2XTJA

The crystal structure of pcsk9 in complex with 1d05 fab
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
Knots found
sequence length
268
structure length
242
Chain Sequence
PWNSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLILFSAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title A Pcsk9-Binding Antibody that Structurally Mimics the Egf(A) Domain of Ldl-Receptor Reduces Ldl Cholesterol in Vivo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/antibody
total genus 83
structure length 242
sequence length 268
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2xtjA00
3AFGA 5ARDA 3BPSA 1ST3A 2ID8A 1Y34E 1AK9A 1C9NA 1TO2E 5FBZA 3ZXYA 1KDVA 4K8RB 3LPAA 5FAXA 1SCAA 4RYDA 3WIUA 3QTLA 1NLUA 2V8BA 4DZTA 1T1GA 1WMEA 1GNVA 1YU6A 4AKTA 1ZVKA 3SQOA 2Z30A 3DW1X 5ARBA 1TMGE 1Y3FE 4M1ZA 2W2PA 3HJRA 2TECE 1TM7E 3BX1A 2XRMA 1Y3BE 3VTAA 5SICE 1Q5PA 3GCXA 1YJBA 3I37X 3DVSX 2DQKA 3I2YX 3Q5GA 1SUEA 5AVKA 1IC6A 4LVNA 1XF1A 2X8JB 5ARCA 3PTLA 1PTKA 2PMWB 2PQ2A 1C3LA 1IAVA 1NDQA 4YN3A 1NDUA 1Y3DE 1WSDA 1SBIA 4AKSA 1T1IA 4B5LA 1OYVA 2ZWOA 4FONA 3SICE 1SUBA 4H6XA 1CNMA 1SCJA 2Z57A 1DBIA 1S02A 3DE3X 1BJRE 1PEKE 4CFYA 1Y9ZA 5FFNA 1Y3CE 2WUVA 1PJ8A 2PYZA 1AV7A 1CSEE 3VHQA 1THMA 3F49S 1SUCA 1C9MA 2Z58A 2WV7A 1SIBE 3WHIA 4OMCA 1SN7A 3TECE 2SICE 2ZRQA 4ZOQI 1TK2A 2WWTA 2SBTA 3VSBA 5K7SA 4OV6B 1HT3A 1R0RE 2GKOA 4DWWA 1Y4AE 1OT5A 3QMPA 4KB5A 1SH7A 4H6VA 1KE2A 4CFZA 1BH6A 3P5BA 3WIVA 3DWEX 1YJAA 4NMXB 1AQNA 2IY9A 4NE7A 3DE1X 3ZXXA 5JXGA 3LPDA 1TM3E 4CG0A 1AU9A 1ZVJA 2IXTA 2PWBA 2W2MA 1S01A 3DVQX 2PKCA 1S2NA 1GTL1 4J94A 5B1DA 1GTJ1 2WUWE 2DP4E 3AJ9A 1SUDA 4WOCA 1UBNA 2PRKA 1EGQA 3EIFA 4DJ5X 1MPTA 3DE2X 3CO0S 2Z56A 1SBCA 3I30X 1P8JA 5JMOA 1WMFA 1KE1A 4GI3A 1AF4A 3DVRX 3VV3A 4KPGA 3GT3A 1T1EA 1DUIA 3UNXA 4H6WA 1Y1KE 1SCNE 3DE4X 2W2OA 1SUPA 1WMDA 3DE7X 3LPCA 3D9QX 3DE6X 3EDYA 3I34X 1SIOA 2DUJA 1R6VA 4BWGA 1EA7A 1V6CA 3A3OA 2HD4A 2W2NA 3A3PA 2E1PA 1TM4E 1Y48E 2X8JA 1P7WA 4LVOA 1TO1E 1GA1A 4JP8A 3WQBA 2HPZA 1SPBS 4OMDA 3VYVA 1VSBA 4NE9A 1OYOA 5I9SA 2W2QA 3F7MA 1Y33E 3GCWA 3BGOS 2Z2XA 1Y4DE 5AMXA 4MZDA 4KG7A 1SELA 5AVJA 1AVTA 1SVNA 2XTJA 3DE5X 2SECE 2SNIE 1BFUA 1LW6E 3GT4A 3D43A 1GT91 1BE6A 3TI9A 2PWAA 3TI7A 3EE6A 5AQEA 2Z2ZA 3DW3X 1A2QA 3F7OA 1TECE 1ST2A 2P4EA 1SIUA 1MEEA 1BE8A 3DE0X 2ZWPA 3AJ8A 1V5IA 3LXUX 1GTG1 3L1KA 3VV2A 2ID4A 3H42B 1WVMA 1P7VA 1KDYA 5JXHA 4WOBA 1TM1E 3A3NA 3DDZX 4C3UA 1KDZA 2G4VA 2ST1A 3CNQS 1C9JA 1AH2A 1GA6A 1GNSA 2B6NA 3OSZA 5CW1A 3DYBA 3PRKE 4C3VA 2QTWB 1SCBA 1BFKA 1PFGA 5JXIA 1SUAA 4ZARA 1SCDA 4I0WB 2Z2YA 1SBNE 3T41A 1GA4A 1SBHA 3QFHA 5B1EA 1JEAA 4HVLA 1YJCA 4Z2AA 3Q40A 1SBTA 1GCIA 1R64A 5JXJA 1TM5E 4HX2A
chains in the Genus database with same CATH superfamily
4PONA 3EZ9A 1RM3A 3FPCA 2C4HA 3PGVA 4QC2A 3V97A 4NH0A 2FUEA 2PUCA 3OE1A 5CIYA 2MSLA 2QL6A 4CV3A 5KQRA 3ZXUB 1H8HA 3AKCA 1DIGA 4ZOBA 2JLZA 1N92A 3A9VA 3B5EA 3K9HA 1NE7A 4EGSA 2JLSA 2AI2A 4I1OA 1K6JA 4N0PA 4WFJA 2YDXA 4PCLA 3TQRA 4A6EA 5K3AA 4Y1EA 5IYZB 1EEHA 4PYOA 2OLJA 1Z4PX 4JJ6A 3RTEA 3A9SA 4DW8A 5I7OA 1KEPA 2R8PA 4DZTA 3AC0A 4A10A 3UWDA 3WL7A 2TRSB 1G8FA 4P82A 1S9HA 4F9FA 1PO7A 1TF2A 5TDHA 3U48A 4FOSA 2FSUA 4OQYA 4OB8A 1Z8DA 2I0FA 5CH8A 2XSZD 2GBLA 2JGRA 3NWEA 4GUDA 1B8VA 2IDZA 2RG7A 3NB0A 4RMHA 2Y66A 4HC4A 4QEKA 4BCCA 1S96A 3LLVA 3SS8A 4XYEA 3R0ZA 3AQ4A 4NATA 4X66B 4S1NA 2C58A 3USES 4P53A 3OEHA 1EM6A 3CE6A 1F6BA 2I33A 3FWHA 5BYAA 5DPMA 5K4GA 4WBNB 1H2FA 1W1UA 3GHHA 4P98A 5J2TB 2X0NA 1OGIA 2FSSA 3A9UA 1Y63A 3DTVB 4B4UA 4RJTA 1RI5A 1ZHHA 4M60A 1QHIA 2VK4A 3DVSX 1EU1A 3JYLA 1DHRA 4IJKA 4IWXA 1ZOSA 2WC1A 4P7FA 2CLOB 3SSOA 3TLMA 4MQFB 2D8AA 2EW1A 4RD0A 1W88A 2WKRA 1QYRA 1G6Q1 3BEDA 1IXYA 3VR5A 1JALA 1CJCA 4DMFA 2JLRA 1MO2A 3SQWA 1II8A 1XTZA 2WTNA 3HSYA 1NHGA 1I32A 3VZSA 1C4OA 2Q6OA 4ND7A 2X19A 1KQNA 2G82A 3NHAA 4G5FA 4BNMA 1J5XA 1LZKA 2WJHA 3JQ7A 4JJKA 1BRTA 4KFSA 1WL8A 2NW6A 3SLKA 4YRKA 2BI8A 3SC2B 1SBIA 4TLDA 5CFPA 1EFLA 3JYHA 3O8CA 1R5JA 4OREX 1KAQA 3L8EA 3R7FA 3NNNA 3E05A 3OKAA 2WQ7A 5AJUA 3U16A 3C3CA 3RSZA 4KJXA 1YMUA 2HBYA 4S1WA 5TF0A 3VHXA 3K09C 4E07A 3P2IA 4GVPA 3EC7A 4O3FA 4J4HA 1VECA 5K09A 2P90A 4J0KA 4NBSA 4GI7A 1V41E 1J56A 5C8XA 1ORVA 4HZUB 2OB2A 2ZIFA 1NKTA 2QRLA 4UD2A 5FOQA 1Y6FA 5DIZA 3KL4A 1VMEA 1PEKE 3FX2A 1ZCJA 1WPXA 3NJRA 3GT7A 4LY3A 4Y6OA 5D51S 4ZPJA 5KYWA 4BFLA 1OJ7A 5EQDA 2R6ZA 3DV0B 4D4IA 2HH9A 2WUVA 4KR2A 3ZZ1A 1WUKS 4M83A 4RKQA 5TXGA 2ZBGA 4FIDA 3U49A 3TW0A 3F49S 2OAEA 3H84A 4Z86A 5B4UA 4M9SA 4ZT7A 3VH1A 2G9UA 4FFVA 1KR2A 1MJGM 4UEKA 1M2KA 1C3JA 1X38A 2E4AA 5LWQA 1XFDA 2QN3A 2ERXA 3WK9A 4E11A 1H0HA 5KOJB 5LZ9A 5L7YA 4P2BA 3HU5A 3VC1A 4ZYLA 1BVUA 2VBGA 3VR3D 2O8DA 2O59A 4UCWA 4CKCA 2Z6VA 3BZUA 1QU2A 2JHPA 2PUDA 5AVRA 2HB6A 4G89A 4Q24A 1EXVA 2ALJA 2C1EA 3FTCA 3E81A 3PR1A 1K9SA 4G5RA 4D41A 5KCZA 1QRUA 2AKEA 2MDTA 3DL7A 3QXJA 1YR3A 2HPVA 3FWYA 3QVMA 3IHKA 4HB4A 4DR3B 1TI7A 1BRMA 2XZLA 5AW2A 3BS4A 4BKOA 2FZKA 1H23A 4MJ7A 1DAEA 2X8BA 3D5QA 3P4XA 1IATA 2HUPA 3OWHA 1KDOA 1JH8A 2N42A 3PPWA 3DOHA 1JFVA 3G0CA 3ICCA 3V2GA 3WHPA 4FK8A 5J4LA 3ZJUA 5CDTA 1Q1ZA 4LJKA 3ZQUA 1FNBA 1VP3A 3IPCA 3WK7A 4MI3A 2ACVA 4QUAA 3FRJA 1A3CA 2Q62A 3L77A 3LHKA 1V1RB 3LVQE 3AF6A 4AIRA 1U7HA 2IP2A 1LJUA 1T36B 3CHYA 1U5AA 3UHFA 3ZQ4A 1W34A 3E82A 3NETA 1UM9B 1DC7A 1O94A 1U3VA 3WJ2A 3AI2A 4WLNA 5EZ5A 3DAHA 3PNVA 1KEKA 4FGSA 4IVRA 4ZT2A 2HLDA 3Q7EA 1OX4A 1TK9A 2E7ZA 2WZBA 5JMTA 3EDRA 1PSZA 2ISCA 5TQ0A 5JH7F 4XM0A 1BD4A 4L2IB 2JGJA 3BB1A 3HDQA 2Z6AA 2ZSEA 4H7DA 4UAVA 3WC4A 6LDHA 3OC6A 4RE6A 2MYNA 1ZY2A 3RWMB 1WXQA 4ES6A 1S01A 3U1VA 3IVGA 1Q22A 3CZ9A 3LQKA 1OFHA 2YHIB 4C43A 2QD4A 4L4ZA 3AB3A 2ECPA 3F71A 3ND9A 1YRLA 1FW6A 5EJ5A 1NLZA 4Q66C 4ZAVA 1B0ZA 1F2UB 1XP8A 4ECAA 1CJUC 4U2CA 3R6TA 3O90A 1O95A 4LA4A 4XEUA 3R7SA 1CRWG 1FSFA 4MULA 1CJKC 1NYTA 1RACA 5AK5A 5B58T 1B43A 3O1IC 3U9TA 4AMZA 1DAFA 1KOJA 5M3BA 5B4VA 4DB4A 2JJMA 5EUMA 3V6MA 3HN2A 3M3PA 2JHGA 2X0IA 3C15C 4LN1A 2CGEA 1E1RA 2OPHA 1RWMA 1M7GA 2V9ZA 3MTJA 1REQB 1W5FA 2B2NA 2DY0A 4R7ZA 1FY2A 3DZFA 3LZCA 5GAJA 4ZQHA 1VBNA 2GX6A 4HD8A 5JI3E 1YB7A 2FUKA 2ZSBA 1CUVA 3ILXA 2DWQA 1M8PA 2YRFA 4KYIB 4XVCA 2Y2VA 3HFRA 5E9WA 1N0WA 4RANA 3F3MA 3IE2A 1GARA 4E2YA 3IE1A 3JR3A 4BL5A 3GUHA 3PCXA 1K2VN 2J0QA 5ITZA 2C95A 3GLKA 2HWWA 3OFVA 4QIHA 1N6LA 4MLDA 1ISIA 3CBGA 1DEOA 3O8NA 4S24A 2XHZA 4UTNA 1TT7A 3NNSA 2A4MA 4FWIB 4V0MA 3A05A 4TKLA 2ZI7A 2CVHA 4MUFA 1X7DA 4GQIA 3T9AA 4ZJPA 2DR3A 1P44A 2I8AA 4EFMA 4UTZA 1QKJA 4PRKA 4GC5A 2A7QA 1ML3A 1ZGBA 1ZXXA 3BE5A 4RA9A 3D4NA 2HA4A 3ZU6A 3G8DA 3VISA 2CYBA 2R1TB 3BA6A 3PWSA 4E3ZA 2EHJA 2IYLD 2PX4A 1PK9A 3RCBA 3LD9A 2I55A 2PS9A 1RWVA 2NPFA 5ALXA 2UKDA 2GCEA 3VHLB 2AOXA 4QRDA 1TNDA 1IZ7A 2W2OA 1UPCA 3LFHA 1IN8A 2A3RA 2VHTA 2G5GX 2I8CA 1J9ZA 2WP0A 2WYUA 3L4EA 4LHYA 2C1ZA 1I6MA 1Y37A 2JD0A 3A1NA 3DT6A 3QWBA 3D9QX 1KXZA 4H3KB 4I55B 4TKVA 4GPIB 2PGXA 5K0FA 1EP2B 4PM4A 5T67A 4B84A 1RKQA 3DEZA 2OD7A 5EVJA 4C4SA 3F6CA 1A69A 5DO9A 4HRYA 3OP1A 1QYIA 4ENUA 2ZYTX 1L4UA 1R6VA 1YRQA 4F9TA 4QOEA 4BKPA 2EAUA 3N2GA 3T3HA 4YMHA 4DNQA 1BX1A 1WHSA 2KI5A 1L3IA 1OZGA 2D1FA 1GTVA 3KZKA 4HQ0A 4M9QA 2YNMD 3RT7A 4DUPA 1PKEA 2VBIA 4G07A 5EJEA 2GEVA 4IL5A 3CPEA 1QRSA 4OGFA 4AECA 2PGOA 1Y4ZA 2CLHB 3D7KA 3AEKA 5EESA 1XG5A 3KVRA 1YK0A 2IUUA 2ZYVX 3ROEA 3W6ZA 5JWRA 1PK7A 1SHJA 3CUYA 2HU7A 5HMMA 3AOEA 3MYYA 3NTLA 3FAZA 1JYEA 1IPFA 1DQRA 3GQBB 1M34A 2BRUC 2HWUA 1EFRD 2X8JA 3FTPA 3LQRA 3PQ4A 4H1UA 4WK2B 5FNZA 5C9ZA 1I7QB 7AT1A 5DRYA 3A27A 1NUAA 1SXJD 1U3WA 3JAKB 4N6NA 3FHOA 4U2GA 4KQCA 3HB5X 2FA9A 2XECA 3DP7A 3KJQA 3TZHA 5AVQA 2I78A 4YUXA 4ZVKA 4CKYA 3HVRA 1ODIA 1XZHA 1GM5A 2Q6TA 5BUZA 2JZOA 1DJLA 2BMWA 1IPHA 2Q29A 1A77A 1G42A 1T34A 4GG1A 5C3MA 2NTJA 3KM0A 5KHOC 1OYOA 2WT8A 4ENRA 3A6PC 3IAS6 3N8NA 2W2QA 4DLLA 1A4XA 4N6OA 3EZ7A 2X0KA 3KZVA 4GICA 4HEHA 3WGQA 4F96A 1N5IA 3G1UA 2YMLA 2NNWB 4L3WA 5EXEA 4XH9B 1CQPA 5K3FB 2X0FA 3THXA 3EIUA 3K9QO 2XCRB 1A7JA 5CDGA 1PVOA 1R4NA 3DBLB 3MOSA 4NJMA 4FYWA 5AKZA 4L8LA 2D3WA 4WN3A 2QM3A 4RXUA 1DG9A 1M2NA 3IMKA 5JE8A 3EDMA 2BF4A 5AM1A 3RR2A 4KDEA 2BDTA 1XOIA 1AT1A 4KG7A 3RQSA 3F2VA 4E5VA 1K06A 1HRKA 4HX9A 5F5XA 1H66A 4BB6A 2J45A 4WX2B 2XTJA 3FOFC 3BULA 4DWOA 1X8XA 3HI4A 2R8EA 1GAWA 1YS6A 3SP1A 3VU9A 1ZJZA 4I4TA 3LTEA 2ENUA 2GUWA 4YJDA 2BF7A 1P29A 2AW3A 3VTKA 3JPWA 1W6RA 4KN6A 2AJ8A 3IDQA 1KGDA 2VF7A 3KYDA 1IK6A 4Z4HA 2Z2ZA 4V0OA 2E9SA 3GJRA 1N6KA 5D3MA 4AFNA 1A2QA 3EGIA 3RG2A 1K7EB 2QMQA 1UANA 1H0SA 2GSWA 4BU0A 2B5VA 2HA6A 3WFIA 4FZVA 1VG0B 1GCAA 2WYVA 3PQ6A 4INJA 4KUGA 4YUVA 4JC8A 4PX3A 5K2OA 1ULUA 4MX8A 1V39A 4URZR 4H1HA 1F06A 4XR9A 3RV3A 1V5GA 2OV3A 1A8HA 3D4BA 2J4CA 4MYUA 2XPCA 2VHVA 3DMPA 1PJCA 3KPVA 4CEIB 3M1AA 5L3SA 4BDSA 3TLZA 3GD7A 2CHVA 3KUUA 2I4IA 4HDSB 1JXAA 1WZIA 3VR4D 1H2YA 2UUAB 4MDFA 3ODGA 2X86A 1DVRA 3FDIA 5AESA 1PEYA 2FCRA 3JRNA 1QIHA 3ZIAA 5MN6A 1I0IA 2Q1TA 1RYEA 3ND8A 4RVSA 3GUYA 5AVSA 2NZUG 1XZQA 3C6QA 4UXIA 3RVLA 4LPKA 2Q5QA 1BYUA 1KRHA 3STYA 2IV3A 4EHAA 1BWSA 3G6WA 2Z4RA 1DX6A 4JI8B 4GZLA 1KSJA 1XHLA 2D1QA 5FWDA 1XCLA 3SBDA 1CUUA 2F8MA 2ISQA 4FNMA 1GZ3A 2OYSA 4KIGA 2A1UB 4PGMA 3TAHA 4Q18A 4TYYA 3TZBA 5HF8A 3TOVA 4UTRA 4B47A 1W49A 3UHOA 1WCWA 3PXEA 3MMNA 4TL9A 1PJLA 2HSZA 2MMGA 1J0XO 2VF4X 2JIMA 2NO0A 3MD0A 4XQ0A 1DNPA 3Q9LA 3ESZA 2QMUA 4ZVRA 1E3IA 1TUGA 3UMSA 1OAAA 3L07A 3G5TA 2H17A 3ICOA 4OJKA 4XIJA 4OF4A 5T7BA 5GV8A 2XY4A 2I91A 2YOFA 3HCAA 3INGA 4C4TA 4TVSA 2A0KA 4X94A 5REQA 1DB3A 2QD5A 3IUQA 3O0TA 3WL5A 1CS0B 3IAHA 1BGXT 2GLUA 4GFDA 1DMSA 4ZDKA 3GOHA 3PHIA 2C2XA 3ZDDA 4QGBA 1M9NA 3BTOA 2QTWB 1W0JD 3A26A 1T4CA 1AQYA 1FIUA 1DCMA 1OZ0A 1C9DB 1W94A 4IIGA 4AUKA 4BTEA 1BFKA 3WIBA 1I94B 4IQ8A 4HR7A 4Y7DA 5DHRA 1Z4JA 3QEAZ 4RWEA 3KYBA 2ICAA 4B6PA 4WJKB 4KBFA 2IOQA 3CWZA 1ADFA 3JYPA 2OZPA 1Z6GA 1F4LA 2C83A 3L5OA 3D64A 1VI6A 3M3HA 1XZDA 4MS3B 3G2MA 2IGBA 1JKJB 1VJ1A 1XMIA 4GQBA 4MCAA 3KUXA 5KYXB 5FPKA 1Q12A 4UU1A 1CY6A 1ZD3A 4WLVA 1XXHE 5E2AA 5BNIA 3VVMA 2EEZA 1FXSA 5KSOA 1ENPA 1ZX1A 2PGNA 1O6CA 3CLSD 1YA6A 5JTUA 2V7EA 2XEDA 3PEUA 4OJMX 3HR4A 1QVRA 1I4OA 3ZTTA 4EDFA 1G5HA 2AUTA 1BVYF 3ZGYA 3OLZA 4P7BA 2IHVA 2Z5LA 5KAPA 1O4VA 4NV0A 1E8DA 2OKGA 3N07A 1EVJA 1NM5A 3MWDA 3UYKA 1Q6YA 3MWJA 3OPVA 3C5WP 1A9RA 1OXSC 1YZQA 8ABPA 4XKJA 4AJ9A 1ST3A 3EMVA 3O4HA 4FNAA 4LGCA 3S1AA 1VA4A 4EJ2A 2BTOA 3G7UA 4EO7A 5JT1A 1SAYA 2OO3A 2R62A 1XDBA 4CM9D 1CUGA 1R8XA 2P9YA 5CM9C 2CC2A 1QV6A 1RLJA 1UT6A 4WXRA 5E9JA 1DZIA 2I54A 2E87A 3RQIA 2FVYA 3WR5A 2XVYA 1N36B 2Q49A 5D8DA 4NVRA 1G17A 3QX8A 4JQZA 4B7XA 5HKKA 3U6BA 1H8EA 3E27A 4B6SA 4WE3A 5DM0A 1M1YA 3L9XA 3MVEA 2X1LA 2QUBA 1RJEA 3FNRA 1BA2A 4KFUA 5H16A 3HL0A 2G0NA 1KJIA 1L8QA 2I2DA 1E2FA 1DAGA 5T4EA 2VWHA 4GWGA 4TUYF 5FOWA 2IS6A 3Q6IA 3U3KA 1GQQA 2H8GA 3BT7A 1X1DA 3ZVMA 4BJ5A 1MO6A 3QI2A 4HLQB 1J0EA 2RHMA 1YB1A 2YCBA 1VBKA 1FMCA 2LP4Y 4J91A 1GGHA 4W9NC 1F0PA 2G08A 2PVPA 1P1JA 1LBIA 2WYHA 3BD8A 2V0GA 4S3MA 5AW5A 2I6GA 3OF5A 1L7NA 2W37A 4HWSA 3DAGA 5TC4A 1NV9A 4BNFA 4CG1A 5JAUA 1QNFA 1T15A 5AVTA 1OILA 1PG5A 1SKAA 2JIOA 4LDPA 3NFRA 4YJ3B 4NZNA 1MCZA 4BVHA 5HIKA 3LQ1A 1NPYA 1BKSB 4HNHA 5IT0A 1VXOA 4JFRA 1FOEB 3GCXA 3V00A 2B83A 2WNIA 2ZR8A 3HYTA 4Z9AA 1CJVC 4M99A 4BKRA 2VHXA 3CN7A 3ZWAA 4AJKA 1TIKA 1GR1A 3DTVD 1XIVA 3L2OB 1Y5LA 2DLDA 3MJCA 1XL0A 2V6FA 3ZWQA 1M2WA 5DW0A 5JBNA 5LB4A 2DH6A 1N7IA 4D9IA 2QS9A 4OK5A 4B3HA 2PGIA 5CXSA 3OY7A 1STOA 3WL8A 1UXOA 2ZBFA 5DCYA 5ARCA 4F4HA 2I66A 3O0DA 4MICA 1QCZA 3MS7A 2NU7B 4R2IA 5ENZA 4CDRA 4EG6A 1IY8A 2NUTB 2WYOA 3RGWS 4JV5B 3V80A 5JANA 1RRMA 1U1IA 2WABA 2EJTA 2PH7A 1USVA 4LSMA 1PS8A 3CISA 4A8JB 3GLFE 4UM9D 1UFVA 1X94A 4CF4A 5LD2C 1T8RA 2COUA 1WXIA 2IXDA 1GPAA 2ODQA 3EXHA 2VYVA 2XMQA 3LUFA 4TWZA 1QS0A 4YGYA 4C07A 3BJRA 1D4ZA 2DE0X 5IMBA 2NP7A 3TRJA 4PQYA 3NC4A 3T3MB 3MERA 5DGHA 4FCCA 3T5TA 2CCKA 2ZLBA 1P91A 1U2DC 3LHDA 4TL6A 5EIXA 2FPSA 4OYYA 3OJFA 1X1CA 4JLKA 3R76A 5E6RB 1HE3A 3ZZ0A 1IZ9A 4D3FA 1EWRA 1CQJA 2GYUA 1JIUA 1RHMA 1ULAA 4F6LA 4ROTA 1WU7A 3MRXA 2BCGY 1DELA 1Y6ZA 3BL5A 2VTEA 4Z4GA 2Y4NA 5AJWA 1C81A 5KMGA 3KDSE 3SKXA 3WIEA 3UJ6A 3WQRA 1AV7A 1CSEE 4AX4A 4YCSA 1MT0A 3BIFA 3N0TA 2OV1A 4JR0A 3BE4A 3HBMA 5FPTA 2OTCA 4PNPA 2PAFA 2WKWA 1QYCA 3MUFA 4R9VA 1VKHA 3MLBA 4RGVA 4TGLA 2BTQB 2PNJA 3RHTA 3RS4A 1TZCA 1WDKA 2AQ8A 1V9LA 3WAGA 1JVSA 4OMCA 1GGEA 4V0SA 4WJZA 2EGHA 5H4HA 2ZRQA 1LK0A 1WKBA 2JGNA 2VO1A 3CINA 4CLOB 3G85A 3V55A 5C1OA 1BMDA 5LFAA 3KKZA 1XZJA 5CXQA 5EIWA 3WS7A 1YNOA 4NY1A 1SY7A 3BFKA 4M8IA 4IGFA 3WAKA 3CPSA 4B3BA 4B17A 4BC0A 3GFTA 2C7GA 1JKFA 5ICCA 1IB6A 4Y0VA 5K7SA 3RIMA 2P11A 4ZIRA 4OV6B 1VPWA 4O1MA 3VBCA 1TUBB 2F9MA 1FMLA 4NKRA 2GKOA 4FSDA 2VTKA 5JD3A 3PLAE 2GXSA 1T0IA 1OGJA 1NW7A 1ZN2A 1YL5A 3EBOA 1H3NA 4PINA 1HOTA 1RYDA 2FZWA 2K87A 3FKQA 1UF9A 3T3NA 5KHLB 3WRYC 5JNRA 4O4HB 2Q6IA 2TS1A 1Y9AA 3CMCO 4YPOA 4M0DA 5KDLA 1E9SA 4OXYA 2NACA 3P5BA 3T06B 1S4MA 2WF9A 1FDOA 2DUWA 2YVQA 3PEFA 1OR8A 5LP6F 4K2HA 1YJAA 4TTQA 2Q5LA 3G0OA 4HYYA 3VXKA 2DSTA 5DWDA 3PGXA 2Y6UA 4JYBA 3O95A 2E21A 2P9FA 4HLNA 3EPKA 1A97A 5JPIA 3D4IA 3P9CA 1KI3A 3PSAA 1AC5A 4HX5A 1S4QA 3IIMA 3LKZA 4QHYA 5TGTA 3OPYA 5CG2A 1JG3A 1ZKMA 5FHQA 4RTPA 4AJ1A 5KU1A 5AIAA 1GLGA 1U9IA 4F93B 1I33A 1ZN7A 1JA1A 1RE0A 1PNTA 1ZGGA 4JR2A 4XUDA 3QW4B 1X8LA 1QCCA 5KJFA 5ELLA 1EGHA 1ZHFA 3JYNA 2W4MA 5HJ2A 4X7MA 2XD4A 2XB2A 3HJFA 1O9GA 2BFCB 4O29A 4OQMA 5K3SA 1SZDA 4INZA 4N65A 5SYAA 5LZ2A 2CL6X 1W76A 4KCGA 3SC3A 3AM1A 4OHWA 3Q5DA 3VO2A 4P81A 1S1CA 2ZWIA 1HE8B 2AN5A 2V7GA 2WF6A 3DLHA 2WM9B 1ZM3A 2PO7A 2ES4A 1H5NA 1ZZEA 2WUWE 3GIWA 3H2IA 4I2VA 5JJCA 5JVDF 2G0TA 1BIFA 3FPHA 2QI9C 2AOUA 3IP3A 5IKXA 5A3VA 2P5YA 3PPVA 2CLEB 1EVLA 3IL2A 4BO2A 3RSFA 1UBNA 4NLLA 2VDRB 1MNAA 2ZUBA 1MOQA 3UENA 4F0JA 1Z2PX 2I22A 2ZU0C 3FVRA 5D5QA 2M9MA 4CDGA 2H63A 2HK7A 2XMGA 3NIWA 1A1SA 3QF7A 4HDMA 1RCUA 1D1SA 2WFLA 1E2UA 1U0NA 3MBOA 3KLPX 3OC0A 1SBCA 4ZRDA 4YAKA 1ESCA 3MWLA 3RRZA 1W73A 5EPOA 2CVZA 2WNHA 1GADO 2FW0A 1K8XB 1N0HA 2AUNA 2WAOA 3AHDA 2QJWA 5GVSA 1H1TA 3L7NA 2H08A 3TZKA 3L06A 2IEIA 5KVQA 3WKBA 1TLTA 4Q15A 4Q7MB 4BVFA 5K6RA 2QUHA 2QAGC 1DPFA 2CNLA 5LKAA 2AFRA 2FQYA 1PIWA 2YN2A 4LYGA 1JN0A 5HCNA 3SQDA 3F46A 2GTIA 4ISCA 1NVVR 4P22A 1UM8A 1E4EA 4KPUB 1HX7A 4GS5A 1DIBA 1VPTA 1W85A 3E0XA 4KPGA 1IBMB 3TMAA 2HRDA 1F1BA 1P0PA 1T6NA 2VPTA 3RROA 3V7FA 4CMGA 5E4JA 4MIYA 4BQSA 2C3UA 3UT6A 5AUNB 5CD9A 1O6ZA 4UZFA 4PO8A 2RAPA 3NXKA 3S7TA 5ALNA 1QE0A 3T12A 5BWBA 3STXA 1D3AA 1WDWB 2NSHA 4DCJA 5K8IA 3TXAA 3KXLA 1IWOA 1C0KA 1Y81A 2CE7A 2GI4A 1QPZA 4IOMA 2BT4A 4LVUA 4Y2XA 3L92A 4QRIA 1MJGA 3UPTA 4GMFA 4UE2A 4C76A 5BSKA 3HLKA 2HT1A 3IQFA 5JFOA 1R50A 3HABA 3M4XA 1BJTA 4ZU3A 2X0DA 3ST7A 3L0CA 4BMOB 1MR3F 3GVCA 4QO8A 4U2KA 1GDHA 1LSJA 1UDAA 4MR8B 1OU0A 5E2IA 4L57A 1PQUA 3GB9A 2POQX 1P9NA 2QRJA 3L6EA 2E85A 3O38A 1JR4A 4O25A 4EHLA 4XWWA 2C2OA 4FXOA 4EUHA 4INAA 4FT2A 3T5GA 3UMRA 3TG2A 4MQ6A 3IJRA 3D5EA 3K9GA 4RLSA 4ZCMA 3CRMA 5FLXA 2J6CA 3CX8A 3HB4X 4KNVA 1ETUA 4LGVA 4O0LA 4X45A 521PA 3VDMA 2QRZA 2KW5A 4R2JA 1SG6A 1DU4A 1HNNA 2VCEA 9GPBA 3LO5A 5JNSA 4NOKA 1KNQA 2I8LA 2DJIA 2W6OA 3BWXA 4D57A 5C18A 5LWHA 1MOSA 2I4MA 2NXEA 4NEHB 1ZUIA 4DVGA 1OOEA 4JBIA 1RWQA 4R40A 5DBIA 2ZPAA 5EIFA 3CUWA 3KV1A 5CA0F 1RMTA 1GA1A 4Z7NB 2XOXA 1CRZA 1BEUB 5IBCA 1XEFA 2GZ3A 3IR7A 3MWYW 4K2AA 4MW9A 2QJFA 4BNDA 3HKEA 2N47A 1T0PA 1QP7A 2CXTA 1M75A 4TPKA 4RV4A 4AJPA 3F3YA 4IP0A 2DPYA 3HBLA 3QI7A 4RPHA 2ZYGA 1XWFA 1U7PA 4WKCA 3CZ5A 3Q8MA 5BR4A 3ZE9A 3AI7A 4HHEA 4NEGA 4DQXA 1VE6A 2G63A 2O2SA 2XMBA 4HXFB 4PNHA 1OASA 4R7TA 3VVCA 3W9YA 4K8OA 4RXTA 3BGOS 4KO8A 3I01M 1I2CA 4LAFA 4Q4CA 1YT5A 3FGOA 1W1IA 3H2SA 4Y2GA 3L7CA 5HJ7A 1TADA 3C6KA 5TQ2B 1HDGO 4BQOA 2OBBA 4G1MB 4LF8B 1E66A 2PH5A 4I5IA 3TTYA 4DMRA 4KRFA 1PL0A 1DBRA 3X2SA 4CF5A 1U9YA 3OOYA 3PIDA 4RMJA 3PUJA 1EXWA 2L18A 3GF4A 1NBWB 5AI5A 4HWRA 5GONB 1JVNA 4QAQA 4ER3A 4R2LA 4MARA 2ZVJA 1XEXA 4TLCA 4Y2TA 2G1KA 3FVQA 3DD1A 5C35A 5JS8A 2Q4BA 1KY4A 4G5HA 5K0LA 3GWGA 1IXSB 1RABA 5MGNA 3FWNA 3DLCA 1DTEA 4JA0A 3BRWD 3BGWA 1TA9A 2P9JA 4LTNA 5AQEA 2DXIA 1NMSA 4YUAA 4UD6A 2Z6UA 3DZJA 3FR7A 3JWPA 1DLIA 2YFKA 1CJBA 3G2JA 4QT4A 4FYYA 2P77A 2QU8A 1QV7A 2FRXA 4PC6A 1VKRA 2F8LA 4ZCLA 1JU9A 1IVNA 3RJTA 1G5QA 3J80A 5A4FS 4GSYA 3W8RA 2HMYB 3LDHA 1T1JA 3AEQA 3GL9A 4RK6A 1S7CA 3IJPA 2P40A 3FRHA 5CUQA 3WGZA 3QLEA 1SXJE 4D9JA 5C46F 3P96A 3O21A 2QLBA 4ZEVA 3N6VA 5E95A 3RUIA 1JEDA 1UBHS 1FZQA 3L1KA 3R5TA 4CEHA 2IXEA 1OVMA 3AR7A 3OVMA 1XPUA 4O33A 2AMJA 3ITKA 2GJ9A 2X4GA 3PPXA 1YVDA 4Z0HO 2JGIA 4RD4A 1P7VA 2HQ1A 1ATZA 1RU3A 1FYXA 3K0AB 1KH3A 3HCNA 3KSMA 1HY3A 3MGBA 3PTZA 4N82A 2XUHA 4ND4A 1MQSA 4JBYA 4N5HX 3AIKA 4W99A 2PLFA 2WM3A 2G88A 3AX6A 2O2JA 3ZZMA 2X9NA 1GQ2A 5IC4A 5KINB 5BV7A 3ABSB 1G63A 2H1SA 5JC1A 1GSHA 1HO3A 5HP4A 4E5UA 3T7EA 5IVHA 4QXRA 3W5DA 2V7QD 3OZTA 4LOIA 1ULTA 4YT4A 1L2TA 3G2PA 5ALKA 5DLQC 2MYTA 4RDIA 1J97A 5PNTA 3NDBB 1GFWA 3RSQA 3SM3A 3VI3B 1AH2A 4TSFD 2Q5CA 3L8CA 1P0MA 5AUOB 4EMTA 1MUUA 1VKNA 3AFMA 3EHEA 4N3NA 2F6RA 4IMJB 4TL8A 3TD2A 3CN9A 1GG8A 6ABPA 1V6SA 2ZBUA 1NQUA 3O9MA 1P4GA 1JDUA 3OSZA 4B3CA 4F92B 5LDDC 3CLTC 2FUG1 1C8KA 3FYTA 5JZ9A 3E8MA 4RPKA 3LF1A 2B94A 1JR3D 3L49A 1GPUA 5B55A 1UAAA 5MDHA 2G5CA 3L6UA 4MUGA 2HWYA 4NJEA 5F2NA 2C7VA 2XMCA 1UEIA 3MJHA 4OXXA 4N3CA 4TV8A 2CDAA 1C80A 1OD6A 2JFVA 5LIPA 3DQQA 3OQPA 4CKWA 3UH0A 4LI3X 3UEOA 2IE8A 2JI4A 4Q03A 3GRVA 1QG4A 4P83A 1SQSA 4NWIA 2ETXA 4LZLA 4MGIR 1R9MA 2RSLA 2W6MA 4QXOA 5CLIA 2IRWA 4FMBB 4CDMA 2PE5A 3WHLA 2IOFK 2Y77A 5AHXA 5TX7A 4II7A 2XUPA 4WLUA 2HR1A 4JLPA 4PTZA 3G0DA 1P9LA 3B89A 4MHSA 1Y3HA 3HPQA 3BIJA 1WXXA 2H1IA 1TKRA 1ZWLA 3DBIA 4M87A 4TN1A 2AMYA 2BKVA 3B7WA 4XCQA 3TKYA 3MD9A 3W5HA 5HQJA 1L7DA 1JIXA 1WCV1 1ZIOA 4I1RA 1OE0A 3KQPA 4MWEA 1TW3A 1I4EB 2P4HX 1YOVA 2R97A 4NL4H 3G13A 3PUYA 4DJFC 1ORRA 1V35A 1Y34E 3HJHA 4NZYA 1RZRD 2E3JA 1P5JA 5JS2A 4GM1A 3FZYA 3HGTA 1TO2E 4L4RA 4CU2A 2NQTA 1SBQA 3SNKA 3LY5A 3H11B 1EE1A 5HKLA 3ZK8A 5FLYA 5JISA 4G24A 4WADA 3LJKA 4EGCB 3V3KA 1DLJA 1E3QA 4W7SA 2GRAA 3RYHB 2VYQA 2FEPA 3BDIA 4GX5A 4V1CI 2ORVA 1X87A 2YJZA 4PYMA 2CW5A 4ZT4A 1ZQ1A 1Q50A 1YB2A 4DV7B 4WI1A 2Y0EA 4L4XA 5H1YA 1UKYA 1XHEA 3ES9A 3JSXA 4IY1A 2PD6A 2NPIA 2F2TA 4ONEA 4ENSA 1XKTA 1PNVA 2BUBA 1Y1RA 2LPMA 2A5JA 2VWPA 2WKPA 3LE8A 3LT5A 3LWBA 4MVJD 3P19A 1MG5A 1DWOA 3SAJA 3VQTA 3ABOB 2YN4A 2GQ0A 1A7KA 3VPAA 2H0AA 1FVFA 3WK6A 3WIDA 1PEDA 2D6FA 1DS6A 2HKIA 3PEEA 5LXTF 5CB4A 2GA8A 2PL9A 2WHEA 3RWOA 1JR2A 5JZVA 3PX7A 3IP7A 4XGQA 1BMFA 1F17A 1P1KA 1YR6A 2FPGA 5CA1A 4H08A 4M1ZA 1XTJA 1XD9A 3WJ7A 2R5NA 2ZRCA 2IOHA 4R51A 4M54A 5B7QA 4KAAA 2DR0A 2A35A 3MF4A 4FDLA 1JECA 2A9RA 3A10A 3IEUA 3PFWO 3ZWBA 3K0CA 1TD9A 4QVIA 5GINE 5DP1A 1XKXA 4OOFA 3V1LA 3ZXXA 4QM6A 5HDQA 5C7LO 5BT8A 3H1PA 2XEXA 5A5FA 4D42A 4DUZB 5FHRA 1E2PA 3EVTA 1EXDA 3OY2A 3TFQA 1A7UA 1L5RA 2OZKA 2HDWA 1UBCA 4RF2A 4UOZA 4MYDA 4JT4A 1CUDA 4GMDA 4KI7A 1IC6A 1P2VA 2EIXA 2B4AA 2ODTX 4G8JA 4UVEA 1PNRA 2CXHA 4JB3A 3NMUF 4I9HA 1PZFA 2ZIGA 3FUWA 3TQTA 1QFJA 4MYCA 3CX4A 4MV8A 5ERXA 1PTKA 3HGMA 2DSNA 2O14A 3NONA 4PPYA 3IBTA 5FBQB 3SWWA 2VQEB 1FYVA 1ESDA 3GMSA 4FB4A 2IS1A 1F14A 4BNYA 3FLAA 1P0QA 1N3LA 2ORED 3ORSA 5HX7A 4C5CA 1RQ7A 1VLMA 1N32B 3FF4A 2BGIA 1HE2A 1RJDA 4PYNA 4UTPA 2QENA 4C0LA 1E0KA 2RD2A 3VVBA 3PPIA 3F4LA 1U2GC 4JB0A 4PLTA 1NT2A 4O0MA 1X19A 2M6RA 3TBKA 4ABTA 1ORTA 3QEMA 1U02A 4ZVMA 4F7WA 4GRAA 4DZRA 3W04A 1B23P 3BIOA 1XT6A 3O2QB 1CT9A 1R66A 3NTQA 5F52A 4ALNA 3K9LA 4CJXA 1FDSA 1KY3A 2X0RA 2AN9A 2I34A 2XLBA 3TUJC 4NU8X 4IYRA 4QQRA 2C98A 3ZS9A 5JAMA 4RD1A 2GEBA 4KQXA 3T38A 4PIVA 1G7SA 4AZ0A 1Q2XA 2JCVA 2BV3A 3WK8A 2AFVA 1QR6A 3ZNPA 2CLCX 3GLGB 3CF2A 2W0MA 1FEZA 1XRJA 3IDFA 1B6SA 4QJIA 4MUXA 1A9YA 4JDPA 3R0IA 1J9GA 1ESZA 3NBMA 4RHEA 3EMBA 4NMWA 4D4GA 4DDTA 1U6JA 1O8BA 5ALGA 2VF2A 4ZCSA 2IF2A 1K8YB 2C0QA 3AVPA 1THMA 3T9BA 5LQDA 3UICA 1EZ4A 4KHPB 2VQ3A 4EHFA 3WMXA 3H0CA 1H3EA 1RE1A 5BOSB 4HGOA 3D3KA 5EHGA 3RVBA 1QQAA 1C7FA 3KUKA 2FSVA 5AXCA 4WACA 4EA6A 1CUHA 2WV7A 4NU6A 4RQBA 4EUEA 4LZOA 1SN7A 3RC7A 4LOJA 3RG8A 1GR0A 2NSLA 4R1MA 4QATA 1W7AA 4IHJA 2BJHA 2CZQA 4ZCPA 3R3WA 4RH1A 4ZOQI 1EVKA 3DGFC 2B5OA 1VSVA 1Z8NA 4K03A 1KMQA 5H68A 1WDMA 4Q3KA 4CFSA 3DKIA 2W6IA 1GFZA 3QVSA 3DLAA 1ECPA 4MV9A 4R6WA 3TOCA 3LY9A 3WIOA 4CM8B 4EL0A 4F84A 1NNEA 2O7QA 1D09A 1RAGA 1TQ6A 1ISGA 2FYTA 4Q1EA 5AICA 1GG5A 1MVLA 3VAAA 1Q11A 3AINA 1KAOA 4DDWA 2Q5EA 4EQZA 5A9SB 3M5PA 1SH7A 4H6VA 3HKBA 3NDJA 3ROXA 3AVYA 3UM9A 1EUZA 1Z4KA 5IZCC 4JD5A 1GSIA 2NLOA 3CH6A 3B9BA 4WOJA 4LCEA 4AQDA 3VOAA 1NBME 3G5AA 2PX6A 4IS3A 4CMJA 1G8JA 1FUKA 1Z0KA 1TCVA 5I4CA 5C37A 3W2TA 3W2EA 1WHTB 1YZNA 4N3GA 2LKDA 4DVJA 2D0IA 4FJ1A 4FYXA 1YKFA 5TV2A 4MITA 5FNVB 4TRMA 3PC2A 4G0VA 3IRUA 3ZDAA 4CCYA 1JDSA 1NXSA 1C2YA 1G3MA 3ONEA 4J90A 2IF0A 1CZRA 4LNAA 1Y6QA 3WVNA 3MHTA 3DWGA 3NTUA 1T0UA 1Z39A 4JODA 1ZDMA 2P9GA 2BFWA 2CFRA 2W48A 5L4SA 1ACMA 1UZAA 3AEUB 3E9RA 1NY5A 2NUAB 1K8RA 1MNQA 3I9V1 1NBOA 4F2PA 2Y0DA 4R6XA 3TQQA 1MJHA 5ALOA 1OCEA 4N8SA 4Y3UA 6ADHA 3MNFA 4O4IF 4Z9FA 3VZPA 1UK9A 2GN9A 1KQPA 4XCVA 1VFPA 2F64A 4GVXA 3VHRA 4UVIA 3OUZA 3IHWA 3AM5A 1LD3A 2WD7B 5ALMA 1LBSA 2WVAA 4E14A 5G40A 3EDQA 2QL7A 3GGCA 2GB4A 4NESA 5TGDA 4EY3A 1PJTA 2FMXA 3WNQA 5FDFA 5FAKA 2BGWA 1M2JA 3L1UA 1WY7A 1PFQA 2ZPUA 1JSZA 2BEJA 3MT7A 4HDAA 4I50B 4QWWA 5LKRA 1T0JB 4G85A 4PQGA 3IV6A 4D9HA 1U2QA 1GNLA 5TPWB 4EBBA 5JRJA 1FFHA 2QN9A 1XNHA 2YJ3A 2BHSA 1WQ1R 1Z2CA 1E0DA 4MMZB 4TL7A 3SHVA 3HS3A 4PCVA 4BZQA 5JDIC 1RTKA 1QTNA 1GXSA 3C3BA 2ACEA 3BK1A 2FMHA 3FDXA 2EX1A 3V2HA 5AM3A 6YASA 5IJ9B 3U4QA 1BXGA 1JLRA 1WQ4A 3E48A 3ZLBA 3NHKA 4TSKA 4QM7A 3C6ZA 1ZIXA 2W2KB 2X4IA 3W5UA 1YJQA 2JFFA 3KFXA 3QOFA 4JR1A 4PWYA 5BN4B 2EC5A 4E5PA 1YZHA 5KDDA 2J46A 4UATA 3S68A 1JE1A 2OQRA 3W7BA 1R6DA 1IHDA 3OM1A 1WKCA 3BIWA 3C5VA 4DKXA 4DG5A 5JQGF 1DJOA 1QZXA 2P67A 2XNSA 3LPLA 1CQZA 2JKZA 3D8NA 2D4AA 4LHZA 3M83A 2D0PB 3R3UA 2II6A 3VC7A 4ZDJA 2Q1YA 5B4TA 1IYZA 1H2AS 4X20A 2HQBA 4H17A 2ERYA 3GEGA 4RMGA 1PTJA 3IQDB 4B8YA 3M6AA 1HFEL 1ISSA 4ZOLF 5ALUA 1R15A 3SF8A 2Q4EA 3FF1A 3O74A 1PUJA 2I03A 2R7LA 1T13A 4J75A 4RGBA 5FPQA 3ZE6A 4DIEA 5A3JA 3UNXA 3UAVA 1WVGA 3CV3A 1V8ZA 2WMOB 4KFRA 2VJDA 1JAXA 5CVJA 1W46A 1Z4IA 1SCNE 4HL6A 2GCGA 4PEVA 1LTQA 3LYUA 3Q0TA 2SKEA 2EHDA 2PKWA 4DCUA 1Q1EA 3NYIA 2CMFA 2DPMA 1QFYA 1JT2A 3AMVA 5FFMA 4AQYB 2VPYA 1Q2UA 4YH1A 1NW4A 2QTAA 2W6JD 1QUEA 1ZJJA 3B3GA 3C8HA 4ZV9A 4GBJA 2PMEA 4UHCA 2WVGA 4MJXA 2XKKA 1OX5A 4EIWA 1GSOA 1RQXA 1OIVA 4TTRA 3TRKA 4C6TB 1XNRB 1KGSA 4GC9A 4BYGA 3W9SA 1L5NA 3FIJA 1WPQA 5D01A 4JBNA 5K0BA 2ZUFA 4ZTZB 2ID9A 1JHOA 4OU4A 4HGRA 2CLDX 4KNWA 4E5YA 4BV9A 3A3OA 2HOQA 4RY0A 2P8JA 3E3LA 1VJGA 5JATA 2JFXA 3UUWA 7REQB 1DWUA 3RSSA 1DG1G 3MAAC 2A14A 3FPFA 3O8OB 4L8WB 3HE3A 4UBIA 5GPBA 4D8XA 4DDMA 1JIVA 3N2KB 3ROPA 2VDJA 5G1OA 4D79A 3RIYA 4AP5A 1FFGA 3RVQA 1KFBB 1ECFA 1D5CA 1WDLA 1LI4A 5C7IO 1II8B 1BQ4A 3CEMA 2R8BA 3EVBA 5JEDA 3SGLA 3PHLA 3E9QA 4M8LA 1SOMA 4Y7CA 5K0EA 1FDTA 3LK6A 4XYGA 4MXDA 1NFFA 1LRJA 5DT9A 4K81B 3DV9A 4DKJA 2EJWA 5KX5F 3FCCA 4D26A 3GUUA 3RKRA 3L7OA 5I4BA 4TLEA 3KCNA 4LXGA 5E1DA 5HM6A 3T5MA 4BC1A 4BB0A 2OYRA 4AJ2A 2J9RA 2QRNA 1N1MA 4FZ3A 3GJYA 5CVCA 3QRWA 5BRJA 4RDXA 3VHXB 2GK4A 2QZJA 1D6MA 2DMRA 2H18A 3UAXA 3V8QA 1E2EA 1ZQ9A 5KWIA 4A16A 4DMHA 3H5OA 3QBJA 4QG7A 2FJPA 3Q11A 4ALIA 2ZT6A 2Y71A 2JW5A 1QBKC 4TMZA 3FCYA 5K0SA 2EARA 4FMCF 2XE6A 2AN1A 3FPAA 2FQXA 1LDGA 1JQBA 3PDIA 4BGVA 1G3RA 5KYWB 1SVNA 3OT4A 4AUMA 1XZLA 2YXNA 4CCAA 3GLQA 2GK7A 2LDBA 4PAQA 5SY6A 3U4DA 1SU6A 2K2WA 4J2HA 4Y6LA 3MCAA 4FGUA 4WWHA 3C4VA 2XVAA 3TNJA 2ZB2A 1DKNA 2XQKA 2TSYB 3LL7A 3UJ7A 4DRZA 1JFTA 1FJHA 2AOTB 1C8VB 2PWAA 3L0DA 4L5CA 5FI0B 3SHQA 2RJOA 1KP3A 1PNQA 1X14A 4INPA 1P19A 3KEFA 3WWZA 4F3KA 2Q5IA 1DT3A 4CIDA 5JCOC 5I01A 2B3DA 3BWDD 3ZYCA 3RGGA 4MIKA 3UB3A 2H1FA 4A27A 3QLVC 3F5FA 1JJFA 2O8DB 1D03A 4JUBA 4D0SA 4WKOA 4LKOA 3M4YA 3DZKA 5T4FA 3TX2A 4CQMD 3ETDA 2P1RA 4MKRA 4OFZA 1AGNA 1R12A 1XTIA 2IUSA 2XDWA 3PQDA 2IEDA 5FOUA 3DT9A 4R7GA 1ZM4A 1W581 1GTG1 1QB7A 3DOUA 5I9BA 3VV2A 3K71B 4EY7A 4YFYA 1IBCA 2H7CA 3IP1A 4DC0A 3X44A 4B34A 2H2AA 1B8UA 1Q7GA 5EWMB 3U3ZA 3I0NA 5LB2A 1ODCA 4N01A 3ZEIA 2ZANA 4M1TA 1UPFA 4U63A 4UVDA 3ZY5A 1EUYA 4NMLA 5CVTA 5CNIA 1LDNA 2VJLA 5EGSA 2QTNA 1QGED 2FX5A 3BICA 4OFWA 1I4TD 2FEOA 4GX0A 2AQKA 4RH3A 1HDYA 4KXXA 2B82A 3EYWA 4LRWA 4R1NA 3O2SB 3OE4A 5HSGA 4CF6A 4CWAA 2WHQA 5IULC 3TZLA 2G09A 4EUSA 2HPHA 1DQYA 3OUUA 4FGWA 3RAGA 4A6PA 1XK6A 4RKWA 3TTTA 5IYZF 4DCPA 3FVVA 3LQFA 4Z4CA 1LA2A 5JDCC 1KYVA 3CTPA 3K31A 3R8CA 5CT5A 3H17A 3U7QB 1A5AB 3DMGA 1MO5A 5KNBH 1GV0A 4MRVA 5GM1A 4LISA 4OI4A 4YCAA 1FTSA 2QG9A 4LDJA 4Z5XA 3KJEA 4HNTA 3KOOA 3BWCA 1E6MA 5J63A 3GDFA 3JASA 3N5KA 4BGUA 5JCXA 2GESA 3QWIA 4TS3A 1MRZA 2Z8YM 4BEVA 3LECA 5HUJA 1FJ2A 3AFNA 2F1OA 3GPBA 4EW1A 4BZPA 3ZI4A 4DDHA 4QOFA 3P0IA 3KC2A 1CIJA 2H1CA 2HBRA 2I3GA 3L4BC 4CQNA 1IRIA 4J1TA 4YMLA 1W2HA 1XJ5A 1IONA 2XITA 3GZ4A 4OCZA 2NO4A 2IWRA 1E64A 3EGDA 3WISA 5AW8A 1N5OX 1HG0A 1SCDA 5A4MS 1HZZC 5J2TF 3CKYA 2OOKA 1OWOA 1XRQA 3DMYA 4R2KA 1PK8A 4XD7D 2GCIA 5KYGA 2Y05A 2Z1NA 4Q1DA 1NTOA 1SBHA 1JTFA 4L0CA 3OO1A 2HA3A 3R0JA 1GV1A 2HLHA 4MUIA 3CWQA 4Q7KA 2BL4A 1KWKA 3HHPA 2UV8A 1U0HC 3AETA 5AWFC 5TT1A 3GH1A 3NEJA 5M7EA 1GGKA 4JI2B 3AEZA 3K32A 1ZH2A 1XXHA 4XLLA 1HXHA 5TGZA 4CM1A 3MMXA 1THZA 3K5WA 5JAZA 3ZGLA 5SYNA 2H2GA 5FOTA 1FFXA 2PUBA 1U7WA 2C77A 4DG8A 4B76A 3AG6A 1YJ8A 3L84A 4NZZA 1YBHA 4K0KB 1T2UA 1E79A 2GCOB 2PHZA 2QN2A 2JIZA 2YZ2A 3NJ4A 3VZCA 1J49A 2DOKA 2J7KA 3N6XA 1IQPA 4V02A 3WBFA 1NMQA 1RXIA 3KR0A 4AMGA 4W7IA 3V7WA 2EU8A 4CEJB 1NMZA 5K20A 1AXEA 1TT5A 2G9RA 1C7QA 4DLXA 4FTWA 1U1EA 4XE5A 1BDJA 4UDOA 3RIHA 4XJVA 3ZE2B 5JI2E 1Z5VA 3IKLA 1AURA 1E1QD 1GZ7A 1HL7A 2VFAA 3MGGA 5JC8A 3Q72A 5JJKA 3ICWA 3BMXA 4DV0B 4MYHA 1PDVA 4Y8VA 3DHYA 3QJ5A 4CW7A 3ZU5A 4FQ5A 3THSA 4EPYA 3DGEC 3U13A 1HFWA 2OG1A 4YDQA 3T52A 3LL4A 3QFSA 5INTA 1OTHA 4I8DA 1PZEA 1YU6A 3KUCA 2BI7A 4JCOA 4EQ6A 5DN9A 2H4YA 3W3AD 2QXYA 3WSWA 3G0HA 4ZV4A 3WHKA 2B2CA 1JR3E 4X1OA 1SXGA 3N8DA 1GP2A 1W1WA 1YUNA 2H5EA 1M2VB 3I64A 4L15A 4UUNA 3D6NB 1G6OA 2AR9A 5FTLA 5ER9A 1E58A 3OT1A 3PR2B 5ALSA 1I3KA 5BSEA 3C7KA 5K01A 5K03A 4EKEA 1U0GA 4PN3A 4QQNA 1FSSA 1FFCA 4UXJA 5DV9A 4UPVA 3OQNA 5IM4A 3KU1A 3O8RA 3SPXA 3ZDEA 1T2AA 2GKGA 1BD3A 3K5HA 3P0JA 4QLAA 5KJ1A 1ABBA 3WB1A 2HK8A 3KAPA 2FTKE 4R54A 5BYBA 2WIGA 5SZIA 3PHHA 5TS3A 3N2GB 1I1HA 4DYHA 1WHSB 2IT1A 3HB9A 4IJQA 2MCFA 4RVDA 3GU3A 4M88A 3WNDA 5F5NA 3I2YX 2W8BA 2I7DA 3ZDXB 5LZ5A 2PD4A 3B53X 2WKQA 2DU8A 5LYJA 2QP3A 3AEKB 3DQZA 4KSBA 1GTMA 1DRVA 4Y9RA 4MCHA 3T7KA 3K70C 3CRRA 4G4JA 3RS9A 1Z5PA 7YASA 1T8TA 2X8JB 3LIPA 4GI5A 2OVFA 4L51A 4LVCA 5C51B 1EK6A 3NIDB 3I1YA 3P94A 4NDAA 4ZZ1A 1EJ6A 1NNI1 3IELA 3SYRA 2G4LA 1H94A 2QW8A 3AUUA 2Q5HA 4R3NA 4WLEA 4U5QA 2W9XA 2YZNA 2QUKA 4WZBA 3M1IA 5KQLA 3CH4B 4YHHB 1ZMOA 1NVKA 1JZQA 3K0SA 2MTBA 3PU6A 1X1BA 5FB3A 5CBKA 5H4GA 2ZWVA 4BUCA 2XYRA 2ZREA 1G38A 3ZXIA 1LWNA 4HFMA 3CUVA 4JKYA 1EKXA 1IMJA 3NVMB 4UMEA 3GLFA 3HBFA 1M76A 3IT3A 3LXRA 1B3RA 1P1BA 4PFQA 5F3DA 3RFTA 3FOCA 2ZYRA 5FOXA 4GLJA 4PZUA 4H60A 2CJWB 1F2DA 2J7PD 2X3UA 1U7XA 2XJ9A 3CGGA 4MVJE 3SICE 2A67A 5A02A 2XMSA 4D8VA 4GHWA 4YCDA 3MCUA 3TRDA 3THXB 3FMFA 3V8MA 1SB8A 2Q3HA 3VO1A 3VRHA 3VPBA 1R4NB 1P7ZA 4NJMB 1B41A 4XWKA 3N58A 1WBJB 1JHDA 3DE3X 1MVNA 3AR9A 4N1AA 3I2HA 3CLTD 1K6IA 2XUDA 4A5SA 3UMCA 2ZUVA 4BLPA 3IOCA 1XSEA 2E4UA 2XSZA 1TVEA 3EEBA 5EKSA 1TZJA 8ADHA 2OPBA 1TK3A 3KV3O 3A4LA 3C7CB 2AMLA 1POXA 4HDRB 1SKYB 1G2OA 1BU8A 1UIRA 2HCRA 2PXXA 4V1CB 1ZXBA 1HYQA 3IKTA 3IO5A 1ND5A 1MJ5A 2WHRA 4ZCQA 5HF5A 3OQMA 5IBQA 1SKUA 4EZBA 1IUOA 2R86A 3KVOA 5FTJA 3P9IA 3CLRC 5LA6A 2O20A 3A6KA 3VR2D 4ZAZA 4JU8A 3V5NA 5AW3A 1UZUA 2NN3C 5I6DA 4L7QA 5JNWA 1FQWA 2CLSA 3EQZA 2QPLA 3EXIB 3INTA 1A2OA 4W9RA 5COAA 3L1VA 4EA9A 5FA5A 2IX3A 4YROA 3K16A 4P8RA 1NXWA 3ZWXA 4FBGA 1DUVG 3B1ZA 2ZAGA 4IXTA 5TR9A 4A0RA 2BUAA 4QYWA 2AQIA 3CNHA 3ZUGA 5JZBA 4N8DA 5KYYA 2DT8A 1CIPA 3OCCA 2L82A 1CEYA 1ZMRA 1FBTA 3PI6A 4QUDA 2FZVA 4K9NA 3EG5A 4RQUA 1A96A 1G8SA 1E69A 3LXMA 3ZD9A 3GZTB 2LZ0A 4HRAA 4JFAA 2DBRA 1RVV1 3WZLA 3EFOA 4Z6KA 4W5HA 2R66A 4Y2PA 1DHTA 3C1OA 1Z2DA 2NPOA 1G66A 3QLJA 2YZMA 1VA5A 4PE5B 4J0HA 4DARA 4EY5A 5BN1A 2XXAA 1OAOA 1D7AA 3AWIA 3QIVA 4IILA 3A2NA 3JZFA 2NADA 4ZO8A 1MENA 4RF5A 3GGGA 5KPDA 3STHA 1VLJA 3BSWA 2YXDA 1KBQA 3HCPA 4RPCA 3CF4G 5J9FA 4OJNA 3N7UA 2MHCA 4GEKA 2RGRA 3EY9A 4E5SA 1CULC 3MM4A 1ABEA 1EBBA 1ESNA 5YASA 3LZ6A 4KQMA 5DHUA 5J59A 4D44A 4ZI7F 5JXGA 1J70A 2HMSA 3UJHA 3RUAA 1DBQA 3ENQA 3RO7A 4DR5B 2EQ5A 1UP4A 3LBNA 1L7QA 1HT2E 3GCDA 4DTCA 3RC8A 4XIFA 1I2MA 3OZFA 2C3MA 5AK0A 2PNFA 5ICEA 2WTMA 4HUQA 3CNLA 3JAWA 3Q3HA 4U6NA 5CLQA 1W44A 2WSYB 4AO8A 4DMMA 4I55F 4MI1A 2R6FA 2D3TA 3I5AA 4HQFA 2ENWA 3G2LA 1MP0A 3KOZA 4IEFB 1RP7A 2FY8A 2YJ4A 3ZCTA 3IYLW 3NV7A 2WTUA 3PA8A 1O58A 1RMQA 3L6DA 4FC7A 1CDDA 4E08A 3UMMA 1IE3A 1Z74A 4I81A 3ZEAA 2W71A 1AN0A 4DQVA 1QE5A 3DBOB 1ZI9A 4E6PA 1LUAA 3V8EA 3UMVA 3K6RA 4EVRA 4FN5A 3HZRA 4AJIA 1ISPA 4PZ9A 1KJWA 4B8ZA 3UZUA 4YUWA 4XPIB 4REOA 1RSZA 1N3IA 1JLSA 1VYHA 2ESRA 1E0AA 4RGYA 3VYSB 3HCRA 3OQVA 4UPDA 5KO2A 3VR3A 4F3CA 3GJTA 4C2UA 3S8MA 4BRZA 1DIRA 4DR6B 4UAUA 4NS1A 4Z3KA 1JVBA 2DJ5A 2XX3A 3QVGA 4LY6A 3DD5A 4BV2A 3GJ3A 2FW6A 5KB3A 4DB2A 1A4RA 1FK8A 4YRJA 3DE2X 2O0HA 3WQQA 2JAQA 3PXGA 4LBYA 1ZUHA 1UOOA 3LDAA 1R8QA 4KTVE 2ZR9A 3A1TA 4CN9A 4NXNB 1KXJA 1DAPA 4O4JB 1BYIA 3PT9A 3GBPA 4BLWA 4ZMSA 3F1KA 1CF2O 1EBUA 1QZ3A 2XDYA 3G2QA 3KYIB 5CJJA 2VJOA 3HJAA 4DDUA 1HT0A 2WWRA 3RUFA 4M0KA 4D25A 2M32A 1B4DA 2HIAA 2EBFX 2LBPA 2PKQP 5J2UA 5ALFA 3VV3A 4DPKA 2P3LA 1EHYA 4OXIA 2QSJA 3EBLA 5LQRA 4OQ4A 4O2AF 1WBBA 1KYZA 3JQFA 3R3ZA 1K86A 2KLHA 4JLNA 3SSNA 2BEVA 1I9CA 5EFZA 5JCPA 4E88A 2BH2A 4IRXA 1E3EA 2WIBA 3THYA 3H5LA 5COBA 4NARA 3G1TA 3M4NA 3J81A 1LK5A 3MCWA 3X2EA 4F5ZA 5JOQA 3SEZA 2O5RA 3DBRA 3B1VA 3QXHA 4FLEA 2EWMA 2WJVA 1XMJA 3RK4A 4DLBA 4JJIA 2XRZA 4QUJA 1N2EA 2CJPA 4ZU6X 3QBTA 3H8WA 3MWEB 4EABA 5CB0A 1N9GB 3F9RA 4KZKA 3I12A 2HBZA 1O4WA 4WXYB 3IXQA 1K5HA 3C1TA 4URYR 2XE7A 3IOEA 3QVTA 3S2EA 3TSAA 4YMGA 1U99A 4RTOA 3G0IA 2RHRA 3ASUA 3KRTA 4MPRA 1YA8A 3N7AA 2DM6A 5TS2A 2JVKA 4CTOA 4K87A 3WWDA 4MUMA 4PYIA 1W5BA 3L8MA 1EK0A 5IDQA 2C7OA 4ZEWA 1HETA 1DQPA 4WCVA 4XEHA 1VRWA 3K92A 3TLAA 4MHTA 4DWVA 4AWBA 2FFBA 4QT0A 3RS5A 2ZATA 4ND3A 5IN5A 4EHIA 3CRW1 4HLCA 4JLDA 3CWCA 1NNUA 3FBTA 4N9WA 4DM4A 1NR7A 2ZR7A 2A9KA 1L5FA 2B25A 3OETA 1EFCA 2IDMA 4Y6SA 3IP5A 3IAM1 5F7OA 2WQ6A 3OOHA 1PYGA 3K35A 1PWZA 4ZVQA 5DM70 1LC0A 2YYZA 3EQ7A 3PKZA 4YLYA 4G0UA 3VO9A 3ITDA 5K5EA 2VP6A 4LG1A 2HXGA 4UEOA 3SZMA 2AZ4A 2PMDA 4XWAA 1YJ5A 2O2IA 3PUWA 1CB7A 3G59A 4ESVA 2C5LA 2RBGA 2P2SA 4NBTA 4LF9B 3DPUA 1X2BA 4LFCB 3NOOA 1GL3A 1XRRA 2PFGA 2VUHB 3ABRB 5AW0A 5ESDA 2GAFA 3ADPA 1RS0A 4OQEA 3W79A 1E3WB 5IUKC 2BDUA 6AT1A 3KELA 1QS0B 1EUDA 2FWIA 2OO5C 2PWYA 4KC0A 2IOYA 5F1OA 1XXLA 3K1AA 3X1YA 3K05A 5BWLA 1S2IA 2YFQA 3K4QA 2V9CA 1TTQB 2Z2XA 3WL6A 3ZD6A 2K6GA 1XMSA 5ES3A 2NUPA 2BKEA 2C0PA 2R60A 1E2HA 1GN8A 2WZCA 3LHIA 1ZPDA 4RJKA 2C5AA 4ZV7A 3WL4A 3VR4H 3PTAA 3VBEA 3NNDA 2W6PA 4RH0A 1N2XA 2HA0A 2JLCA 1T9AA 2AEEA 3SJ7A 3VFDA 2R4TA 4GXTA 2QL5A 3LUJA 3PUXA 1E9EA 4GYWA 6Q21A 1DDIA 3DE5X 4P3PA 2VTBB 1EK1A 2P4UA 3NHWA 4G01B 1UPXA 4IZIA 3SC6A 5DHFA 721PA 3ENVA 4BEWA 3UO8B 3ANLA 1KFCB 4B7CA 2DTDA 4FHDA 4MPPA 1FL9A 3M5WA 5BSFA 1JFLA 2PZFA 5T6MA 3BHNA 4XZ3A 5FWXB 2NT4A 1WPRA 3A28A 3G5LA 1FFAA 3D1JA 3O8DA 2Y1GA 3U4MA 2A30A 8OHMA 2D7JA 4KO2S 5ALYA 4YJ2F 1GLNA 2R68A 1M66A 1TZ2A 2YNMA 4HATA 2EKPA 5KWSA 1NULA 4MAMA 1ST2A 2HJSA 3U4IA 3LH5A 1A9OA 2VZEA 1FBNA 3C5EA 4TRNA 3JD1A 2XWJI 1MEEA 1QH1A 5ICFA 1QYDA 2C8VA 5CXUA 5JHHB 1UP7A 1SK8A 1KEWA 2H3EA 4C22A 2R1VB 3E9NA 1EFRA 4AB1A 3DC7A 4NXMB 4ZIRB 2EFHB 2H1WA 2QXTA 4TMTA 3K0KA 4BVKA 4EJFA 3OCXA 5CU7A 1SXJA 2OO7A 4DAOA 1T9DA 4ICIA 1SUFA 1TFRA 2EW2A 4OUDA 5BMVF 3RIEA 2JAOA 2JEYA 4I1YA 4QUEA 4WECA 3N7TA 3OKFA 5BQPA 2GTPA 3AKZA 2G17A 5I48A 8ATCA 4ZHQA 1FQOA 4JKIA 4WERA 5BY2A 1K3UB 2W7TA 2VT7A 1TA0A 1AHNA 3NWJA 3NHZA 4HY3A 4NIMA 2Q6VA 1HNZB 3PG5A 4HNAA 4HQOA 3HRKA 3AW9A 3V3TA 4EFLA 4MB0A 4MVCA 4J49A 3N2NA 2Q21A 5B6IA 1LSUA 1XRPA 3OX2A 3R24A 3V48A 3NOQA 2HCFA 3BSSA 4A0FA 2JAUA 1JH9A 1ZA1A 2O50A 1XZEA 3CNQS 4I5DA 4Q7QA 3L6CA 3E8XA 4IEIA 3L7IA 2YZKA 2CV2A 1OSNA 1PVDA 3KJZA 3OZGA 4KEAA 4Z4FA 4S12A 2KYRA 3F8SA 3CRVA 3RS7A 4PYRA 2QJRA 5T64A 1CCWA 1F1JA 1EX1A 4KN5A 1O97C 3DYBA 1I0ZA 3EF0A 4FMDB 4ID3A 5TQJA 3S2GA 2Q4RA 5DCLA 1DRJA 3GLIE 3LP5A 4C3VA 5BSTA 1G64A 2HA5A 1Y8QA 3I8XA 4IUDS 1BW9A 1PD0A 1V7QA 3P4YA 4G2TA 4NR0A 2FR0A 1G6KA 4JX9A 3SX2A 1VE3A 3VX4A 2BEWA 4GLFA 3RVDA 1RXEA 3UJCA 2GNPA 3QKTA 4L85A 4YJ3F 4G9EA 1TJ5A 4G26A 4F6RB 1X1QA 4UQLA 2AOUB 2H52A 3QW2A 3N0XA 5L3QA 3GGJA 5J5AA 3R9KA 4F71A 3HV2A 5I8PA 2IYNA 2P78A 2G6TA 2ZDGA 3ZWMA 4QFDA 3Q1KA 4OHRA 1W29A 1ADCA 4CM3A 2XUIA 2UDPA 1THTA 3K9CA 1Z8FA 3CX3A 1JAZA 2B1GA 2ZRKA 1QDEA 1I10A 3H13A 3NBUA 3VNQA 3ZIUA 1ID8A 4HDMB 1U5CA 3UGKA 4GMGA 1ZEMA 2PX8A 3OAAA 3HVIA 4ED9A 4YRZA 4JLAA 4BIMA 4P0PB 4O2BF 3KQUA 1YKSA 2GN6A 2CJXA 1T0BA 1M83A 3C6BA 5DNAA 1KSHA 2O0MA 1UFQA 2FMUA 3GLHE 2XBUA 5IXSA 2ILVA 1AK9A 1JMKC 2C2KA 2QVYX 3V4FA 3E5NA 2ZBPA 3QPBA 2FZ4A 2PS1A 2YWHA 3BH7A 5KCMA 3SDSA 3G89A 3SU8A 1KEEA 4H4CA 1XQ1A 3KNZA 4OXRA 4IH9A 2H48A 4C0AC 2KHZA 2FN8A 2XTAA 4IIJB 4P3OA 1SCAA 1CR0A 4LBZA 4OSEA 3ER6A 2Q0XA 5CDFE 4UFNA 2F1RA 3QTLA 4URVR 5I7HA 1KDTA 1Z2OX 3RVSA 2J85A 3DLPX 1OLXB 2I4LA 1DKLA 2RDMA 2V8BA 3NPAA 2Q3JA 4QWMA 5F2KA 4H0CA 4D98A 4P93A 2B3TA 4ADSG 1ODSA 1XCBA 2NT3A 3CT4A 3AR4A 2WWFA 3P97A 5CP8A 1QH8B 1K3FA 4RJJA 1LX7A 3GW8A 4X90A 2E6UX 1T4MA 3EQ9A 3P26A 3A6JA 2OGUA 1OF1A 3MCVA 1II9A 4CIAA 3MFQA 4L9SA 4M55A 1NXTA 3UIEA 3CUSA 1Z18A 4RM2A 2E4XA 3I39X 3OECA 3ON5A 2IZ5A 1Z82A 2LIPA 3OFSA 4LGMA 1DMRA 1KTIA 2QTFA 5ALHA 4DJTA 2WFZA 2V6IA 3QXGA 1P74A 2B6HA 2RJNA 4GBED 4RSMA 4X97A 6GPBA 1Y3BE 2CK3D 3BXGA 2GN1A 2GILA 3EIQA 3DTYA 4QPCA 5HOEA 4B31A 2H31A 3OCJA 4WNAA 3UY4A 1NKSA 5C3UA 5IT4A 1Z17A 1CYDA 5EHZA 1SUEA 4ZAWA 2P27A 2ASEA 3MMZA 4EJSC 2BM8A 5AVKA 5CFLA 4UBOA 5KJCA 2IW3A 1VKZA 1XF1A 2XYGA 4AMVA 4EYEA 2DHQA 3PQ2A 5KTPA 3SY8A 4LRSB 2AKYA 5JLAA 3QKWA 4O4HF 4Z3OA 1I2ZA 3MBIA 2D1TA 1KSGA 4ERXA 4B4WA 5BUCA 5KNDD 1ZUD1 2J1LA 3AY7A 4M22A 2V1XA 3RS8A 4KV9A 3RE1A 1Q92A 4AX8A 4BJ1A 4EF5A 3U1TA 4F9EA 3CF0A 2QT9A 2EFCB 1JQAA 2YJ6A 3CR7A 3F6PA 4PU0A 1KZ6A 2JASA 3FFTA 3HKEB 2BCJQ 4FHGA 4QDTA 1U2ZA 3GFSA 2V8OA 3I1IA 1PG2A 4Y67A 4D6YA 3QUSA 5AR1A 5JG7A 4CYMA 5KQGA 1EWYA 4F5EA 5MN5A 3MB8A 5DWVA 4CM9A 4LBVA 3E7WA 4RY2A 4OHYA 4LXXA 1FU7A 5C8YB 3DVLA 5DIFA 3U1BA 4WH0A 2A88A 2NU6B 3HGQA 1SD2A 2FDXA 3P2OA 4K1XA 4N18A 3EXFB 121PA 4UMFA 4BJHB 1M1XB 1V4NA 4OIMA 1WKVA 2QTZA 1J8VA 1S1MA 1MB0A 1SCJA 2VL7A 4RL4A 4TS9A 3RYCB 1JR6A 2JNWA 2XXJA 5AKIA 2G06A 3L0ZA 3UHPA 3NH9A 4DV1B 1NJSA 5M29A 1NHWA 2OXFA 1FFSA 1M0TA 3LW7A 5TPZD 1AQIA 1GGJA 1SUSA 3UCFA 3V1YA 5FFNA 3ZHZA 3LA6A 1F7UA 4O1HA 2A5FA 1UBRS 3Q0EA 1Y3CE 2JAWA 3QSYA 4HWTA 4AY3A 3WTBA 4WNCA 4AZWA 1YBMA 4JJ4A 5JRDS 1ZLXA 3OOJA 4W6ZA 5JYCA 2AWOA 3ANNA 1V26A 4DXDA 1YSCA 4EB8A 4MQBA 4MO2A 4LOAA 5KNCD 2W90A 5DBHX 3J81k 3NKVA 3L6OO 4PANA 2CDNA 2BBOA 4KO4S 4ZEMA 1SB9A 2SICE 2ZB8A 3KJGA 4FOLA 5A4KA 1EFPB 5FWYA 1JAYA 2H4XA 3O94A 4WBNA 1UUFA 1ZONA 5AHOA 4QTXA 4CT0A 3LUDA 3T3DA 1U8AA 3WYGA 3NP7A 1FQJA 5D85A 2Z83A 3DTVA 3HYSA 1E6KA 1H69A 4WV3A 5HW0A 5A7GA 1CZHA 3AEQB 2G1JA 2ZI6A 3ZY4A 1KO8A 3QYPA 5EP4A 3TO5A 5LA6F 4MQFA 3WJ1A 1EB9A 1C0IA 2PU5A 2PX0A 4RPGA 1QRAA 3PNYA 4ODIA 3PRYA 4LMBA 3FVTA 4X44A 4CLXA 2OD2A 5ECGC 2QT1A 5DTJA 5TEVA 3UJNA 3UAGA 3I5YA 2GDJA 2HIMA 2CMHA 3JQDA 3T4EA 5TLSA 2PGAA 4DBLC 1P2UA 4YP9A 3E9CA 2RHHA 3AJRA 3HH8A 3Q7IA 1J0CA 1WLYA 1SOWA 2G07A 3LK7A 5DM4A 1T29A 5TSDA 1VMKA 2XGMA 1NBMA 4J0CA 3DEYX 4YK7A 4C14A 3ACDA 1R5NA 1B7GO 1JZTA 1N75A 2ADMA 1A5TA 1FXUA 2QLNA 1QAMA 4G23A 5B53A 3UWMA 5C80A 1JSLA 2PTHA 4B6OA 1J07A 4NMXB 3UJDA 1AQNA 1C3EA 2MR6A 2AXEA 2YWFA 3FDZA 1OH6A 2YIJA 2EL7A 2WWYA 1TCCA 4NE7A 1E61A 1QM5A 2BMJA 5IRCD 2X0EA 1Z16A 2WAYA 3FUTA 4KXUA 1MV8A 1MQ9A 5I5GA 3WYFA 2QKYA 4Q1VA 2FPWA 4LJ9A 1U80A 2GZRA 5ESRA 3O1HB 3OIGA 5A06A 3OZWA 4YX9A 3MAGA 1V1MA 3Q1LA 3K9WA 1C8BA 4R1PA 2OECA 3HCWA 1ADGA 3K4PA 1SPXA 4OBWA 2OQ2A 1DXYA 1SVSA 1XYVA 3FNQA 2OCLA 4Q3EA 3DV0A 2B92A 1FLVA 3QFRA 4QL3A 1SRQA 2QXUA 2PCJA 4JXZA 3M3DA 2C31A 3RNOA 4E70A 5TEWA 1JP7A 2GEJA 2R9VA 2ZE5A 1N5JA 3CSUA 4XYBA 7MDHA 1JHRA 1ORDA 2Z98A 4IUYA 3V8VA 2ZIXA 3DHWC 2FFJA 2A0YA 2VP5A 3DA8A 3QJYA 5EINA 4W5RA 2AEJA 2X7HA 1KMNA 2CUNA 3HCFA 4GR4A 2C61A 5KOJA 1E5QA 5ICMA 1ENOA 4C7XA 3K70D 4EGFA 3KKOA 1N0VC 3RBAA 1QIFA 3EIEA 3T61A 1X70A 3LT4A 4Y9DA 1V8FA 2N0SA 3ZCVA 3S2IA 4MP3A 4K6OA 2D0OB 1WSAA 1XDZA 2V03A 3OHPA 2Q8QA 1Y6RA 1QO7A 3O8LA 4MI6A 3K0HA 1OZHA 5HIMA 4ZJZA 3EIOA 1YOVB 3S55A 5KQSA 1ECGA 1QX3A 2HF2A 1CDEA 3PV0A 4JCCA 3A4IA 5ADHA 3T3PB 4BN0A 2C7QA 3HCCA 1Q19A 4P4SB 2RK4A 4UU8A 1JTEA 5C5DA 5DRTA 3O84A 1LDBA 2YW2A 1DFHA 1Z6PA 3EUEA 4PX5A 3ZQ6A 1ZRHA 4L8GA 2JKYA 2PY6A 1TE2A 2FPLA 2XMRA 1KPHA 3RARA 2PSFA 2PZAA 1KOLA 5IWAB 3DO5A 3VYTB 3UWOA 4YPVA 2BONA 2CXPA 3D7RA 1B73A 3GT3A 3EH1A 1TU3A 3OMWA 4C3OB 4JOSA 4CQLB 3DAPA 5FI3A 1V1RA 1EVQA 1EVZA 5CK5A 2QVGA 4ISBA 2DVMA 4TWRA 3IR6A 5HQTA 3MRTA 5JTTA 2AE2A 5HYVA 1NQ5A 1UXKA 2X2PA 3TKLA 1UM9A 2OV6A 2DBVO 3ZQJA 3SZRA 2JVJA 2Z9BA 4IAOA 1ZN9A 5DNVA 2E4VA 3DEHA 5HEKA 1A5ZA 4BP8A 1DFIA 3IIIA 4EPXA 5K3OA 1SUPA 2PH1A 4X95A 5CFMA 2XE4A 2C88A 4DXHA 1UC4B 4EOGA 3FOZA 5GONF 3N2LA 1G7CA 4RU1A 1PR1A 3A37A 3CLRD 2O4CA 1X92A 4L2IA 2J5BA 4V03A 4CKBB 2ODEA 5HG0A 1H4SA 4KQ6A 2OC9A 1YQGA 1MX5A 3LLCA 3SJCA 1G7TA 3QFFA 4HJRA 3KEGA 4NAHA 2GBPA 3SNHA 3VKWA 4O63O 3W7AA 3H5NA 1UPUA 5IAOA 1MH9A 2IHYA 3ADOA 3LC0A 1EPUA 1PSWA 1V6CA 2RGBA 5HJ5A 4GM4A 2D5AA 1BAPA 1F2UA 3BZWA 3WLJA 5JSFA 3S28A 1P8AA 1K4MA 3AF5A 1KZ9A 1XRNA 2ZRMA 3AP3A 3HBAA 4RHFA 1UKAA 4H1TA 1USWA 1YZTA 5EAIA 3VU3A 4HJXA 4D46A 3NWBA 3D8TA 4G0NA 3KFVA 5IHPA 3JQEA 2VK1A 2H9YA 1TB4A 2ZETA 4HOYA 1XZCA 3ZHRA 5BVHB 2BFAA 5JCJA 5DM60 4C9BA 2RHWA 4EI8A 4BBJA 2RGUA 1JWAB 4Y2UA 3M33A 1T3TA 4QXQA 4PAGA 4H59A 3TPZA 4AMBA 5LQCA 3QYJA 1IBRA 1ZKDA 3GZNA 1Y6JA 1XJ0A 3ZWVA 3E15A 4Q7JB 3MW8A 3R4VA 3IMCA 5JV5A 1ZCFA 2PKQO 1VL1A 3R7LA 4JWTA 2BFMA 1GRVA 3FNFA 4OPMA 3FFBA 4ZZ0A 1Z5OA 2B36A 3K09A 1L4BA 5BQOA 5L53A 1SHZA 1OXTA 5JXWA 4YRBA 2JGMA 2XMZA 3V7UA 3F7MA 2P6RA 1AN9A 1OFUX 1V71A 2N9UA 4IIHA 4YJFB 3QEMB 5FYDA 1D07A 2I1VB 1KK1A 2KLBA 5K51A 1CP2A 3WAJA 4Q3NA 5EJMA 1ZP6A 3I0ZA 2A9PA 4IF6A 4JUCA 5LLDA 1Y4DE 4KKXB 2WD9A 5JMWA 1W9MA 2FHSA 2QTBA 1YFKA 2UZ1A 4L28A 1OFVA 4URWR 2R1TA 2BCEA 4MWDA 5DW3A 4F1KA 3OCWA 2AEMA 3MC1A 1ZH4A 1E59A 4HEQA 1PL8A 1SVLA 2HN9A 2SHKA 4TXMA 4W82A 2D74A 4ND2A 2Y9PB 2ZIVB 1UMCB 1Z9BA 2RGNC 4YJHB 4LECA 1IMOA 3DAOA 3Q8WA 2VQ6A 1G2QA 1I80A 4HAUA 3GAFA 3BKWA 4F5YA 1HYGA 1QCDA 3PFNA 4JJZA 3OH8A 4L73A 2DWUA 1DDOA 3QA3E 3IP8A 5FPYA 4YC7A 3VNRA 3ZKWB 4ER7A 4K6FA 3FSEA 1VOTA 2A1TR 3R1IA 4HQNA 2NZ2A 1Y3IA 5IEBA 5CNMA 1T5OA 1X77A 4DSAA 3S81A 1JEYB 4WXHA 1VSUA 3UUFA 3HL4A 3TOZA 3LWZA 1NAIA 4G5GA 4DABA 1AS3A 1P3JA 1PV1A 4NCXA 3ZD7A 3C8MA 1PR0A 4EA8A 4XVHA 1U8EA 3RRMA 3IH5A 4XD2A 2WE7A 3FDFA 5DLDA 3TLGA 3ESRA 3CVXA 1KDRA 2YV1A 3V4RA 3R3JA 3ZC3A 3KTFA 4KRGA 5CB6A 4PG4A 4DIUA 3QEKA 2VPWA 3GT0A 2NV6A 3H87A 3EEQA 3NH6A 2YY5A 5DNDA 4ZDIA 3HKBB 3MUNA 2PUFA 1A2BA 3JAKA 2JEZA 3PVZA 2X2OA 1PR9A 1D7OA 1K66A 1L7XA 1IULA 1V0JA 1QE3A 5EN4A 3F8WA 4LRYA 4WIAA 5DNUA 5ITVA 2V74B 1YBVA 1Z33A 2FSGA 2OSVA 2Y4OA 4YEDA 3UXHA 3CEPB 3WLSA 3O03A 4YT8A 16PKA 8MHTA 4RTNA 1B0AA 2Y1DA 3C2QA 4HVCA 3C85A 2FCAA 1DC5A 1P39A 3R7WB 1E2KA 1O6GA 1SC9A 3NBQA 1VZ2A 1UKBA 2JH8A 4K9KA 4RYLA 3LGAA 3KTDA 1Z0IA 3JATB 3N9IA 1SCQA 4JENA 4UZSA 2K4MA 3X1DA 3UHJA 1T9GR 2XMDA 3KSAC 5IVKA 2UZ4A 1C1XB 4E5MA 5CAEA 4IDBA 4IHKA 4NAUA 2UUCB 3DPSA 3DBLA 3IALA 1NVBA 4HB0A 1XK7A 5LA6B 1ENZA 1W0KA 5B1IA 3JAMA 5HTOA 2YJTD 4IDDA 5EHNA 4KQWA 3TNFA 2OORA 2Q5OA 2F3SA 1S8FA 2I6FA 3PRKE 4KWTA 4JJAA 4F46A 1NY6A 3CG0A 3WMFA 5BNTA 1IH8A 4B3MB 2ONKA 1TUEA 4UHFA 5I45A 1IZ0A 1DOAA 2ZGVA 4YDHB 3M6WA 4YCNA 4KSYA 5IDXA 1NRIA 1IHPA 1CUJA 3W6UA 3DHVA 3RJMA 4HWOA 5JXIA 3BRWA 1VE9A 1VYTA 4COKA 3B1WA 5IXJA 2H5JA 2CB0A 1PBNA 2NTYC 2WP8J 2CLLB 2IYOA 4IIUA 1AUVA 1MKYA 1TQ8A 3KSZO 2AJBA 4LUCA 3QFHA 3CSSA 3M6XA 3O8QB 4M1KA 1YR2A 3BILA 3EEFA 3MSXA 1SHLA 2GOYA 4PFJA 5KJEA 1CKEA 1CY0A 2FXIA 4MUJA 4PC7A 4TTAA 3V9PA 2IPLA 4BKMA 1TOAA 3EGEA 1YHYA 1CUXA 3S2FA 2FU5C 4HTAA 2YVLA 3OIYA 2J5RA 4R8RA 4G1CA 2VJMB 2C92A 3WKDA 3W34A 2GEKA 3DNMA 4HDSA 4ZCRA 2GTHA 2MSCB 1I2BA 2WDZA 1YBFA 3KYCB 1K0FA 1OFGA 1QK5A 2RGDA 5JAPA 4ZDWA 1U4SA 3T7IA 1YQEA 2AKAB 1S8NA 3T7DA 3R6WA 3PWTA 1UKEA 2Q4TA 2X42A 6CHYA 3MJEA 1J33A 1YZGA 3HRHA 1L6RA 3I04A 4PLWA 4Z8XA 2R6CA 2IXAA 3STTA 4E4TA 4EG3A 5LOVF 2PWPA 3I05A 4XGNA 4M9RA 3UWKA 3NAGA 2RIPA 1ADBA 1XB2A 4MR7B 1UXIA 3AIIA 4JVLA 4K1LA 3AV0B 4AUNA 5DSXA 3LPAA 1Q7CA 1YIAA 2P2LA 5JAQA 1Z5NA 4J1NA 1F6DA 1U3DA 2A1UA 2AZMA 2V7QA 5K3EA 1GOTA 3ELBA 4LC1A 3OEEA 5KYVA 2L42A 3K3PA 4GOKA 2I76A 3ZW7A 3KZXA 1AS2A 3O4VA 4KWIA 2IBTA 2VOJA 2QTTA 2WJ3A<