A 1P73A 4P3NA 3UV3A 1EBUA 3OA2A 4DV0B 1WULS 3KPWA 2RGWA 3TVTA 4FHZA 4PYRA 3F6RA 4D3ZA 2Q27A 2RC5A 5JDIC 2CMGA 2CXRA 4FFNA 3U3KA 1VDZA 4JQZA 2B36A 4RC9A 4YR7A 3KKMA 3ZU2A 2A3RA 1Z4OA 3V1NA 2C5AA 1E5VA 3OEED 2ZYTX 4R2IA 1TIPA 2MU1A 1RE0A 4HDMB 4ZT2A 3DE7X 2JIZD 2WAYA 3BXXA 4PYLA 2J87A 2HMYB 4A03A 1TVEA 2O8VA 3EZGA 1KEWA 1QNFA 4RF3A 1M1XB 5M2QA 1E9FA 4JXXA 3MJ4A 1ZPDA 1BA2A 1Y6ZA 1KAQA 1NR7A 4WASA 2A84A 2VXBA 4ND5A 5C5EA 1DTWB 2VK1A 4AKHA 3DOCA 3IP9A 2HADA 3P9IA 4HDSA 1UOPA 3Q85A 2V6FA 1CZOA 1B93A 1XNGA 2V8OA 2IIPA 5ENVA 1L1EA 4J7UA 1LVHA 2J7PD 2UAGA 4H31A 4NYMR 4Q6WA 2R8OA 2VDLB 4MKZA 4MQLA 5HPYB 1XN1A 2GVNA 2ZBVA 3MMNA 2PUBA 2N9UA 1XVIA 3GPDG 1P7PA 3HN7A 2VJCA 5H0IA 2HHAA 1JX6A 4ALNA 1IHPA 2XOXA 3BULA 4ZDWA 1U8CB 1CEYA 1P0IA 4E08A 5BPHA 2NQ8A 3TAUA 4KVZA 2PG3A 2BTQB 5CBPB 4HXEB 3D8HA 5AM1A 4LRTB 1SQ0A 1YCGA 2EV9A 1MJGA 3ZIDA 1UPAA 4W6ZA 4ZT3A 3ZGNA 3U4GA 3JZMA 1MCZA 5JEDA 3QKIA 3GYGA 2XRYA 3GQBA 1PJ4A 2C98A 3JX9A 4V2IA 2AXQA 4MVCA 2IE8A 2BR3A 4H7EA 8GPBA 4RTOA 4BFWA 2JLAA 1GZUA 3BEOA 4AYTA 3C7AA 1AC5A 2AOWA 3CX7A 4DLNA 2Q7DA 1W5FA 3DCJA 4URVR 3ZUPA 5T4EA 5KX5B 5EHIA 2FGJA 4OLJA 3VO2A 4IKEA 4C2BA 2OSBA 5K8JB 4NEGA 1OH5A 1KFBB 1MDFA 3RW9A 1IE3A 2WU4A 2REQA 3B51X 1H42A 4X6YA 5ALUA 3TXAA 2B7CA 1B8OA 1K98A 1CNEA 3C3CA 4PICA 3T1TA 4M53A 2OXTA 2WZQA 2WJPA 3AW8A 1R10A 3EC2A 1XHFA 2CCGA 1QWSA 1BXRB 1G6HA 4DLSA 3EXG2 2A67A 4OQYA 2C9YA 5EVCA 4U2KA 3KOZA 5UKDA 1FXSA 3MMPA 1LV8A 1XP8A 4DA8A 4JT9A 2DCUA 1PEKE 3QU2A 4JAVC 5T6BA 2F67A 2GZRA 1B8UA 1JBEA 2YW9A 3G0OA 2FF7A 2GXUA 1CLUA 2YJNA 3DPSA 4RNCA 3U3JA 3WIBA 3EZ2A 4P32A 1N2XA 1XRMA 3PNVA 3U4HA 5F7XA 4UNQA 3FG9A 2WC1A 4J16C 1MOZA 4F8EA 4C0HA 4ZTZB 3KEOA 2Q1WA 3PPVA 4NC9A 4OHBA 4UVDA 3F67A 1C3LA 2GN4A 3MWDB 3N86A 1IDOA 1O6BA 3AFGA 1GA4A 4G4SP 4JOBA 4ZU1X 3AUXA 2VQDA 2A1TR 2PA0A 3DWIA 3RSQA 2WTNA 2XIQA 5I4KA 1RPAA 1OX5A 4XTRA 3B1JA 3PRYA 4OX9Y 4Q3DA 1D2CA 4NLLA 5BR4A 3OTGA 4OQMA 4RV9A 2VCEA 3GH1A 4U3JB 4B79A 1BQEA 2P9TA 2RBGA 4PS0A 1U28C 4R6WA 3I6MA 1E3DA 2CDAA 3QKSA 4CDNA 5AKGA 3P0IA 3UJ7A 3EUFA 2WZCA 1KARA 1SPBS 5TJHA 5IJ0B 4H1VA 4UNIA 1YGYA 1L5FA 5AK6A 5E7QA 1NW7A 2Q0HA 2PPLA 5K51A 3BDIA 1YNOA 1C3OB 1MQ8B 1OYOA 2OGSA 4V0OA 3VAYA 3AHEA 3F8TA 1NJ2A 4NJEA 1KDOA 1L4MA 2BE7A 4FZ3A 1I7NA 4HPJB 4CG3A 4F0JA 2VAPA 4LHYA 5FOXA 5K4AA 1ZU4A 3LKVA 4ZODA 2W8BB 4NS1A 3KUKA 3S44A 2I3DA 1E18A 1RRFA 2JHAA 5ESWA 4H4CA 4JASB 3PNBA 4K6CA 4UFNA 2VF7A 4OHZA 1NYLA 1TVMA 3U4QA 4CG0A 3THYA 1E1YA 3ORYA 2IYZA 4KFSA 1JE0A 4B3CA 4YALA 4BDTA 1RYHA 3M6VA 2QUKA 3AM4A 5CM9C 1ESZA 5M34A 3I5MA 5CFLA 2VTBA 1MA3A 3IYLW 5HMLA 4DSTA 4G0WA 1J8YF 1NX6A 1SM4A 5B53A 3WO1A 1A9QA 4RL4A 3HS3A 2XTNA 1Z4JA 1PJCA 4GEGA 4ZAYA 2FZKA 3UATA 3P0EA 4R9NA 4KQJA 4BMOB 4LRXA 1MXHA 3FHOA 3ICOA 4BLQA 1DUIA 2QL7A 3L92A 2X1MA 3KWFA 2G08A 2XDAA 2IXEA 3EZ6A 1OTYA 5EKTA 1MPTA 4J1NA 2IHNA 4OBEA 4B43A 4I4TB 1OA0A 4B4KA 2WJJA 1D1SA 1KFKB 2LNDA 4EKDA 4NH4A 2ACKA 3O1LA 1CJUC 2AF4C 2ZW9A 3H1GA 1JQDA 2X0RA 4C01A 2J9FB 3HNOA 4FMCB 4CL3A 1XZCA 4CMIA 1KOJA 4BUJA 2DSNA 3HJHA 4FFSA 1DLJA 1QZUA 4JGGA 2Q1UA 1N4DA 1NQOA 1WUJS 1R00A 1MP0A 1PKXA 4OFZA 3IKJA 4TMKA 2C2XA 1W0JA 2YASA 4A6XA 4OYRA 1KIMA 3AUYA 3W9SA 3ABQB 3OCJA 3HCBA 6Q21A 3RHFA 3PEYA 3QVJA 4AICA 2DTXA 4XTCS 2NX2A 2B2NA 1B74A 4PYIA 4TMVA 1Z82A 3UNXA 3B6IA 2DHEA 1HFEL 2Y71A 5HTKA 1JR4A 3W5VA 3BE6A 3W6ZA 1IUPA 3EEBA 3GMTA 3P2IA 1DCFA 2G04A 3HA7A 4JDPA 2YYYA 1YVPA 2QSUA 1NIJA 1W8DA 1Y80A 2XAAA 3IHLA 3NV7A 4U2BA 5C9ZA 4PZDA 1GTRA 3H1AA 3A0RB 1BVRA 3K0SA 3DMRA 4XEHA 3QUAA 3CZRA 2QAGA 2VA9A 1K7YA 5HS6A 1FP6A 1U98A 3HLTA 4HLUC 1E7YA 4CJXA 3KAJA 1AKUA 2HCRA 2OZLA 1T8WA 3L5KA 4HGOA 4ZAZA 1LVGA 1R6XA 1K8RA 2HWXA 3EVFA 4WZBB 5HK9A 1U90A 2H31A 4Q7QA 4WN9B 5GJVC 1G59A 2OVBA 4PNPA 4MUKA 4D45A 5CCXA 1XRJA 1CB0A 1GFSA 4EX7A 1U0EA 3F9IA 4W63A 5LCXA 2VWQA 2XZPA 2C4MA 1RWVA 3DUFA 3M2TA 1GSIA 1W0KD 3FCEA 4KH1A 4M7OA 4B75A 3ZI7A 1AA9A 2VHCA 4DREA 1VHWA 3ANYB 4AK9A 4IQFA 1WOMA 3JRXA 3GEMA 2DP4E 4KU4A 4RD6A 3GCGA 3BH0A 4ZVSA 1NDQA 3H4IA 1S96A 1UAYA 3VR2A 3L3BA 1J5PA 1K66A 3ORQA 4UVHA 3LX6A 1R9MA 1JEYA 1L5HB 2DWUA 1XGKA 3H9CA 3O84A 5IEBA 3HG7A 3L6RA 1RXWA 4HXYA 1GRRA 1V8OA 2P2YA 4XB1A 1D2HA 4DIBA 4YAIA 3HADA 3Q3HA 4JIGA 1Y7PA 1GZ3A 4NMLA 4PIPA 2WJZB 5JXJA 1T1RA 1XD2A 1XJQA 1FJXA 2FR1A 3RD5A 5I9LA 1OGJA 1H2RS 1NUSA 1QAMA 1RXCA 2ILTA 2ODWA 1QHEA 3QPWA 1L8LA 4OEHA 4R9VA 5LJLA 4G9EA 4QBIA 2GAIA 4CEIA 4DLKA 2QLFA 2IUEA 2I4NA 4YDQA 5FKJA 2BMDA 4QL3A 2FZCA 4BQEA 1ZISA 2IZZA 3ICWA 3NUGA 3I5YA 5DTQA 1CF2O 1MD9A 2Z1DA 3G88A 2ZVQX 2IV7A 4MLPA 3HYSA 4ATNA 4B1FA 4RTLA 3TLGA 3DYIA 1K0UA 3K5IA 1Z2EA 3TTTA 4IIJF 3LVQE 4YQEA 4KJZA 1ZW6A 2EL9A 5AVZA 1A72A 3GPCA 5C52B 3E0XA 2D0OB 4O59O 3C3MA 5EP3A 1D0VA 1N9GA 3SVLA 1T9GR 3CR8A 2F1KA 1GVNB 4JSTA 2V7XA 1T1GA 3L1UA 4AUEA 2CLEB 1DS6A 3Q6MA 3NAGA 1ZCFA 1KO5A 3T7JA 4U0KA 5KNCH 3N5KA 4K0RA 4IDBA 3VUEA 2VJNA 3UJ8A 1JJIA 1QGZA 3WZMA 4DLLA 3D6NB 3ZWDA 1CNMA 1M2OB 3S2IA 3L9XA 2JH8A 4MQ6A 5FV7A 1Q83A 3FUCA 3LOQA 5AYVA 4IXNA 5EPUA 5EJAA 3WYBA 1Z0AA 4FIDA 3UF0A 2XJ4A 1IFXA 2Q8PA 5LWHA 1H2EA 3R5HA 4L6AA 4MDYA 4IRXA 4OUDA 2XKJE 4PSAA 3RIGA 4J0EA 5EFZA 1OAOC 3ZE1B 4QKQA 2B4AA 4B6PA 3I37X 1C50A 1T5DX 1HDYA 2PR7A 1HPLA 2Y8EA 1HNNA 3EULA 1CQXA 3HCCA 3NLLA 4R6XA 4HJXA 4X8MA 3NVDA 1P9RA 4M46A 2DT5A 4R68A 3CEAA 3Q8KA 1P75A 3B9BA 1OAAA 2DVMA 1HT3A 3BB3A 3HJCA 3B78A 4KWTA 4H18A 1JMYA 1QKKA 4A6PA 3E3OA 2L17A 4W7HA 4RGVA 1NP3A 3ZLJA 1TYEB 4EJ0A 4ER3A 2P30A 1I6MA 2HV9A 1B1AA 1YR1A 4MUIA 2C2HA 4YMSA 2CUTA 2F3QA 3W7BA 4JBWA 2DTEA 1EHYA 2JLXA 1TM3E 1Q14A 1RJFA 1VJTA 2KHZA 4IL5A 1J8MF 5CA0B 3KG2A 3AINA 4MCJA 3DBHA 2J6HA 3DDSA 3WLHA 1GGNA 3LDGA 5LQUA 3VNRA 3D8NA 4DLTA 1TUBB 1NI4A 1GLGA 2ZBRA 1P9LA 2R1ZA 4G1EB 1X9GA 5FBQB 1KEEA 1QTRA 2X8BA 3WO0A 2EX1A 4EPWA 3HCDA 2J3LA 1QIGA 2UYCA 2C7OA 3WV4A 3WIVA 3Q72A 1TM2A 4BLSA 3LC0A 1BEZA 4EG0A 3H3JA 1FQOA 4B3XA 1U3CA 4S05A 4GSLA 4I55F 1IY1A 2AT1A 1UK6A 1TU3A 4B8ZA 4JJAA 3N28A 4MEBA 3U4IA 4RACA 2CMFA 3NATA 5F4ZA 4B7XA 2XBMA 5EVJA 3TI9A 4PYJA 3VHXB 4GW3A 4MV4A 5F21A 1Y5MA 2FW9A 1GGJA 2GD0A 1T6ZA 2HTEA 3O91A 3VV3A 2E5LB 3CVOA 2IK8A 2VWHA 3SDZA 2ZAMA 3KPJA 3INTA 1JLLB 3UANA 1IK4A 3R9KA 3FOBA 5BP7A 3I2IA 3IVXA 4YAFA 5JIBA 1FFYA 5AP9A 3LCJA 3U1BA 1JE1A 2LKCA 2ZRNA 1US8B 1TA4A 4HNRA 3EARA 4MGEA 1ZDMA 2D54A 2BGIA 3H2ZA 2I66A 2BH9A 1BD4A 2HMTA 4AKGA 2IYPA 5LUBA 4IG4A 3B6JA 3PXDA 3P45A 3RUPA 3A9CA 1UK9A 4XD7A 4L15A 5LMNB 5JATA 1PK7A 2VHYA 1XKXA 1SQ6A 2H2GA 2RGCA 1C0IA 2Z2XA 3FCYA 2QX4A 1KSFX 1NFFA 1C1DA 2BFWA 2HQ1A 4GP9A 1NQXA 4L50A 4XPZA 4I4IA 4Z5XA 1YQQA 3EC7A 3GJ6A 1QZTA 4QUJA 2NUPA 2ZRCA 2QZ9A 3RT1A 1BQ3A 3SYLA 4LPSA 1WQ4A 1R0XA 1IQ0A 1FDVA 1J70A 2QORA 2YZKA 3MRVA 3NWOA 4E5DA 1GCAA 5FV4A 2DFDA 2WAMA 4UVIA 4DKXA 1DZ3A 2WIFA 1PV2A 4RM2A 3WOHA 4NNJA 1U4NA 3BF8A 4RCVA 5TF0A 5FBKA 1W2WB 3HDGA 3VR0A 4BMVA 2VTDA 1NXQA 3SAJA 2NTVA 3ZYCA 2CVOA 2QQ0A 2WI8A 2X3UA 2I4RA 3F7MA 4GR9A 4QUAA 5EHGA 3CNQS 1I7LA 3PU6A 4EQ6B 2RONA 3KVNA 2SKCA 1K8QA 2PL1A 2UYYA 3R3YA 4MWZA 5BMVA 3R0JA 3ZY6A 2Q5IA 4YC7A 1RIIA 1VHDA 1LX7A 4KIUA 3LE8A 3VVBA 4L57A 3V4RA 5C7OO 4AMUA 1OKKA 3CX3A 4W9NC 2O48X 3MTJA 4FI3F 5LDGA 2M6RA 3QIVA 4ZMRA 2H7VA 2IEIA 3FTNA 3RS0A 1CDZA 1BGXT 3E23A 3LCCA 3OE4A 4XQ0A 4AN4A 1P1BA 1SQ5A 1OT5A 1MJNA 3QPCA 2NUTA 4CL2A 1RJEA 3UFXA 4QASA 4HZUA 4NBLA 2D62A 2BDEA 5DP1A 4YRKA 2QRMA 2JHFA 4L6CA 3GT3A 1ZD5A 3FNIA 1Y4SA 5GPBA 4DG8A 1JPNA 3R5TA 4EK9A 2GYWA 2V3VA 2ENWA 3GLRA 3LXRA 4GMFA 4AIRA 4DZZA 2OV2A 4F84A 2QR2A 5IN4A 1XNHA 1ZWKA 2G1AA 3V8PA 4EO4A 4EL0A 3GAZA 1GSHA 1XTBA 2AWOA 4Y2PA 2JIRA 1J0EA 2QRLA 1YI0A 2BKXA 4KVFA 5JY6A 1JA9A 1W0JD 4WDRA 5EHNA 4UUBA 3N2ZB 3IMCA 1G291 3FI0A 3V2IA 3C7KA 1M66A 1G8PA 2VJPA 4UE6A 5CDHA 5FBWB 4HQKA 2ZTLA 1I4OA 2Y1WA 3HFJA 3Q8MA 3ETCA 3M4XA 5EKSA 3VO1A 5EKXA 1XWIA 3PPIA 4H6PA 1C7QA 1IN5A 5C1DA 3I6QA 4FSXA 5EGNA 1BGWA 1KOFA 1JHPA 3I9V1 4ZCLA 1WV0A 4L6IA 3F73A 2JI9A 3WKEA 5LSAA 4F71A 2C92A 3EQ6A 3AESA 1ZGCA 2HCFA 3D54D 3GEGA 4J2TA 1DXQA 2Z5FA 3LQQA 5AQ1A 2WOJA 3ZE9A 3FRJA 3TCKA 4ARAA 2P3OA 1D6NA 4DQKA 4O0MA 3UA4A 1XK7A 5FWYB 4B6GA 9LDTA 2XEDA 3LRXA 1AKQA 4XM0A 4ZI3A 3W8EA 1U99A 3OCZA 3AFNA 1CRLA 4CLEA 1KYTA 5JXWA 1CFZA 1EFPA 3IDAA 4ND4A 3DAYA 3MVEA 3OLYA 2XWPA 4PLWA 1GGKA 5CDSA 5DNYB 1GL7A 1J8DA 1EFVB 4L27A 4NULA 3WLAA 4ACAA 4DPMA 1J56A 1M8FA 2H48A 4YDHB 4RFLA 4RFSB 3DZIA 1DWQA 3N75A 5B1SA 1SXGA 3DOUA 3WKBA 3HCEA 1C5KA 3IQFA 5KYKA 4GZMA 1GRNA 1LDNA 5DNCA 1VL0A 2H08A 4L3OA 2D0DA 3AF4A 3B2NA 4KZPA 2XB6A 3NV9A 5D3ZA 5FFFA 3ZWPA 5KNBH 3EXG1 3GFVA 5I9SA 4NV0A 1POXA 5JCJA 5BN1A 4XB2A 1JZSA 4MI1A 3VR2D 5EZYF 4YXFA 1Q1GA 5DHTA 2IC5A 1LSUA 4NF2A 2FSPA 5C8YB 3N0VA 3WIUA 3IAS6 3SC2B 3AEKA 3WHPA 3MZ0A 1QX3A 3GEIA 3T5PA 2IIBA 1IUNA 4B6RA 5F2EA 4KVAA 1EZZA 1XTIA 4EG8A 2X1HA 4TYWA 2TRSB 2VZ0A 3NT2A 4TV9B 2XJ9A 1X9IA 4LDPA 4PFQA 1UQTA 4CKWA 1NMEA 1J21A 4FFWA 4JCCA 4PZZA 3CSSA 3IAXA 3UFBA 2FFQA 1UWKA 4QOIA 3JYLA 3RF7A 3ANMA 2V96A 3A4YA 4R71A 4CLOA 3SLGA 4KPEC 1CQPA 2FFBA 3GAMA 5HBGA 3GWGA 1KC3A 2YJ3A 1Y9AA 2H2WA 5ALYA 2W2LA 3GVIA 1MB9A 1AZSC 3K7EA 1PT6A 3TW4A 2HQRA 1E79A 1II8A 1HWYA 2WE7A 3W7AA 1SHJA 3L7JA 1MJGM 3MM4A 3WMXA 3FMGA 3ECSA 1KO7A 1ZD1A 5GZ3A 3ORSA 3KXIA 4HGYA 4GGOA 4N6NA 1X2EA 3G2IA 3FYSA 3T3HA 5C3MA 3MHTA 1QYRA 1SUIA 3BC1A 3WMEA 2I4LA 3WQQA 3V7WA 1UFKA 4XGNA 2JRCA 4FGKA 5LQRA 2NVOA 1R4NB 2FH5B 3VNAA 3QK7A 2HJVA 4WFQA 5EMHA 5LBUA 4L9WA 4KV9A 3WX0A 3ZDCA 2PCLA 3MMXA 5DH9A 2JFUA 3KYDB 2A94A 1FVFA 4GRAA 2GAAA 4OKNA 3W78A 1CJTC 3UYKA 4JMLA 5IZCC 1ZN2A 4CHGA 3A9TA 2B2XA 2IQIA 3AM1A 2BF7A 1PT8A 1FXUA 3HPQA 5AM4A 5TARA 4L0DA 1LDMA 1AX9A 2O54A 3SR3A 4CMCA 2G9UA 5JSHA 2EX0A 3DM9B 3KR2A 3EDCA 1AU9A 3N6RA 1GKYA 3EGVA 4CIVA 4DMRA 2H16A 1WMAA 2Q5LA 3N1UA 4V02A 1R4MB 1SHZA 4JSRA 1NG1A 2RGYA 4F04A 1UEIA 2WNSA 3GRFA 3ZHQA 1E9VA 3ETJA 4Q5IA 4MKGA 3VR5H 1KOGA 4NY1A 5AJTA 4URXR 1Y5NA 5JFGA 2OOKA 2GXQA 2QVCA 1GQYA 4MKRA 1Q1QA 2O9JA 3ZLBA 5LD2B 1Z63A 1U0RA 2BVNA 1ZEJA 1HLFA 1BNCA 3OLQA 3RDPA 5K0GA 1J1UA 4K9RA 2GHRA 5C51B 3E0QA 5D6NA 3PT9A 1JAYA 5AVVA 5HW0A 3I23A 4G0ZA 1U02A 1N75A 1BN6A 1UH5A 4D43A 1PQUA 1NT4A 5JMTA 2O4UX 1YRBA 1P6UA 4NBSA 3THOA 1Z7EA 5SY4A 1KBOA 4BJ1A 3B3AA 4B45A 4BX0A 1P18A 2OPHA 1K0FA 1AZWA 3MCVA 1Y42X 2VPPA 5JW6A 4O08A 1QU2A 1GFZA 3SQMA 3W3AH 3IUMA 3S2SA 2V45A 1OI7A 3P9QA 4AYXA 4RS3A 2K87A 4YN3A 4YAUA 4L4SA 1G9SA 2P35A 5TMDA 5HUJA 1TJPB 4LZZA 3UMVA 3MFQA 3KU4A 4QSHA 3IP1A 1A27A 1ZNXA 4YWJA 3GBSA 4Z7NB 3FYHA 2FPPB 4ZFNA 3GN1A 2J41A 4JYZA 2EFJA 4D3XA 4F9FA 1ZFNA 3PPWA 4GPAA 1CC1S 4HAXA 4DQDA 3B85A 4FFBB 1TD1A 4MULA 4WCDA 2J5RA 4TKUB 3IUPA 5FNVF 4I5FA 4X6UA 5AH0A 3DL4A 4OI1A 3GLFB 1H22A 4RKEA 1E77A 1JQJC 2G9ZA 2YIDA 4CFZA 2B30A 2H2AA 4R8SA 1N8TA 1XA3A 3WYFA 4R2HA 2R6FA 5IKXA 4PX3A 5AVJA 5G4KB 2YL2A 2F8LA 3DVRX 1OB2A 4JI5B 3WHLA 2GCOA 2JD0A 1NMZA 2ZRHA 8AT1A 5FUQA 5K6RA 2ADFA 3QYPA 4W7SA 1KMQA 2FLWA 1QK4A 3MYYA 2LD4A 1Q3HA 2IXAA 2XT6A 1ISMA 2IPLA 3GRAA 3MA0A 4L72A 3QXGA 1XQVA 5HRCA 1XRRA 1DEKA 1U0LA 1ZH2A 4GX5A 5IBPA 1IULA 2V6IA 1SC6A 1G18A 1GARA 3BWDD 2O2CA 1XZQA 2XNDA 3CE9A 1L4KA 3E9CA 2VHZA 1XLUA 3IC5A 4WLFA 4YAEA 5WRFA 4A92A 1Q7GA 1QX4A 2ZBQA 1XL0A 3RI3A 5B2EA 1PQYA 1QOQB 1XF1A 2IYYA 2GSWA 4Z8XA 3TIIA 4MW9A 1W59A 1W73A 1JR3E 5C3UA 4TLMB 3U26A 1I32A 1H4SA 3GWZA 4N3CA 3WFZA 5A3VA 3GLIE 3NZEA 5T6MA 3IVRA 3O9VA 4RK4A 1D6MA 3JASB 4M98A 3L4JA 1Z8FA 1XTKA 2HJSA 2VHJA 3E7PA 2VHWA 5GONB 1RI4A 2H57A 5K3DA 3F1KA 3T34A 4G0OA 2XGGA 2XXAB 2ZRIA 1N3IA 2FQYA 1KIFA 4RXTA 1IHOA 3VGPA 5M29A 3RVOA 2WV7A 1FNMA 1ML3A 1Y1TA 3DW1X 3EYWA 3MT9A 4V0KA 4FEGA 4TTAA 1HETA 3IMKA 1XR3A 5F77A 4D9GA 4JXKA 4DV7B 1X8XA 2PNFA 1NBMA 4MYRA 4EJ6A 1A4IA 1AUVA 4OM8A 4K28A 3BF7A 3U9LA 5JXGA 1DLIA 5H82A 4KH0A 3IRVA 3KDPA 1GU0A 2PRJA 3QM1A 3MJHA 1OKKD 1D2AA 1GDHA 1Y48E 2A1IA 2ZAIA 5LMZA 2ANCA 3FAZA 2J31A 4KI0A 1P61B 3K0KA 4OQPA 2XBLA 5SV2A 4ZCIA 1PJTA 2M6KA 5KYUB 2WJIA 5HGXA 4D3FA 4I1UA 2C3PA 2W98A 4RELA 4UNSA 1BX3A 4EJFA 1C0KA 2HLNA 3REQB 3UWKA 3BX1A 4LF6B 1AMNA 1WOYA 1U3UA 2RAPA 4HDKB 1KVQA 2X0DA 4EFDA 4ABYA 3B48A 3U3MA 2VDWB 3NIBA 1ZA1A 2X3FA 5K3BA 3T1QA 1EP9A 4P84A 4LF9B 1CBUA 2QLNA 3U40A 3MAGA 3C3JA 3PGKA 2RHCA 1KVRA 2II6A 1BE6A 1BX1A 4TL9A 2P2CA 3BOSA 4C07A 5KBYA 4G0XA 3HKBB 3FNQA 1BMDA 2X6TA 1PO7A 1ZC3A 4BO1A 3CCCA 3JYQA 4Z1MD 3NHBA 4BLTA 4MGIR 2I2BA 4OIFA 2O3RA 2IVZA 4FR5A 3WG9A 5LQJA 5A1TA 2YICA 3B36A 1EXNA 4L0MA 4W7IA 1ZM7A 2HLDA 1ICEA 3W06A 4COKA 1MPXA 3G9ZA 1PGNA 1IRXA 2OCAA 4V1CA 1F0NA 2LZ0A 4AZSA 2EBFX 3HSSA 1OILA 3ZD7A 3T41A 4PG4A 1UADA 1KH3A 3LSTA 4ZZ2A 4GKKB 2BV3A 2V3WA 1IEXA 4TTTS 1P0QA 4ZOCA 2IOQA 4E13A 1GQQA 2A0UA 1UJNA 4U7FA 3LT4A 5DJ5A 3RAPR 1FB5A 2V8BA 4GI7A 5E1BA 1MJFA 5AW2A 5L3QB 3AHIA 4DXHA 2GTIA 2O06A 3O9MA 5K09A 1PWZA 1J7JA 2AE2A 2ERCA 3CGGA 1MBZA 3N2KA 5TMBA 3KQHA 4DNPA 4M0DA 1JJVA 3FMPB 2PRSA 4EVSA 4UD2A 3LP8A 4ENTA 1Y7LA 1V5FA 3Q5EA 4PXYA 5EMLA 4OG2A 4M3NA 4NZNA 3H17A 1XZPA 4DMCA 3BJMA 2EX4A 2QX6A 2W6IA 4CGYA 4H1TA 2HA6A 2X5XA 3UAGA 3OTIA 3W5DA 2DBQA 2VSNA 3A10A 1HQKA 4Y9RA 5IF9A 2WG1A 3A3KA 5CNIA 2FFAA 2GCGA 3I9JA 5FQNA 4BEJA 5K0SA 5KNDA 4IJ6A 3PE3A 3U44A 1EB9A 1EVYA 3QLVA 4EGSA 1EZ4A 5ITWA 4J0FA 1FIUA 1IAVA 5IM4A 5B1EA 3QV2A 1OD6A 4F2GA 5CPFA 5KI6A 3ZCXA 3I8SA 3NRCA 2QTTA 1K3TA 5EIHA 3CEJA 3KE8A 1EP2B 4UUQA 3N8IA 1NOKA 2OXFA 1NDHA 3IOMA 1QRRA 4CMHA 3I6IA 1LLUA 4ZU6X 2MSCB 5T64A 3JWJA 4R8LA 4TMWA 3PK0A 4J1TC 4KMOA 5F4BA 5JQGA 4R8KA 2JFNA 4YAOA 3W6NA 4IDEA 1NPDA 2R7KA 3WWZA 4G4IA 1UL1X 2I4TA 3ORRA 4WKBA 4JZKA 4F96A 4MR9B 5LIRA 1ZMTA 3P2YA 1M7BA 4WY5A 1BH6A 2CB0A 4ONEA 1KXZA 1NQWA 3E3NA 2W2LD 3NYWA 1L5ZA 2ZRGA 3OQIA 2Q2OA 4KO1S 4PFKA 2OBMA 3Q15C 5HQTA 1J0DA 3ADKA 1S02A 1E79D 4YH1A 3E1SA 4XXHA 1NX9A 4M9SA 2CZCA 2FMHA 5L3ZA 5AVOA 5JI3E 4KNYA 4BP3A 2QRKA 3R7BA 3KQNA 1UBFA 4IGIA 3ZHTA 1ICIA 2WHRA 4UCWA 3RVPA 5AKYA 4Z7OB 1TC2A 1XLTC 3P9RA 4PR3A 5BURA 3MBKA 3FKSA 3PXGA 3V8NA 3C87A 1G20E 4CKZA 1N0IA 2CVQA 4LXHA 4E2XA 3BJIC 5BUQA 2QRVA 4MIYA 2F8TA 3CLTD 4J7XA 4DMGA 3EG5A 3M33A 3PC8A 2XMPA 4D9MA 4GQBA 3TQRA 1JFRA 2XGSA 1P31A 1TA9A 2ZUVA 1J2JA 2XMRA 3DOOA 1PJ3A 3EXHA 3GMDA 3HKCA 4DG5A 1FRVA 4LZLA 2XITA 3MJCA 3TQIA 1U0JA 3MBOA 4WGFA 3ZIAA 1DG9A 1QV6A 4NH0A 1AK2A 4M0LA 1FL9A 4U63A 2VTKA 4D44A 4WBXC 3ZWWA 1JR3A 3ECCA 3EAGA 1N6KA 4RMHA 3Q5GA 3WC4A 1T0UA 4WNCA 3E82A 3SKYA 4UUNA 3OUTA 2EARA 2GYUA 5TLSA 4V0LA 1FA9A 3L8HA 4MVJE 3AY0A 4FQ8A 4JBGA 3PTAA 3BD9A 4IVPA 3OZEA 1QHNA 5LQNA 2JG3A 3SS9X 5CXQA 1KYZA 1XEXB 1NXOA 2FPGB 1JG3A 2HDWA 2RGGA 1D2GA 4O4IB 1UBEA 2O5CA 1OT3A 3IPXA 4IV0A 4PYKA 4JT8A 1YHNA 3UY4A 1ADJA 2O2HA 4KITB 1P1KA 1A9PA 3R20A 3DFKA 3ESCA 3H8VA 1IRIA 1VKJA 4AO7A 1FTNA 2YZ7A 2XQVA 3LUPA 4ARCA 1LD3A 5ECYA 3CE6A 1MGOA 1KI6A 1WZ2A 3R0IA 2WYWA 2XWSA 4D5EA 5KSYA 2GPNA 4ZQGA 3WNZA 3NJ8A 2O2GA 4UM5A 4O4LA 4E03A 3UAYA 1AB6A 3QRWA 5K8UA 1TW2A 1N0HA 1A8QA 2R5FA 1L8AA 2RHRA 4Z2AA 2CKDA 3U7GA 2GPJA 2CFOA 3HWX1 3M49A 5CFPA 5CU7A 1F06A 3L7BA 4YROA 4BECA 4II7A 4UTPA 1JDBC 3RU2A 4B3IA 1E69A 2H1WA 4P2GA 3CM0A 3G13A 3ZW7A 3CG4A 4RD0A 3VAZA 1N2EA 1UJ2A 2YHAA 2PGNA 3V8VA 3FTQA 1ZXLA 4PVCA 3SYMA 1AQUA 1RWKA 2ZIUB 1PE0A 2IYOA 3D3NA 1NULA 2W6NA 2X5OA 4L5AA 4FEEA 2C7VA 4UCXA 1TDJA 4X1KB 4IRMA 4RU1A 3M5DA 3IQEA 3PDJA 1EJ2A 1YTUA 2CNDA 1MW9X 2DQKA 4DN6A 1ISRA 1H8EA 2E4YA 1YR6A 3BGVA 3CNOA 1CY6A 3AR8A 4RZ2A 5TQ0A 5AK4A 1T5HX 2DYKA 2GVDC 3Q7TA 4X71A 5KTPA 4K1LA 3WWEA 5KJEA 3SLRA 2AXEA 1Q74A 2WU3A 1OBVA 2WEKA 3QBVA 2D00A 1BA3A 1JA0A 1U5CA 1VLQA 3PNSA 4KQFA 1P1FA 5EUBA 3BD6A 4MPDA 4PCUA 1CXZA 4S1NA 3TB6A 4BLUA 5TGDA 3SMQA 1JYSA 3PD7A 3EG9B 1UZNA 2XNDD 2E4ZA 3AHGA 3L8MA 2AFHB 2DB3A 1P29A 1JIVA 2X0KA 4ZCQA 3BWXA 1E64A 3AL0C 3AEQA 1FZTA 2O3TA 3RKSA 1X94A 1VFPA 1RWPA 4DW8A 2QVZX 2YCLA 3FTPA 3BE4A 1JIXA 1WUHS 5E0OA 1GAJA 3Q3GE 3DOHA 1FUKA 3HP7A 3PKZA 4MS3B 2PBRA 2VWGA 3ZCPA 1VSUA 1TZMA 3TPZA 5GVRA 3EDYA 7REQB 2O6HA 3C3AA 3IVCA 2BI8A 2WM8A 3IP7A 4RMJA 4A0SA 5CHEA 5B6JA 1V41E 4KSYA 4DLRA 4RTKA 4FDUA 3FF4A 1BH2A 4Q4HB 5EKDA 4BNVA 3ML1A 2CY0A 1VZ2A 2G5TA 1N9ZA 3VJRA 2HF9A 4XCXA 2X1VA 2GQ0A 4PLFA 1U3WA 1G7SA 3ICVA 1NBMD 4GAEA 4ALLA 3IO3A 2F00A 2QB5A 4DV3B 4FHCA 3D2LA 2QTAA 3TIGA 4CBVA 4RH1A 2OWEA 4PVDA 4BTVA 2IPOA 1JYFA 1RQLA 3GJ5A 5HJ2A 3STXA 2R6DA 1YB7A 2ZVJA 1VCOA 5EYPA 4DRYA 4UM9D 3H4TA 2P69A 4P81A 1ZIOA 1LA2A 1PW7A 3ITNA 4GXTA 4TQUS 3WSTA 1IIRA 4YV7A 3SBXA 3MMSA 3KZCA 3VPAA 4I14A 5KYVA 1HTWA 4NCXA 4O8CA 4OQLA 1ZLXA 1XMOB 1X8KA 1ZNZA 3QFFA 4RMGA 1MKYA 3FKQA 4AIIA 3RUDA