2XTJA

The crystal structure of pcsk9 in complex with 1d05 fab
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
Knots found
sequence length
268
structure length
242
Chain Sequence
PWNSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLILFSAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibody
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title A Pcsk9-Binding Antibody that Structurally Mimics the Egf(A) Domain of Ldl-Receptor Reduces Ldl Cholesterol in Vivo.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 242
sequence length 268
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2xtjA00
1GA6A 3A3OA 1SUDA 1S2NA 1C9JA 3P5BA 1BJRE 5FFNA 2B6NA 1A2QA 5CW1A 1WVMA 3H42B 1PEKE 1TM1E 1GTG1 2QTWB 1V6CA 1SCAA 3VTAA 2HD4A 1KE2A 3T41A 3GCWA 4BWGA 1BE6A 1MPTA 4J94A 1WMDA 3DVRX 3F7OA 1Y34E 3BPSA 5JXIA 1DUIA 4ZOQI 1AU9A 2E1PA 1SUPA 2SICE 3VHQA 1SCJA 3CNQS 2XRMA 5ARDA 1THMA 1Y3FE 3VV3A 1WSDA 4KB5A 5FAXA 1GT91 1JEAA 2G4VA 3ZXYA 1Y3DE 1SELA 4CG0A 3EIFA 1S02A 4LVOA 1SBTA 3SICE 3EE6A 2Z58A 4AKTA 1AK9A 3BX1A 3WIUA 3I34X 5B1EA 1DBIA 3QMPA 4NE7A 2HPZA 5AQEA 3AFGA 2SECE 3DW1X 3GT4A 4DZTA 2Z57A 1TO1E 3UNXA 1AVTA 3PRKE 4HX2A 1SVNA 4DWWA 2PKCA 4I0WB 1Y1KE 4FONA 1GNVA 3LPCA 2W2PA 2IY9A 1T1IA 1GNSA 1SBCA 1WMFA 1TECE 1KDYA 1Y4DE 4WOBA 3LPAA 3LPDA 1TM3E 3DE7X 4KPGA 5I9SA 2XTJA 1GTL1 4OV6B 1MEEA 1SIOA 2WV7A 4GI3A 1XF1A 3WIVA 3Q5GA 1UBNA 2TECE 2W2QA 3A3PA 1PFGA 4NE9A 2W2MA 2ID8A 3CO0S 5B1DA 3VSBA 1C9NA 2V8BA 1Y3CE 3DVSX 1BE8A 2Z2ZA 1PJ8A 1CNMA 4C3UA 4H6XA 1T1EA 3HJRA 4Z2AA 3Q40A 1Q5PA 1C9MA 2ZWPA 5AMXA 1AV7A 1OYVA 1YJCA 3TI9A 1T1GA 2ID4A 2Z2YA 3AJ9A 3GCXA 1Y4AE 5FBZA 2Z56A 3VYVA 1BFKA 1SUBA 4M1ZA 1KDVA 2Z2XA 3DE3X 2ZRQA 4H6WA 2IXTA 1SUAA 3DDZX 1TK2A 1ZVKA 3EDYA 3SQOA 1R64A 3I2YX 5JXHA 2X8JB 3I30X 1BH6A 2ST1A 4K8RB 3D43A 1AF4A 3DYBA 2W2OA 4B5LA 3AJ8A 1NLUA 4KG7A 4WOCA 4DJ5X 1TMGE 3D9QX 1OT5A 4OMDA 2GKOA 3TI7A 3I37X 1AQNA 2X8JA 4CFZA 1SCNE 1ST3A 3DE1X 3GT3A 3WHIA 5SICE 3TECE 3WQBA 1EGQA 3ZXXA 2Z30A 3LXUX 3OSZA 3VV2A 5AVKA 1LW6E 2WUWE 2DP4E 4RYDA 1YJAA 1KDZA 1Y33E 2PWAA 1SPBS 3DE4X 2DUJA 2DQKA 1TM5E 1Y48E 4CFYA 1PTKA 1C3LA 5JMOA 2PMWB 1V5IA 2PYZA 1SBNE 3A3NA 3DWEX 3F7MA 1OYOA 3DE0X 1GA1A 1SBHA 3DW3X 1NDUA 2W2NA 4YN3A 1WMEA 1SUCA 1ZVJA 4H6VA 1S01A 3DE6X 1IC6A 1SCBA 3L1KA 4NMXB 5JXJA 1SIUA 4ZARA 1GCIA 4JP8A 1SBIA 1NDQA 2PQ2A 4HVLA 1ST2A 3DE5X 3DVQX 1YJBA 4C3VA 4LVNA 3BGOS 4MZDA 1BFUA 3F49S 4OMCA 1SIBE 1VSBA 1R0RE 3PTLA 3QTLA 1YU6A 1SH7A 1KE1A 3DE2X 1R6VA 1P8JA 1CSEE 2WUVA 5JXGA 2PWBA 1HT3A 1EA7A 1SUEA 1P7VA 3QFHA 1IAVA 2SNIE 2ZWOA 1TM4E 5K7SA 5ARCA 1SCDA 1GTJ1 5ARBA 1TM7E 1Y9ZA 1Y3BE 2SBTA 2PRKA 4AKSA 1TO2E 1GA4A 1SN7A 1P7WA 2WWTA 2P4EA 1AH2A 5AVJA
chains in the Genus database with same CATH superfamily
1Y6ZA 3EDOA 3H6HA 5HQ3B 1Z35A 1DDIA 3ZDCA 2N42A 4GICA 3C7KA 2OCPA 2JFWA 2VT7A 2Y93A 1OFUX 3DAHA 1NRJB 4C14A 5ESDA 4II2A 4GR9A 4QVGA 2ESRA 3RROA 1M6HA 3NBUA 5BVHB 2Z5LA 2F9FA 1B42A 3PENA 4WBXC 4FFLA 5IAKA 1GPBA 1V8FA 5K8LA 2QTWB 1NYRA 1TUEA 1ISSA 4DV6B 5FNZA 2XNDA 3HN2A 1CUYA 2NO1A 5I01A 1X7XA 3MS7A 3DO6A 4X91A 5JVDA 2MDTA 3ACCA 3GCWA 4ISCA 4I55A 2OCAA 1K8QA 3WGIA 3RU3A 3X1ZA 1J8MF 1U2ZA 1Y1SA 2BOVA 2P9JA 3LQQA 4WINA 3ASZA 4F91B 3LQ1A 2H9AA 3CR3C 4W1QA 2ZBFA 4LFBB 1XNQB 1G66A 3PUWA 4L85A 1H1DA 2ZTMA 1E69A 1AU9A 3TRIA 5KOJA 1RTTA 1UBHS 3BHJA 1EEXB 1JHMA 4LJSA 3TLEA 3ZK9A 1BDIA 2GKSA 1RBMA 5BVHA 1SY7A 4OHUA 3S1LA 2WNHA 4S1TA 2VHWA 3KXIA 4EELA 1M2KA 1B14A 2H6EA 4V0QA 2ZOSA 3IKLA 2BEKA 3PQ4A 1KC3A 1JHZA 2EQAA 3AF0A 4FOLA 1DBPA 4RLHA 3IHTA 2BKLA 2OFOA 5HF8A 3VR5H 3ZNPA 3ZLUA 4Z6KA 5ED0A 2QJRA 3ISJA 4TWAA 1R50A 3S6JA 4NC9A 4OQYA 1RQRA 4QL3A 4PYRA 1ZGCA 2ZIUB 3PEFA 2XGMA 4BYMA 1ZUHA 1R3DA 5A7FA 3M3PA 4M22A 2B61A 5KYTA 1A76A 2HBZA 4FEEA 1OPXA 3WLTA 5E2IA 3GVHA 3JWHA 5CLQA 2B92A 5DYYA 3TR6A 3SZMA 3U1VA 2FH5B 3P45A 4AXBA 4U8GA 1T5DX 1DJQA 2NZVG 3V8NA 5IBCA 4XZ3A 1M6WA 2B3DA 4HNHA 4DLAA 4Y2SA 4N3CA 4QTUB 1P77A 1XDDA 1KH1A 2FZ4A 2FUKA 2YV5A 4HQNA 3OZRA 3ULKA 3PICA 1QYIA 3E4DA 1PNVA 1B8PA 2W2LA 1J90A 3U4HA 2ZTLA 4DMCA 4P0QB 1PFUA 4RSGA 3SF8B 3ZBQA 3T8YA 2PE5A 4YUYA 2DBVO 4PPNA 2GAOA 3LUGA 1FZTA 1ZP6A 2CHQA 4G9EA 5IDXA 4OHXA 1K4MA 1PZGA 1JR3E 3M1LA 5IKXA 2BI4A 2PMFA 3N86A 4JITA 3B8EA 4RPIA 3NVKI 4TLMB 3M49A 5EXEA 3TZCA 2H4XA 4PQYA 2WJ4A 1D9XA 2AI2A 2GZRA 1QTIA 3E27A 4EG3A 4NU5A 2A1UA 3MXOA 1V26A 2GN4A 5BMVA 2Z57A 1FCJA 1M74A 4PR0A 4C20A 4XVRA 2CHUA 2E5LB 1C7IA 1NR1A 3H9EO 2H8GA 1YRBA 4KPEC 2CHEA 1W1IA 4C78A 4K88A 1JHQA 1BHO1 2XITA 1P18A 1JDSA 4WKCA 1Y1KE 2P91A 3FKJA 3MD9A 3UFBA 4FONA 4C0LA 2HF9A 1E3IA 2Q4BA 2VNJA 5AK4A 2W71A 4U00A 5F7ZA 3VR4H 1SXJB 4A16A 3QEAZ 3PXCX 3WXBA 1YK0A 4FFPA 2C8JA 2AZ4A 3PGLA 3FI0A 4HGNA 4ACAA 4BJ1A 2IKQA 4JXZA 1A5ZA 4G07A 1JHRA 3QNMA 2C7RA 3AINA 2V3VA 5A06A 2WU8A 2B20A 3SHQA 2C7OA 3S7ZA 4N0DA 1Z5ZA 3HL0A 1N4DA 1OXBB 2AOTB 2GZ1A 3S28A 2I34A 2X2OA 4X3CA 2OB1A 3OUZA 1UBEA 1CR0A 1WCWA 4LFCB 2E4XA 1CT9A 2EG9A 1YI1A 4JYAB 2NU9A 2WMNB 3LQ2A 1TEHA 4V39A 3WY9A 4BFVA 4JI3B 4U63A 4EHKA 3AI3A 2AWOA 4N0EA 1KVQA 3JQFA 1W0KA 4M8NE 3KTAB 2DLDA 3OESA 4M7RA 3R7DA 2QD1A 1SXJA 5HBGA 1GN8A 5HA5A 4IDNA 1GTL1 2ATXA 3CQ9A 3V00A 1RU3A 3NTOA 4J1NA 4OV6B 4WDRA 2W98A 4IIXA 4TLAA 2VNKA 4EFKA 5B3JC 4O4LF 4YMWA 1QH8B 3QVGB 3OFVA 1T2UA 5FOTA 4EVSA 3ODPA 3PU6A 1G0OA 2AOTA 4GI3A 3MUOA 2B69A 1SU4A 2GXUA 4S2UA 3DQQA 1ORWA 3JZMA 4RO0A 4NOLA 1V3UA 1IEWA 3R5JA 4IWYA 1R0CA 3NOVA 1IQRA 4QJ5A 4V2UA 1I0IA 3M5WA 1K7FB 5H0IA 1SBZA 2C96A 2O1WA 2REQA 3VRHA 3E7PA 2HT1A 1NP6A 3MWJA 3KTAA 5IKMA 4F21A 2C9BA 3VSBA 5K09A 1LQTA 2Z9CA 1A9XB 2LW7A 2NOAA 2O6LA 1XD9A 4PO8A 2PR7A 2FQ1A 5EIWA 4J4BA 2I91A 3NOXA 1H8HD 1U8EA 3PFGA 4FR5A 3WAKA 4BNUA 1UANA 2B0JA 1YRWA 1BE8A 4U2FA 1XCJA 1Z4OA 1WLYA 3EWAA 4LF4B 4N40A 1UIRA 4HY3A 4M21A 1NXQA 4HUTA 4WLEA 1LLDA 3I2GA 2QGNA 1X1EA 3L40A 2GEJA 4C7XA 4D8VA 3OZWA 1Z5PA 2B83A 4N03A 3TKAA 3MA0A 4ZGWA 1X8JA 2YCLA 3JYLA 2WTBA 3GJ5A 3GLFB 4MWDA 3LUKA 2A9VA 3BK1A 4B76A 1A9XA 2MTBA 4GM0A 2HWKA 3Q40A 4C0JA 3CPSA 3WNCA 2G5TA 4UUQA 3L07A 3S99A 3COZA 4AKIA 5KKNB 1IIRA 1O4VA 1DS6A 4Q7EA 1VLVA 2G9QA 2DVMA 3G9QA 3AW8A 5INTA 2QE6A 3MFQA 3F73A 1R0XA 2WSLA 4MW7A 2MYTA 4XARA 4OB7A 3WRXC 4PRKA 2VYNA 5L6MB 2WOJA 5HVNA 2E48A 1SVIA 1ZESA 3BEOA 3ID6C 5FBZA 8LDHA 4QC2A 1DJMA 4NENB 3GRUA 1IXSB 2AC4A 3RC8A 3B36A 4HADA 1GPH1 4A82A 3A6HA 4G5GA 4I50A 4BL5A 4U2DA 4HYTA 4DLYA 2WMOB 2CSUA 2BEWA 1E66A 3TXXA 3CHYA 5JJKA 4K40A 2KB0A 4BRSA 1KI6A 3OQBA 2GJAA 1N33B 1H2ZA 2E85A 5E3HA 1A4XA 1TQ2A 4JXKA 2PRZA 1I9GA 3WGKA 4F4CA 4KO8A 1KU0A 1QIJA 5ELLA 3GLIA 3G85A 2ZM6B 2GI4A 4X90A 2QUHA 3LCJA 5JAIA 2IXEA 3SQOA 3KJXA 3D8RA 3WJ7A 5CGZA 3H7AA 4LTDA 3G7NA 4IIJA 4J7XA 3U9SA 1VKJA 3ZVKA 3NEAA 2CLDX 4NENA 4H35A 4UCFA 1FSZA 1EUDA 3OZSA 4JJGA 2FZLA 3JYPA 3OJFA 5BYJA 3EC2A 1E3JA 2ZXFA 1L5ZA 4CMIA 4QJIA 5DP2A 1VE3A 2BZGA 2O07A 5DE3A 1QH1B 2WSYB 2WA2A 3NTRA 4DIDA 5B55A 3LGXA 4QOJA 1M2NA 1AQLA 5GJWC 1XZ8A 1TIKA 3CB2A 2AI1A 1SZCA 2FR1A 3MOIA 2PVPA 5JPDA 2AOUB 3PFIA 1V95A 4OSOA 3I62A 1ZL2A 3IUMA 2LKDA 1V4NA 2XRZA 1NVUQ 4KKVA 6LDHA 1DO8A 4ARIA 2AX4A 1HC7A 2PPVA 1H2YA 1BDJA 1J9EA 2AR9A 2ID7A 1NYQA 4YT2A 4K0KB 1QMPA 3DOUA 1BFDA 1E61A 5DB4A 1W88B 2PL9A 1WV0A 2XIJA 4GYYA 2UUCB 2VHCA 1CJCA 2EBFX 4UZFA 1O95D 1PKXA 2ZRDA 2WF7A 2WLSA 3C45A 1OUMA 4DUPA 1WE2A 1YR1A 1NKTA 4C0KA 3JQ7B 4U6QA 3OE1A 2I55A 3CEHA 4JVOA 4EJFA 3TECE 4HWSA 2I3BA 5AXDA 1MVOA 1QYRA 1FFYA 3G68A 1S7GA 3PS9A 1QBKC 4FEGA 4PAMA 3KWLA 3L82B 3OMXA 3GLGA 4HAOA 2CLLB 1O96B 3UENA 2ZR0A 2C1EA 5CFQA 2B1RA 2J9GA 3A2NA 2KMLA 4QXPA 2XUGA 4K3VA 1KYZA 1YKSA 3C6XA 1SK9A 1QGOA 4QQFA 1FFXB 1DI0A 1W76A 1O0BA 3EA4A 4MHSA 4P4NA 3S70A 4BRZA 3PF8A 4MRNA 3I5XA 4OFZA 2UYYA 4FMBB 3SY8A 3RNOA 4P2GA 2EU8A 4MGZR 1L5QA 4F04A 2CY0A 4OQNA 3DDSA 2ENUA 4OXXA 2BV3A 4O4JB 3KKNA 2YRXA 2O19A 4QDJA 5IAEA 4DQUA 1UOPA 2Y2VA 1JP7A 3SOZA 3CN7A 2W48A 3GJRA 1WBDA 4JNKA 1TT5B 3WLNA 3CV3A 3UJ7A 2B9EA 4NNPA 1ZUIA 4I2VA 1JAZA 1L7AA 3EJWA 1FFXA 1G2IA 4HAUA 1OCEA 1KR2A 2C20A 2Q3EA 3U09A 4I2NA 1CUGA 4M1EA 1Y8CA 3GH1A 3CVYA 1BQEA 2ZROA 2PVCA 2JA2A 4ZMRA 1WB9A 3N8NA 3O3NB 1T5TA 3FTFA 3DZFA 1K7XB 4CGZA 3N5KA 4ENWA 5KSZA 2OHXA 3HRKA 3H04A 3IQWA 3DL2A 4LV6A 2X0EA 3THWA 3ANMA 3RH0A 2REBA 4TWJA 1HA3A 4MQFB 4TVKA 2CB0A 2H7CA 2R7LA 3A6FA 3FWNA 4Q3KA 4QFDA 7MDHA 1NQOA 1KMIY 4IJMA 4NZZA 5EWMB 3F8WA 3RHZA 2H5JA 1RWXA 1W5TA 3VSAA 5ES4B 1NT2A 3HXLA 1YGYA 2HSEA 1IY8A 2P5SA 3D2AA 2O57A 1M6YA 2DBQA 1MX1A 1L8QA 2RC6A 2V55B 3GJ8A 3LCVB 3ZCXA 5KNDH 1ND5A 3VUEA 3D3JA 4ZU3A 5CIQA 4LJYA 3TQFA 3QFCA 2EKQA 4HNUA 4IO0A 4GNRA 4P0TA 2VBFA 1SCBA 4XJSA 5AJWA 3L1KA 4IVQA 3ADCA 3OKCA 4AF8A 4KFTA 1UFQA 3G2MA 2GZDA 2DAPA 3CPHA 3UYLA 1A9TA 3KEQA 4JB2A 1KI2A 3WL7A 4MQFA 1GADO 2JGFA 4XDHA 4NZ9A 4AW9A 1OV4A 3EXHB 4YJKA 1SIWA 2GAJA 1H0KA 4HI0E 3LKBA 1FPQA 4HXFB 4B82A 4G37A 1RWOA 1VL0A 1XEWY 2PQ2A 4I5EA 4JBNA 2Q99A 4J49A 2WIAA 1TJ5A 2XYHA 1JIIA 3VOSA 4ZRNA 2QQ0A 1H4QA 3AUKA 3TGPA 3E9RA 2Q46A 3K8QA 2P68A 4DT1B 5JD4A 4D82A 5DNYB 4JKYA 1GILA 3BFJA 4E2YA 1G8FA 1WXWA 3RAFC 1TZ2A 4IVNA 1G3UA 2R47A 4PQGA 3T7IA 3TLJA 3WGYA 1NN1A 1A2KC 4PR3A 4FJ0A 4IP0A 4P5PA 2HFKA 4E2FA 4Q4CA 3ACDA 5A04A 3K0AA 3TLCA 5A2QA 4MLDA 4RVUA 3T94A 3BXXA 4LS3A 1T8UA 4HDNA 3GJ0A 2ZS9A 3VR2A 3HXQA 2FW9A 5JW6A 2Z8ZA 4MDYA 3TL2A 3DE2X 1R6VA 3T0GA 3NEPX 3WSWA 1I30A 4HT3B 2JCSA 2WPNA 2XQKA 3L8CA 5AHXA 3L6RA 3C97A 1P5ZB 2R8OA 1Q1BA 1U3WA 3TLKA 1DCTA 4DR2B 3QEOA 1P7CA 2J5RA 3DEKA 4GXTA 5BUCA 3QEKA 4YCNA 2PEYA 4G23A 1TMOA 1ONPA 4U02A 4IS3A 5FBKA 2J3MA 2PGDA 1VGVA 4IXWA 3H2ZA 2HIMA 4CQLB 4YMLA 2VNHA 1H1TA 5EYPB 4DWJA 1E1RD 4W5RA 2BTQA 3Q8MA 3AERB 1KMHB 4RD1A 5ER9A 4BO4A 5B7NA 4NZMA 2WP8J 2KLBA 1N2ZA 4ZC8A 2C2XA 1YDWA 2QTAA 4OA8A 3K4PA 4MR9A 4LJ8A 3GC6A 1EGHA 4JBYA 3VNUA 2JL1A 1QG0A 4ATNA 1WPQA 2FNAA 2GJ9A 3B12A 1ZIPA 3HR4A 3CX3A 4ZGBA 2VBCA 2XVXA 3W8RA 1KP9A 3WBKA 2NV6A 3PEWA 2JLSA 2AKAB 4QGHA 4R5MA 3TJMA 4TM7A 5DFAA 2AN9A 2IPXA 4IKPA 4DRXB 5A4MS 2HA0A 4CQLA 2QE7A 5G2OA 1JXAA 2O0JA 1Q7RA 1XNGA 4PO3X 4AK9A 1ZJ6A 5B4UA 3HYSA 5T7BA 5EP3A 2HU5A 3KQPA 4CLDA 1JR4A 1RLOA 2BGUA 2YZ2A 3ZDAA 1H1LB 5FPQA 1PW5A 1A5SB 4MIOA 3W5AA 4MW0A 1E1LA 4AL4A 4B43A 1SU7A 4FYVA 1KRWA 1VI6A 5AVXA 1NR5A 1V7PC 2QR3A 2RK6A 3EMDA 3K1AA 3O8DA 4J0FA 4LF5B 1XTPA 1ADCA 2JLXA 4YONB 1EK6A 3E8XA 4LSMA 3EQ7A 2XECA 1HZJA 3HCNA 1JVSA 3OETA 1KY5A 5DM0A 5FIUA 3FWPA 4BYGA 1VJ5A 3PDIB 1VHJA 3ETLA 2BP7A 3OQ6A 3WLEA 1FTGA 4Q4DA 4HEHA 1MB0A 4D9JA 4Q24A 3H1PA 2GM4A 4NZPA 1SHUX 1GZ5A 1TKCA 2NTNA 2ZT5A 4ZDWA 3W9UA 1AS0A 4EHJA 2Q49A 1H1LA 2ATVA 3ELYA 4ALKA 5FLYA 2WJVA 3QE3A 4M7OA 4GI2A 2H1CA 3F7OA 2WZBA 4CR6A 1X15A 3IUYA 1X86B 2J09A 3ZHUA 3O0DA 1ODIA 1I01A 2WABA 4JP1A 4LAFA 3FVTA 5K3AA 1HMYA 1YZQA 4YJ2F 1AZTA 2JGKA 2P9EA 3DR5A 4FC7A 2GVDC 2GFIA 1Z0IA 2PYDA 4IQGA 1G21A 4L16A 5HFAA 3RSCA 1A69A 3N7TA 3NYIA 2I67A 4AJEA 2GQ0A 3COPA 3FI9A 4NBTA 4WUVA 3R3ZA 2CL0X 2C2BA 3OU2A 3PDIA 3D3WA 4KOAA 3OOEA 4EA7A 4BNFA 3X1KA 1AUVA 4BVGA 1W47A 2QJOA 9LDTA 1UBGA 1UPCA 4N8SA 1QPZA 3N7AA 3FB1A 5TSDA 3TX6A 1X8XA 5JR3A 3L84A 2W6JD 3RYHA 3UK0A 3GGDA 4G01B 5IYZB 4LXIA 1Z4KA 4L2IA 4KB5A 4N54A 4IXTA 4NONA 3HC7A 1IVSA 3IUQA 2J6CA 2JAOA 3IBYA 2ADFA 4MROA 3ANLA 3PYLA 3TAHA 5JPCA 1ECFA 1N6IA 5IK2A 4P80A 3C7TA 4R69A 5EOVA 2F64A 3FR8A 4BX9A 3UC5A 1J1IA 3A1DA 4N6NA 4ZHQA 2IGTA 1Y3DE 4Y9TA 3U3JA 2W7TA 3QH4A 5IPFA 1YZNA 1ZW1A 1UT8A 3ZS9A 3QU7A 5CFRA 2ZUEA 2EL7A 4DA8A 1UC8A 3K16A 1YFKA 4R8RA 3DZGA 3U13A 2C4WA 5LM3A 5K4GA 4YUVA 1G8AA 1BCRA 4JP5A 4TN1A 1U9JA 2GDZA 2XNJA 2H4HA 1S02A 1EK2A 1E3SA 1GV0A 2QTHA 2BONA 3V33A 1R7RA 1N75A 3G9XA 1F2TB 1K8ZB 1PWHA 3P9QA 5DI3A 2IYAA 5IYZA 3RJ9A 2QN2A 5EMNA 5ALYA 4I6GA 3IQEA 2E87A 2O2XA 1ZITA 3EAQA 2G0NA 4HMQA 4X8HA 1AK9A 2R8PA 4LHWA 3CF4G 3PC7A 5IDQA 1QDLB 3WOVA 4GU5A 3U61B 3CLKA 1F0KA 4K87A 3QMPA 1DZ3A 3R2JA 1CERA 5CDSA 3E9ZA 3PNSA 4RACA 1O97C 2W42A 4FINA 1L7MA 2QG6A 3U81A 3AFGA 2SECE 4CMHA 1HNZB 2PXCA 5HE9A 4YR7A 2O48X 2GGSA 3UNXA 3OTHA 1F2TA 1WX1A 4J0IA 4MCJA 4Q1FA 1ISFA 4EPWA 4XX0A 4C7OB 4R41A 1ORRA 2CVQA 4WT7A 4E4YA 2E1RA 2PH7A 1YIAA 5CLFA 5L3RA 2YJ5A 3CEMA 3EOBI 3M6IA 2JJQA 2OG1A 3KBOA 3P9IA 3TVYA 3LUCA 5HZMA 2Q2QA 1QHEA 3CBGA 4B84A 3HEMA 4LNAA 3VXKA 3ZI7A 3A8TA 4TZ6A 2DR0A 1VIMA 4WVLA 4XSGA 3GU3A 4IFTA 2BFAA 1KPHA 1JZQA 1LZLA 1Y9DA 4HJRA 10MHA 3DQZA 2GLTA 2H85A 4IEFB 2ZIWB 3I09A 3ONWA 3KJEA 4HWPA 3FPBA 3B9RA 4DBVO 4PS0A 3NQ41 4KXXA 2XNHA 1R00A 1CB0A 2YRFA 1A50B 3BTSA 1K88A 3IV9A 4LKRA 1J25A 3UXMA 1RXSA 4IOLA 2OXEA 4YJ3B 5JNLA 3DWGA 1RYEA 3RJ5A 3U7HB 5LP6C 5TS2A 4G9GA 4JGGA 3WIEA 1JKFA 1Z13A 5E9QA 1CF4A 1U7ZA 2XA9A 3GXBA 4MVJM 2PV0A 4JJ4A 2ZR7A 1XLWA 3INTA 1ZUNB 4B4OA 1NMZA 5CTAA 1FLAA 3BREA 1T9ZA 1U1DA 4RDCA 5IN5A 4RPGA 4Y6PA 1KQNA 4CYMA 3IFSA 2CJWA 4DA6A 1UDXA 1YQ9A 1KO7A 2H2AA 1BS1A 1IZYA 3WRYA 4X62B 3F5DA 4B3TB 2HYIC 2HU2A 1SM4A 5AM5A 1E2FA 5KQSA 4R1LA 2O2IA 3W5JA 3E05A 4HQLA 5DH9A 2VF2A 4G0XA 3SXUB 3RBXA 4J4HA 2I5PO 4FWBA 4I9GA 4C0QC 5J5AA 1ZVVA 1W4BA 2Y1WA 1YS7A 4IBOA 4ZV9A 3QKSA 1OZFA 1RP7A 1OAOA 3DM9B 2ZGVA 3WLHA 4AF7A 2YRWA 2LZ0A 3DP9A 1K2VN 4G6ZA 2QDKA 4NWIA 4I19A 3VHXA 3W8FA 5FI3A 2Z2ZA 2LV8A 1WXGA 3WNDA 4P3NA 3H2SA 4RHCA 2VF4X 4RL6A 2CSXA 5JXWA 1ZGBA 3RSQA 2ASEA 4J2HA 2ZJ0A 4CV0A 2NZ2A 3K0HA 3PQEA 3G2NA 4Z4HA 4H7HA 4Q12A 5EAIA 2ZE7A 3GUYA 2H0AA 4DA7A 4B6GA 4I1UA 1OH5A 1J7KA 3LL4A 4O63O 1ULUA 3S2UA 4LRWA 5K0GA 1A98A 3D5TA 4H18A 4N7JA 5JQWA 2CJFA 1G8HA 4GEGA 2X8AA 3WB1A 3JPYA 2DTDA 2YBDA 4DMMA 4EO9A 2GK3A 1PRYA 2OCDA 1Z0FA 2CNNA 4LBWA 3LRXA 3EMVA 2CLSA 1LRJA 1Z08A 4TYYA 1F2UB 5AMXA 3R44A 1AV7A 5J63A 3G02A 1VPWA 1NX6A 4KQIA 1AS3A 2PUJA 1DKNA 4LYFA 5TMBA 1E6KA 1UDWA 1ZH0A 3DNPA 2Q0QA 3W6UA 2V03A 3QWFA 1TZCA 1QFSA 2FFJA 4B44A 3W5IA 3LHSA 2PBRA 4LECA 2NO4A 1JEOA 3MT8A 4DLVA 4ZVTA 3UMFA 2QN3A 2QLNA 2AUTA 4OFWA 5CR9A 4DC0A 1X7GA 4JKOA 2FW1A 4GI5A 1BMQA 1ZN8A 1NMXA 3SN6A 3SX4A 3T1NA 4YRMA 4QDZA 1MIOB 4DQVA 3ZLBA 3ZCPA 2ZANA 4FB4A 1V37A 2FVYA 3K0FB 4PE5B 3RRNA 2WYOA 1V3QE 2GD1O 5GINE 2QRHA 1L3BA 4HRXA 4OJYA 5KNCA 5J1SB 1NI5A 1U8AA 3USES 2PZEA 2VF8A 2IF2A 1U5BB 1GGFA 1YHZA 3Q3HA 3VZSA 4BFTA 1U90A 3NIWA 1MLDA 1R4MB 1CQIA 3LUFA 2J32A 1LBTA 2ZI6A 8AT1A 3JRNA 2E3JA 1Y3HA 4EW2A 3K05A 4XWWA 5K9ZA 5CX4A 3HCWA 5JYEA 5ICCA 4KE6A 5F5NA 1RBZA 1SZJG 2LD4A 1MIOA 2ZCJA 3K20A 3UHOA 2ZBDA 3QITA 1TF2A 3HKBA 1P60A 3D43A 3HXMA 2B2XA 2RONA 2XNDD 1QH0A 3LH5A 5AHRA 4TMFA 1AUXA 1NOJA 2AOVA 4U3JB 2C83A 3WK7A 3O1HB 1IDN1 2NTJA 1EWVA 1W9HA 4ZI3A 2JC3A 3L8GA 4OGGA 4CV3A 4LJ7A 3C5WP 2IYWA 5AW6A 1ZGJA 1EPUA 1R4MA 3OJ0A 4HDKB 2PL1A 1ZA1A 4ZN6A 4B35A 4ND7A 4UE2A 2ZRAA 2VVTA 5B3AA 2XLBA 3LFUA 1P2TA 3FVVA 1BWSA 4H7DA 4XH9B 2GILA 4MV5A 4XKJA 2MCFA 2Z5FA 2RGRA 3KZVA 2B8WA 2YNMA 2CMGA 4K9MA 4X24A 4DUZB 2A5FA 3MRVA 4BATA 2PS3A 2YS6A 3IQZA 2WIGA 4IJQA 5AVRA 3ETCA 4IR7A 3AV0B 4U3JA 4XD2A 1O4WA 2WM3A 3AWDA 3E61A 4OSEA 4EUEA 1SPXA 3AF6A 2PX6A 1NVVR 4FFRA 3TJRA 2OFFA 3BJIC 2WWRA 3PC2A 1RXWA 1TYBE 3AUUA 3HHEA 1UWKA 2PUBA 3F9RA 1H2BA 3HWX1 2ONZA 4QOHA 4WX2B 5CDHA 4Q3OA 1IJBA 4QJ4A 3VU1A 1AHHA 1YAHA 1T6XA 5FCDA 5J1TB 4EZEA 3A6EA 4YRIA 4QT0A 3VYWA 1GCGA 3EVAA 1C1XB 3VBEA 4JB3A 4AN0A 4X3PA 2RH8A 3AL2A 1FDOA 3SEFA 4E7PA 4B1FA 2AZMA 2PH5A 2QL7A 1Y33E 2I3ZA 1TT7A 1ZH8A 3BIWA 3BJRA 2W8BB 1D4FA 1VBNA 2W2LD 3C1AA 4Y1GA 4A8JB 4BX3A 4ZYTA 2KQUA 1UZNA 4LK2A 1NASA 1CVRA 4M9ZA 4IDQA 2XUHA 3EGDB 2ZXUA 1IIBA 2HUNA 2I2BA 3U0BA 1TFRA 5FL3A 1S5PA 3V8BA 1KEPA 2EYUA 4GBGA 5EUBA 2B4QA 3K70C 5IDWA 1KO1A 1NJ6A 1DC7A 1TCAA 2FJUA 3FPLA 3C6MA 1SCQA 1U02A 3EGCA 3NB0A 3W05A 1JH9A 2UXCB 3TTUA 1N1EA 1JWAB 1DAHA 4M49A 4NPHA 4U8HA 1DRKA 3GDHA 3N8DA 2AOXA 2WJ3A 3BK2A 4QU8A 2KM1A 2ZR8A 3MCTA 1KOLA 4B6PA 1VYUA 5K0NA 1NW7A 3ZWYA 3B1YA 3HEAA 4ND6A 3I64A 2YJ6A 1E1DA 4E51A 4BXOA 4KC0A 2CF6A 3RU2A 1YDMA 1DFGA 5EHXA 1E8NA 3O38A 4N5NA 1FRZA 3IDSA 4XAQA 2BLNA 4B6JA 2ZU6A 1Z6XA 3AGQA 4BP1A 4BC1A 1KC1A 1YBMA 1EDDA 2RG1A 3F4LA 3RU7A 4P38A 1KHHA 3DW3X 5FPTA 1WCXA 2WWGA 3KXLA 3WRVA 2BR5A 1HLPA 1Z2AA 3BWMA 3JQGB 1EJ6A 3TLXA 1AMNA 5CNMA 4O2BA 5DNVA 2CFOA 3VVMA 3PJRA 3DDHA 5ALEA 2M1XA 4RD4A 3V2HA 3DEIA 1CULC 3SS9X 2O0KA 2H8KA 5CXSA 5IC5A 4JJ8A 5BOSB 2ZSFA 1DAPA 4K6KA 4QOIA 3QVOA 1RAEA 2ZDQA 4JOBA 3GFFA 1KYIA 3EMBA 3SZ3A 2WKQA 4TYNA 1Z6YA 1Q6YA 2X5XA 3AM4A 3C70A 4BMDA 3DM5A 3KB8A 4DNQA 3UK6A 4AECA 2P65A 1I32A 4KQXA 4DGQA 2WC1A 3R5KA 5JMTA 4JYCA 2VDUE 3L7YA 3RFCA 1W0KD 4BQOA 1E7MA 4Q48A 1GCIA 3HCEA 3S44A 2FPUA 2VTDA 5DYNA 1RQGA 621PA 5EZ5A 1SXJD 3CPJB 3ITNA 3QF4B 4CKBA 3JQGA 4HVCA 1VP3A 2B25A 2ZYGA 4H15A 2Y67A 1BU8A 3RKUA 4IKOA 3AOGA 1LLUA 2E4YA 2VA9A 4AF6A 3G6WA 3SAJA 2MOKA 2IZZA 4TMXA 1YSCA 4INOA 1XTSA 3E7WA 3HN6A 1NVKA 3D8UA 4PZAA 2E2WA 3R40A 1G60A 1PUIA 3W8NA 1NLMA 4ZK2A 4H1VA 3NEYA 9ATCA 3H3JA 1OF1A 2Y9PB 2YWDA 1ZA2A 2ODBA 4YXFA 2XT0A 5C5DA 3E8MA 4JI8B 2FQQA 4M0LA 3EZ6A 1I7DA 2NQTA 5AUNB 1LF0A 5LNK1 5JSYA 1BGXT 3PXAA 1JI0A 4PNZA 3BMNA 2X1VA 3H6GA 3IOEA 5THQA 4RTMA 2WD7B 3Q3VA 1MJNA 1N6HA 1YR7A 2I54A 3L7DA 4Y2JA 2I3DA 4U0JA 1WF3A 2BVNA 4JC0A 3AV3A 2VCHA 3F90A 3OZXA 3T95A 2XUKA 2YV3A 4EA6A 3MG9A 2ZQ5A 3A28A 2P0AA 3OHMA 3T1TA 1TYCA 5JDIA 1GJRA 2X2EA 4KDRA 5MHTA 3AEUB 3WNQA 1ZN7A 5DTIA 3HCRA 3MTBA 3SMQA 1VLHA 2R1VA 3PC4A 4KMRA 1DTEA 4BCCA 1U98A 3HGTA 4DV2B 2FN4A 5AIAA 3LDUA 2FLWA 3DT8A 1Y80A 4O0MA 2J67A 1OI7A 5AUPB 4RF5A 4YP7A 3UB2A 4D0GA 2XKAA 3ETEA 1LGYA 3HDGA 2G72A 2XGOA 3BH6A 4IVPA 3WL5A 1I2CA 2FG5A 4XDGA 1JPVA 3GEPA 3PRJA 2CFRA 3BA1A 3BILA 4ZVLA 2IYOA 4KWIA 4ITVA 1SG0A 3TAUA 1XVUA 4OKNA 1CETA 3GT7A 3OCVA 2KBEA 2X3UA 4LSZA 3W3AH 2GUGA 5KKAA 2A57A 5CBKA 4HFNA 4S1WA 2RGUA 4UNNA 4ZYXA 3E5RA 2VYND 1SN7A 3GJTA 3DDUA 2B2NA 3IP5A 1AH2A 1FFHA 5G0TA 1M1ZA 5BUQA 2IEZA 1RRPA 3RS5A 1T24A 1GA6A 4C2TA 5I7WA 2BJWA 3BMQB 3FTNA 4GQAA 2WB4A 5DXAA 4L9SA 2C3YA 2HLNA 4EECA 1MDBA 1NAHA 1TK3A 3LGSA 3LTEA 3P5BA 4CM8B 5LD2C 4G4SP 2ERCA 1UDCA 2B6NA 1WMAA 4JJIA 4U7DA 2WVHA 3T1YB 5AI9A 3A25A 4AX4A 3DHNA 2F8LA 4IFEA 5ITSA 4RX1A 4K1LA 4A0SA 1URPA 4DSNA 3IUEA 1B1AA 1V6CA 1O3YA 2FMIA 5BRJA 1WOYA 3GYBA 4EL0A 1F20A 2OM6A 2HD4A 3O6VA 2X6QA 3F8SA 4D6XA 3EGXB 4KFRA 2X76A 4KRXA 3P4XA 4IQ4A 1AURA 2ZE5A 3OIGA 1ECLA 1YT5A 4TLEA 3NVAA 2XWSA 2EZTA 4URHA 4DWOA 4EJMA 4B3GA 4C0HA 3DPIA 4BLSA 1OX6A 1F5NA 2C5AA 3IB6A 1VSUA 4IDHA 3RV3A 2JIDA 1WUIS 4AN4A 4JVLA 4CM8A 1MJGA 2OFPA 1R0KA 2QX4A 2REXB 4RPJA 4Y2TA 4ZT7A 5DNAA 3UKJA 2QMQA 2VYVA 2O5EA 4JQYA 3CNQS 5FNVF 5EPUA 2VP5A 5ARDA 5KMGB 1NVDA 3IYLW 4OIMA 3X1MA 3D8TA 1EFKA 2BKVA 4L3VA 1RKVA 2VQSA 1AY0A 1OTYA 3LHFA 5AICA 3OFJA 1GL7A 4DCOA 2ZATA 2XVZA 4GW3A 5IN4A 2VF7A 1YCFA 1IOLA 2G17A 2JASA 4UAGA 1LPOA 1W85A 2VK1A 3FNQA 3LLMA 2VP0A 4UBJA 4LZZA 1QDEA 3VV3A 5EIEA 4EYKA 4TKVA 3WQRA 1O0CA 4F9FA 4X85A 1PI3A 5H59A 3O0TA 2AMYA 4BMXA 4PZPA 4R7GA 4RANA 1XWFA 2H57A 1RKQA 3BULA 4MI6A 1P8AA 3OWXA 2ACVA 4V0MA 2C5FA 3GMIA 4JX8A 1JEJA 2RH5A 3TQHA 4CM4B 2F4VB 3VR1A 1PBNA 3LYAA 2FRXA 3H8VA 3CZ4A 4D7AA 2CJPA 2EBUA 3QUBA 4URUR 5CPFA 5HF6A 1DQNA 1DTSA 1T36A 4GOLD 1C7RA 3G49A 3TIFA 4JWTA 2Q6LA 5KMGA 3C6YA 3PNKA 5EJ6A 2Y4OA 4ZTBA 5JTUA 1GZ4A 1RQLA 1ZR2A 1EU1A 2WTXA 1ISHA 4RMIA 5I4BA 1C7EA 1GPAA 2XPCA 5CVDA 4W7SA 7ABPA 3T4UA 3KKEA 2BFWA 5SZJA 2VG8A 2ONJA 3EZYA 5KREA 2ZG6A 1W5SA 3URMA 2VYFA 1TVCA 2A0FA 2WICA 4GBED 3DT6A 1KNXA 3OF5A 4IHJF 2RKWA 4TMTA 4PQEA 4RHFA 5DWDA 4CM4A 3M33A 1GFWA 1DBIA 2OTCA 2P90A 3GXOA 4PAQA 3RSLA 4DBZA 4FDAA 5KEIA 1A2BA 4YLEA 3ZJVA 1MW8X 2BCJQ 1G8GA 1DWQA 3GGCA 3V8RA 2FMFA 1HNXB 3PV0A 3TGLA 2PFGA 5T3UA 1IB0A 4HLDA 3VH2A 3VR0A 4C6HA 2RHTA 1S3FA 2CLHB 2Z4TA 1L6RA 4FN4A 1V7ZA 2P3SA 5IJAA 4HNTA 2Q07A 4EGSA 4A0HA 3N6XA 4H1TA 3DMYA 3HB0A 4RGVA 3HGMA 1PTJA 5H7XA 4ZEOA 2BBOA 4U2CA 5JS6A 3DOFA 1GQSA 4HNAA 3WL3A 1V2HE 1D4OA 2JJYA 2VEDA 2IL1A 1ULHA 3Q87B 5BQPA 1AHPA 3IEMA 3R3JA 1ZEJA 2F3TA 1V1RB 2QUKA 1M8PA 2I7CA 1GG5A 3FSGD 4JP2A 4B2IA 2IY9A 3T1QA 3IP9A 5JALA 3GJZA 1GNSA 2QSYA 3SX0A 1WMFA 3NV7A 4Y2HA 1XMSA 3ZE7A 1MJGM 5ALLA 3F4KA 4QAJA 2G77B 5KCZA 3R3XA 5DLYA 1IBKB 2OEPA 4UMVA 1DV2A 4XLZA 3EXAA 4G25A 2WTNA 1TEZA 1AHNA 1W93A 4S1OA 4PLHA 2VUHB 3GHYA 1AB6A 4GMGA 3QFTA 2EQBA 3WNBA 1HDIA 4KTVE 4LVUA 4OFBA 2GNAA 2FX5A 2C7PA 2HH9A 4J0GA 4MUAA 2AK2A 3PVSA 1CR2A 1IQPA 3I76A 3I5UA 2GA8A 4UHEA 4ZVQA 3RASA 5LXTA 2RI1A 1D0SA 4Z4GA 5EZQA 1D5CA 2RG7A 1JEDA 3RGGA 4WRRA 1R9MA 1MUUA 2PMKA 4HXEB 4JOQA 5JCZA 3T1HB 5D3KA 1R0YA 3LDGA 3M5DA 5FXMA 4PBRA 2J30A 3LNCA 1J4AA 4PNPA 3UJ8A 2NACA 3AH8A 4RXTA 2I6SA 3GCGA 5D1NA 5H4GA 4YAJA 3ILYA 4Z7JA 2LNDA 3Q5GA 3SJZA 4GZ3A 5KYVA 1OGJA 1UAGA 2QXTA 1DCKA 1ZUWA 3OJLA 2ZULA 2VUTA 3OZUA 4CM1A 3EEOA 1RW4A 3EXIB 1KY4A 3DHYA 1V0JA 3JWGA 3Q7SA 4FOOA 1E1YA 4G97A 4OAPA 1YVDA 4LJAA 4TMYA 1H69A 4UM8B 5DKFA 3O75A 5K6AA 1UAAA 1RHUA 3WJAA 4DMGA 5JBQA 2VHEA 2V9PA 4MB6A 4XI9A 5TF0A 4CFSA 1EHYA 4XIYA 4TV8B 1B74A 4TS9A 3P0HA 2DUUA 2IXFA 3MS4A 4QGBA 1FXWF 4RTJA 2VKTA 4NVRA 3PQ7A 1RAGA 2VQFB 4NFSA 2XDQB 4IJ6A 3DFFA 3LGAA 4R9VA 1H5QA 4M0EA 2OQRA 3VR2D 1PJ8A 1QGYA 1ZI9A 1KYVA 3F6EX 3IUPA 2Y76A 3PHGA 2HGSA 1UQRA 3O8NA 2JKVA 4IAOA 5BQOA 5JT1A 1W2WB 3QOFA 1N6NA 2RFLA 4IW3B 1F9AA 5BW8A 1NG9A 2HDOA 3JRXA 4BKQA 1HQYE 5ENDA 3FZQA 1B26A 2P9YA 4WA7A 1Y1LA 4DR7B 4OA5A 1M7BA 4E3WA 1X13A 2XMPA 3QNUA 4EG1A 2HXGA 1JQBA 4M7PA 5BWBA 1VJ1A 2P41A 3USCS 1PT8A 4RABA 3ZWMA 1CCWA 1EG7A 4QBKA 3P94A 2XDQA 221PA 3T9AA 4DLWA 1E2QA 1NI4B 1BKDR 1IBRA 4ZVMA 3FUUA 4E30A 2WU3A 2Q1TA 5A6SA 2XT9A 1BA3A 1JPNA 3ZHTA 1QP7A 5GV8A 2B7LA 1PJZA 3FKQA 1RJFA 2BM0A 2GF0A 2ID4A 3THRA 3OCXA 3UK2A 4JZKA 3EPKA 4FYIA 2AKEA 3I5YA 1YF3A 4LPSA 1UJNA 4I1OA 5KHAA 4GXRA 3TKYA 4EG7A 1L7QA 1FPMA 2DHRA 3EIHA 3ICQB 1AKNA 3L43A 2G40A 3JR7A 2ATCA 4PG7A 4PWYA 1Q92A 2GZAA 3FYUB 3GAFA 3PUHA 3LSTA 1LFDB 1SQ6A 4K28A 4IZHA 2QE7D 5EL0A 5L3ZA 1WV1A 4Y1RB 4QUBA 1PR5A 4JP3A 4IDEA 3RJZA 3W6ZA 3FUXA 3WDSA 3SXPA 5AIBA 2Q2WA 2V5VA 3FCUB 3AR4A 4PAWA 3Q7TA 2YV2A 2NT4A 1NI4A 3R7FA 5IZCA 2A3NA 4A27A 2PCLA 3DDZX 3ADBA 3JVDA 5E0OA 2QYHA 2VI5A 2WP0A 4M36A 5I9LA 4EX7A 4F8EA 3OQNA 5AKGA 3DKKA 5JUWA 2WZQA 3QPAA 2EIHA 3BQMB 1OLXB 1A8QA 1XN1A 4IIDA 4UXJA 5AI0A 3EPLA 2GPTA 2NO6A 2X8JB 2H1RA 5KU1A 1JEYB 5E7IA 1WUTA 2PSFA 1DE0A 1P5HA 4KQ1A 3CONA 4K8RB 3SM3A 4ZICA 5CM9C 3H5LA 1NMSA 1AF4A 1P4RA 2CYAA 1YBVA 4L57A 5G3YA 1O94C 1ZVMA 2FDRA 2GPAA 2WDZA 4WOKA 5M2QA 1DC8A 4PX9A 1Y6FA 1E4VA 5LB2A 3TZ6A 1ECBA 1I7PA 3NV9A 1JBKA 2WSSA 3H1GA 3IV7A 4GOXA 1LBIA 4GVXA 4ND1A 5AK5A 4P7GA 3CEAA 1VA5A 4MMYB 3ZK8A 1LDYA 2YZMA 2Q1XA 2YXEA 4Q4HA 3JYNA 2XGJA 3BE6A 2FPIB 4OLAA 1SR8A 1F06A 2EIXA 4EF6A 1EWKA 2VR1A 3QTBA 2P62A 1JB1A 1BEUB 5BSGA 5B36A 5CVTA 4TT8A 4XEUA 2X8JA 1EP1B 3CSUA 1ESNA 3FHOA 2D5AA 4HXGA 5C8VA 1P5JA 1JEYA 3M82A 1PFVA 2RAPA 2JCXA 4U4AA 4YCDA 1VKRA 1EH5A 1T35A 3Q6NA 1UPAA 3DE1X 2ONYA 1PWYE 1T5SA 3RUHA 4C4TA 3UMJA 2BSQA 5ICMA 1XDWA 4LTNA 2RGBA 3O4HA 2JLWA 4NX2A 1GL3A 4JGIA 3HP1A 1J2TA 2GYUA 4S05A 4CTMA 3SBEA 4CMJA 4FWTA 5GZ3A 5GPBA 4MQUA 2Q0HA 1RRVA 3C3MA 5EE9A 5KPJA 1NPYA 2CCJA 2XMCA 3QJ5A 2XJ9A 2XMGA 4QPJC 1X1AA 3I92A 3NT4A 5IK2D 3MSXA 4D3DA 3WRWA 1IJEA 4BQPA 3UIEA 4BZXA 2QEQA 1G8JA 1KY2A 1Q0UA 2VPIA 2Z3WA 4V0SA 4UU7A 4P4GA 1C0KA 3VV2A 3AB3A 4XIFA 3ZV3A 3FHJA 4HN9A 4ZHQF 6AT1A 2R7NA 2JCGA 4RF3A 1OXSC 4QOSA 4ALLA 4QEKA 3RTEA 4QM6A 4TROA 4BBJA 3OM0A 4X20A 3AKCA 4QNMA 1W5FA 2C2KA 5EIFA 2OMEA 3GEGA 2WPDA 4LWOA 3COWA 3NKVA 3V32A 2YIJA 5GADl 4C4YA 1E3QA 4YCBA 2DM6A 3DFUA 4EYOA 4Q3BA 4EH1A 3LIPA 1RJGA 1V5WA 3Q15C 1SPBS 3LXMA 3R76A 2XQGA 1ATIA 1KYYA 2GO1A 3N3BC 4R7TA 3FXAA 2QRZA 5HKKA 4P54A 4BY9E 1KYWA 1PTKA 4Q15A 3C3YA 4RGQA 1HEUA 5TQ2B 2RJOA 4AG6A 4HEJA 4DR1B 4FU0A 1E18A 2I0FA 3WGJA 3BERA 1Z2NX 3OFNA 1ZCBA 3D1LA 3IMKA 3FH0A 1V5IA 1B3BA 4GOOD 1TCBA 2IXAA 2NSLA 4LQ4A 2ZYDA 4A0FA 3E4CA 2NT3A 3FWZA 2HL6A 2YJTD 1FRVA 4GOMD 4QG7A 1I0LA 1YZ3A 3F46A 3FBGA 4LGYA 4YJHB 2O8BA 4CKXA 3GJ7A 5KYYA 3VR4A 5KWIA 4DEXA 2ZZKA 4LHXA 1MG0A 1SHLA 1GQ2A 1T6NA 4II3A 4Z3DA 3WQSB 3VO1A 4AMBA 1OOEA 1QH9A 3OIUA 2I2WA 1XZJA 2JNWA 1WHTB 2R5FA 3NHPA 4NYJR 3DEYX 1AK2A 2BGKA 3B6JA 3C4JA 4D5GA 2GEFA 1OU0A 5THKA 2H17A 3FZYA 1TA4A 5TQ2A 3PIIA 2IBSA 4UHKA 1ZRHA 1SBQA 2QDXA 3AU9A 2D0IA 3NDRA 4UOEA 2XGSA 1OH8A 4FILA 4YMVA 1B8VA 1SB8A 4YJHA 3ZXUB 3EVNA 3WTCA 3VDNB 1IG0A 4IO1A 5IBPA 2GJSA 1YCDA 4KSBA 3G0OA 4KLAA 1XYVA 3SDZA 3T15A 4CKCB 1R6TA 1XLUA 4NK4A 5C0OE 3U7RA 1WHTA 1PDVA 1PGNA 3HUEA 4NG4A 4L95C 1QCDA 1RAAA 4Z9AA 4ARVA 1IULA 5AD1A 5I7RA 4IVRA 4K46A 4B6FA 3N8HA 4CT4B 3M2PA 5CXUA 1LNSA 3CG4A 3LLCA 4H6PA 3PPVA 3T7EA 4R1MA 1E8MA 3EFOA 1DUVG 1RJ9A 1VCHA 1DQRA 3L6EA 4F7WA 3P52A 2O05A 1QC5B 1BNCA 1LXCA 1ODTC 2AN3A 4JU9A 2OV6A 2QTBA 1BWRA 4AVYA 4OMUA 5F12A 4UUAA 4N3GA 5KTKA 5KYWB 1JS1X 1L5YA 4TUYF 1OIXA 5CVCA 3U0VA 4RETA 3QVTA 3F49S 3M3HA 4OMCA 3TDMA 1UMBB 3N5CA 3T7JA 1N36B 2R6JA 4CQMB 4CKCA 2HZBA 5PNTA 2XAUA 2XCQA 4TLBA 2J0QA 3PZBA 5JBNA 5JZBA 1D6SA 5DLQC 2BZSA 1KA9H 4OHRA 2OHOA 2I99A 3K2QA 3NTQA 2RCNA 4B3DA 3ZH2A 1OLSA 5LVAA 1EGMB 2XX3A 3UW3A 3BSWA 1L4LA 5LYYA 1FU8A 3RC2A 2HJGA 3B1WA 3T9FA 1Q0QA 2A6PA 1H22A 3AESB 4MMZB 1XZMA 1N2CA 2BBTA 5FI5A 1IBCA 2A30A 2TMGA 3DOHA 4MWTA 1NHWA 2I78A 3KV3O 1KK3A 2P5TB 5JFGA 2VLBA 5DX1A 3RS9A 1F8FA 1KPIA 1UMBA 4JSRA 1C9KA 2LDBA 4Q9JA 4K9RA 3V34A 4CQMA 1X39A 2WBLC 4HS9A 2RAVA 3ZE1B 4IDAA 1X0VA 4Q3CA 3SNKA 4CM9A 3UJ9A 1MC5A 1QP8A 2HSZA 4JLOA 4YCMA 5HR5A 1GTJ1 4ZO8A 4MW2A 3AI1A 2JI8A 3PR1A 4UUNA 2V7XA 4V0KA 4F4DA 3HI6A 4A6DA 3KZMA 5L6LB 1F3OA 2PGJA 4TTPA 3AVPA 2H63A 4EHNA 5KTOA 3A05A 3U26A 1PNOA 2HQRA 1PGOA 3KSUA 1U0NA 2JA1A 3K71B 3WXMA 2CNWA 3T7CA 1D7OA 2M32A 4G8CA 4TYPA 3C5VA 3OPYB 3L8DA 3GD5A 3WWZA 2CDRA 2A33A 5KQRA 2DPHA 4UHDA 2C2WA 4RSHA 1VSQA 4QVIA 3HJNA 4LJLA 4OKSA 1N0HA 4YCLA 2C77A 3OEEA 3NVDA 4ZKDA 3AVTA 4KDFA 1OASA 2Q2OA 4LY3A 2A8YA 1MVNA 1ISRA 1E2MA 1ZNYA 2DKOA 4I08A 3KSDO 3ZX4A 1KBZA 3D6JA 2IZ0A 1KO8A 4Q93A 3PNQA 2XQFA 3M89A 3R5HA 5IJ9A 3V4FA 3F9CA 2JS7A 1JALA 1C9JA 1EX1A 1N3YA 4KLZA 4BLWA 4F11A 1XJ0A 4HZUA 2DXIA 3Q9LA 1A2QA 1WXIA 4MVJG 2ZRKA 4XUCA 4N8DA 3U19A 2BE7A 2IHVA 1B00A 3IP1A 5KNCD 1YACA 2CD7A 3WAGA 1XUOA 3PT9A 4PLVA 5DEOA 5FPHA 4BDSA 4IRXA 3QBJA 3P9ZA 2OHIA 4P7JA 1G9SA 5JAPA 5LNK6 4G2NA 2XAAA 2YXPX 3PCTA 4FYKA 3IEUA 4MV6A 2BHTA 2IPAB 4D99A 3TE6A 2HRCA 4G8BA 3WGVA 2O2ZA 1PJBA 2RHDA 3K09C 3M6XA 2DG2A 4R1TA 2IQIA 3C85A 4BNHA 1AKMA 3GJQA 1Y34E 1PGJA 2A4MA 3QYPA 4UNPA 5F4BA 1N78A 1Z0AA 4DLLA 2WYVA 4PICA 1L5RA 4KN9S 4YWJA 4LYGA 3IAFA 3W4JA 5AM4A 3GVXA 4BEJA 1O8BA 2VC2B 1AQUA 1KI4A 2NZUG 1AGXA 2YVAA 4HN2A 3R74A 2OLJA 1NRXA 4D3XA 2C95A 1T4BA 2ZAYA 3UAWA 3W3ZB 3U2QA 4IV0A 1JR3D 4W9RA 3U9LA 1M10A 4B6SA 1L2TA 1EM6A 3H5OA 1UXOA 1R1DA 1YRAA 1R6UA 3FNFA 3H16A 5FL7A 3D4BA 1LRKA 4ARBA 1RLIA 2WT4A 3GMSA 3P2KA 1H94A 4CU5A 1YDHA 2YNMD 1BC5A 3D0OA 5FD8A 2EJWA 2HGZA 3B2NA 3PE3A 2AF3C 1U65A 2FQWA 3JAWA 4PCAA 1QF7A 5DMHA 2WNIA 4KODA 4UBOA 4V38A 4Y2PA 1O95C 2JIBA 2QTNA 2V54A 3HJBA 5E4YA 5HRCA 4DDVA 1GSOA 2CHGA 4GPZA 4BAZA 3H4MA 2MWMA 3IQXA 3PPXA 2GB4A 3CUTA 1D2RA 5C8YF 4QQ8A 4K8OA 2HEGA 3UQZA 4M0MA 1JVBA 2MHCA 3GQVA 4KI7A 2RGAA 1KI1A 4J0JA 5C53B 2F1HA 3BX1A 2YN2A 4JOSA 1Z0ZA 4BWVA 2PUEA 4EB6B 4W7IA 3L7AA 1HDZA 2R84A 2ZWIA 4A92A 1DIRA 2VSNA 2YWHA 3B51X 1JJFA 1I3LA 1KVUA 3P26A 1NJGA 4G81A 1J6UA 3SC4A 4J43A 2RDMA 3E3LA 5BPFA 2MJLA 4HPJB 2AR0A 1RJDA 1N5IA 2Y0EA 3CF6R 2AE1A 1RAHA 1TYDE 3VMFA 4RD3A 3DW1X 2Q2VA 5BN5A 3PB3A 1NLZA 1QNFA 3AONB 1XKXA 5CVJA 2GNPA 3MWYW 5HUJA 4P4TA 3LT1A 3QYAA 2QM7A 2QIPA 1KVTA 2E89A 2LWIA 3RRBA 3T12A 1BGWA 3MN1A 4H1WA 2WRZA 1ISMA 1LJ8A 3I8SA 4L08A 4X93A 3VM6A 4B32A 4B3HA 1M76A 3R9WA 4F38A 4MW6A 2GBCA 4BEWA 5U4QA 4DF3A 3MCWA 4JLMA 4R1UA 2D5LA 5AVYA 3PUZA 4QBFA 1GU0A 3OQJA 5H3CA 2SCUA 2XYRA 5D85A 1MAAA 2H5IA 1OFUA 5KNDA 4ZEMA 2EJVA 3L1UA 5B12A 3SDSA 4ARAA 1SC1A 2VLIA 2ZSKA 4CI0B 1FNCA 1HF3A 3M3DA 3REOA 3QBDA 3CNHA 5FUQA 4IPTA 2IU4A 4QICA 1TM3E 2O3QA 4IY1A 2PGXA 2PZGA 3UT6A 2RB5A 2V8OA 3LV8A 3V2IA 1J0BA 5HP4A 1LS6A 4N8EA 2CUNA 5K0SA 2J8ZA 2YY6A 1W9MA 3QXHA 1M8KA 5ESWA 4C7BA 2IXBA 1UKCA 1VJGA 4ZANA 1RRFA 5AXAA 5T3YA 5J47A 4YRPA 3GA0A 2G06A 4GUAA 4K9NA 2ACKA 1M0SA 3R20A 1NBHA 3FYHA 1IYZA 4W8HA 4TM8A 4TV9A 3RTDA 3VAAA 4L8WB 3ONFA 1P45A 5ALMA 4EAQA 2VHZA 1XRQA 1QKIA 3MQ2A 4LMRA 3WZ2A 3L01A 5KWSA 3ZDEA 4O2AB 2ID8A 4ZAWA 4B3JA 2IYZA 4FP9A 5EQFA 3ZGYA 4B09A 1YOVB 1F6WA 2YHIB 1YA4A 1CUDA 5LMUB 4JBWA 4QTTB 2ZYSA 4XPZA 1L5SA 4Q5IA 5CFPA 1I10A 4L27A 3GFQA 5EWLA 4JJZA 1UAYA 5F21A 2VL7A 1V39A 5C3UA 1MAWA 4MO9A 2P9CA 2E6UX 4PEVA 4HAXA 3RVRA 3KG2A 4TQAA 1YCGA 3BFKA 4LNHA 4ZODA 1PR6A 2CD9A 3AEQB 3TOCA 3VPBA 4C7VA 4D9CA 1QGUB 1JG4A 1NVEA 4INPA 2IS2A 3NKLA 1Z4QA 1QVRA 3BMCB 5JJ5A 4RULA 3E84A 2Y0DA 3DGEC 3PQCA 3TW8B 3K5IA 2IVZA 4Q03A 3GV0A 4M6WB 4YREA 2ZRFA 3ZV4A 4O2AA 4C3UA 4KNVA 2PGNA 3IULA 2QF7A 3NRJA 3QFSA 1SUIA 3R09A 3S27A 1YOVA 4BNTA 4C22A 1RQPA 3CVJA 1T1EA 2QM8A 1H6DA 4H0FA 4X7MA 2AGVA 4A03A 4AO7A 4RZ3A 4LJKA 4D41A 1L9XA 1EI9A 4KHPB 1PX0A 5I9IA 2PX3A 4I5IA 2WZCA 1GEGA 4RJJA 1QO7A 3EN0A 1BS9A 3K1ZA 2HSJA 3HBFA 4LOKA 4ZCLA 5F73A 1ZHHA 1C9EA 1NM5A 3QLJA 1QGUA 4GYJA 3FCYA 1RWMA 4V1CB 1YJ8A 3BMCA 3LQFA 3TIXB 3ANYB 3ZE0B 1R15A 2C7VA 2DTXA 4UCXA 4NESA 2UZ3A 1U8XX 1XAGA 2HB6A 2WWXA 1FTQA 3CJTA 1ICEA 3A3KA 3OIDA 3Q3IA 4XCXA 1ILWA 2NZWA 2PX4A 2OZVA 5ADHA 1VXOA 3KSBC 4JLVA 2GD0A 1JKIA 1TTQB 2IOQA 3U9TA 3MTDA 3WK9A 3ZPXA 1ZRNA 1W2GA 3IAHA 3VYVA 3D0KA 1E3TA 1C7JA 1X7WA 4ITUA 4KIFA 2H7VA 4H2DA 1HT0A 4JVNA 1N0IA 1NVTA 2C5EA 3ROKA 5D51S 2C9YA 1XRMA 1O57A 4B9EA 1ECJA 4EG4A 1QB7A 1XDGA 1VL5A 2FSVC 1UZAA 1YB6A 2ZRCA 1TW3A 2HV8A 1A8PA 1R6BX 4J2TA 1OGIA 3K5HA 3K0CA 4CG1A 4CN8A 2ADMA 3RT9A 1ZGAA 1X70A 4YK7A 5AKZA 1ORTA 2VQ3A 4KYUA 1NQVA 1J0CA 2AYYA 5KIAA 2FUCA 2FCRA 3FM9A 2CMFA 1XU9A 4L8YA 4IRUB 1J5XA 4AG3A 1U8UA 2X8LA 3I42A 4RKYA 1FQWA 1WP9A 2OCLA 2WJPA 2OUIA 3QUQA 4H17A 4D9GA 4F5ZA 5AW7A 4YV7A 3K6SA 2CXXA 1GG9A 5DBGA 2FR8C 2WR8A 3AETB 4FNOA 3I12A 1N5KA 3WYBA 1MDFA 1P0PA 2JAHA 2H5EA 4JENA 2JFGA 3DVAB 1JJIA 1P2GA 2HT6A 2P9BA 3GZNA 3PYMA 4FGLA 3JD1A 4Q1BA 3SYTA 4EKIA 3BIJA 5MF6A 2ORYA 4B74A 3OE5A 4UNIA 2NYAA 2C00A 1QO9A 1G3MA 5EFZA 4B5LA 3O90A 1KEEA 3MJEA 4KX3A 4LHYA 1NLUA 3V2UA 4KG7A 1BGVA 1JTEA 4YFVA 1Y37A 2E4AA 2GKOA 3DTTA 3GGGA 5DYWA 4YASA 4AZ0B 2JFVA 1CFZA 3O7MA 3PDWA 1KMCA 2FSFA 4KNYA 1MX3A 1G6OA 4L76A 4OK6A 1L5HB 4ZQFA 2IUYA 4NOMA 1SZPA 2RHJA 1KAMA 4PC2A 1O5TA 5TQJA 3AETA 4OM8A 5BSMA 1YE5A 2V65A 2O1SA 3M6VA 5ALWA 4D45A 1MRZA 3WYAA 3M6LA 4CMGA 1M7GA 2Y27A 3THWB 1EGVB 3LC0A 4B85A 5CB4F 2MR5A 3DAYA 4HL6A 2A9RA 3PIDA 4ZALA 4DADA 3X2FA 3QU9A 4Z3OA 4ESVA 1UT6A 1NXWA 2ZT8A 4F45A 3CX6A 1FRFS 2YXDA 3ZXXA 3RC9A 2V3CC 2WT8A 1QIHA 2PS1A 5JZMA 1WUJS 2OHVA 4UBMA 3U3DA 3JX9A 1QHSA 3LJKA 3QFRA 5BN4B 3FWKA 3BVPA 4I50F 1HLGA 1ZMOA 3LXUX 1Z6ZA 1ZIOA 3AR5A 1AO0A 2PU7A 4LE2A 4OU4A 2QM0A 2FRDA 3ELUA 1GPNA 2JGIA 3VZDA 1MRSA 2HQBA 2PT5A 5F77A 3STHA 1LK0A 3EY4A 3IJ5A 3WHKA 3GMTA 5JJBA 3E9CA 1JVNA 4EYEA 3EVFA 3VI4B 1K98A 5K6TA 2ONCA 1XEWX 1GU7A 1QZXA 4NICA 2C7GA 3RT1A 2X7XA 3FSEA 1SHTX 4Q0MA 4Y67A 4BV8A 5LQMA 2FWRA 5TVGA 4DIOA 3OU7A 4EB8A 3KE9A 2I80A 4D9MA 4X60A 3AHEA 3IV6A 1DDOA 3L1JA 3EA0A 5ILGA 4IIJF 3WYCA 2F3PA 3DA8A 3MZ0A 3VNRA 3LQ4A 4KQGA 2O8EA 1OW3B 4HO1X 3ZOZA 1YZUA 2Z95A 3DE4X 5COBA 4BVLA 1HDXA 3FTDA 3MMZA 2DEUA 1M6EX 1RYDA 3H83A 5LYJA 3GUHA 4TN5A 2XI4A 5F2KA 2W5UA 4Q3AA 3K2EA 1O1YA 1VKZA 3NAQA 2QRNA 3HZOA 3PHHA 3ORQA 4NRDA 1E1QA 1O6CA 5CPBA 2G1KA 2HO4A 5AVOA 3HO1A 4JLDA 3IC5A 1PDOA 2BM9A 4JVMA 3PI7A 4JUDX 3Q1LA 3SLRA 4FT2A 3TLBA 4UHCA 1C7ZA 1IRXA 4QM7A 2Q4DA 4GMXA 1NULA 3DWEX 4PFQA 3LFHA 3IT3A 4XIGS 1SXIA 3HHPA 8ABPA 2J9FA 4X1OA 1VE6A 2AG0A 2W8ZA 1C1DA 2QN6A 2BSAA 1XTJA 3PEUA 3S2YA 4POAA 5EKDA 5DT9A 1IZ9A 3AX6A 3T5PA 5EIAA 1YQGA 2EKBA 2GZMA 1NN3A 1VL8A 3GYGA 3IA7A 2MINA 4YT8A 1DBQA 3QOWA 3ENQA 3K0EA 2W2NA 4C4PA 4F5EA 2Q9CA 4ZYLA 3GQBA 3KXDA 1V8DA 2GCOB 1KIFA 4AT1A 3ND5A 5JCOC 1RWBA 2N0SA 1B0AA 3E9NA 2X3YA 1XCOA 4B6QA 4O4LB 5J2TA 3OTGA 1F7UA 1HORA 5ELMA 3SZOA 3IJPA 3EZ9A 1R0WA 1SK8A 2PD4A 3LG2A 4G56A 3RAPR 3D3EA 1EM8B 3JD2A 1QIGA 1P1BA 2Z08A 4GLOA 5ERGB 5JXJA 3VKGA 1PQUA 1SHKA 3BMOA 3L4EA 3NAMA 1QK3A 1QVWA 2HJWA 2CVHA 5JH7F 3L1IA 1E3WA 1SIUA 3PFCA 4OQEA 4TTSA 4QLBA 3EHDA 3ZBUA 2B1GA 1YVUA 3NANA 1FRNA 4EQ6A 3ZDDA 4Y6RA 4L15A 1NDQA 5CTJA 5D3MB 1YC5A 5CDGA 1PSWA 3DWIA 3W04A 2A0KA 4A1FA 1B23P 3G89A 5CFMA 3O4JA 3WSTA 1FYEA 4BMOB 2BF7A 1DAFA 3BG5A 4J7UA 3W1WA 3PQFA 3GK3A 4O4LA 1CUSA 1FFSA 4L02A 3NIDB 3ESBA 2I8CA 3LD9A 3CLTD 4XB2A 1V7CA 1UPXA 5E6UB 1RI4A 5EZYF 4E5UA 1IATA 4BNDB 3U4IA 3C3CA 5KDOA 2DZDA 2Y1LA 2RBGA 1FYWA 4N0PA 5LP6B 3MGKA 4FOSA 3AR2A 4MKFA 2JI9A 4GX2A 1HOXA 1SVMA 1U9IC 3DHWC 4M0UA 4NECA 5FOQA 5PGMA 1DQYA 2B9VA 3DZBA 3ZE6A 1TRKA 3EZ7A 2ZWVA 3COVA 2J4CA 3WGUA 5JXGA 3NHKA 4DILA 4QGAA 3U7JA 4N7RA 4ZZIA 5HYVA 3IKTA 3ZW8A 4CT0A 2HHHB 4IXDA 4R40A 3N87A 3E48A 4MA0A 1LBQA 4JQOA 2JHAA 1JFRA 3WGLA 1NP3A 3D1JA 3GPDG 3AVQA 3SEAA 1G7SA 4OGLA 5AI4A 5E6UA 3T1OA 4DJDC 4N41A 3FOCA 4BNDA 1Z8DA 3CTMA 1Z2EA 3LMKA 1H2HA 1YBFA 2FP4A 1Z63A 1SOUA 3ME5A 2DFPA 3ICCA 3LOQA 4UHFA 3QVVA 4O33A 2IUFA 1DLIA 3EGOA 3ZEAA 2XTMA 1XEFA 5AVVA 5I7OA 5GJBA 1IHXA 4F4UA 4DCVA 3AP2A 1HT1E 1J56A 4JUAA 2WKRA 1RM4A 1JQKA 3QE2A 4KLCA 4OKIA 5C7LO 1Y3BE 1ZICA 3QBVA 1EB9A 4R6XA 3VU8A 5BQXA 4MVJI 4ANFA 4TTQA 3OZFA 3H8JA 4MI9A 1KR5A 2PRKA 1U2RA 3H2GA 1T4CA 1I2BA 4S12A 3RLFA 4KREA 2XADA 4JR1A 1M72A 2PUVA 4CDNA 4I9HA 3VJMA 5C34B 3E03A 3T5CA 3NCTA 3BJEA 4BB6A 3OA0A 3SVTA 3ENNA 1ODLA 2H2HA 3IVMA 4MKGA 4RVFA 2QMHA 3UMMA 2A7QA 2NPIA 1QNLA 1LNQA 2I2DA 5BNFA 2JVJA 4LRXA 3UMSA 4B8YA 2ZRHA 1PV4A 1BJRE 1U2DC 4QPDA 1A9SA 3Q98A 2ZYWX 3UCXA 1OX4B 2BR3A 2FFHA 2G0TA 1K8YB 1YJQA 1T0IA 4G5HA 3S8MA 3BORA 3OZTA 4PGHA 5FWNA 1WETA 5CIWA 4CE6A 2GHTA 2P4SA 3KVRA 4CODB 1G5QA 1XN4A 2A92A 3UUWA 4JD5A 1K9VF 3BIOA 3DBOB 3NHFA 3P2JA 5ALFA 5J58A 5U9CA 1FP7A 2JRLA 1WMDA 2QROA 2X0KA 3MCZA 2C9ZA 4EG8A 3L8EA 4F72A 3D7SA 1H6AA 2YQ4A 2TS1A 3QLVA 3HB1A 5AJYA 4F2DA 3K9GA 1NXOA 2ZSAA 4FEYA 2VWHA 3IIKA 2SICE 3VHQA 1ZW6A 1ID8A 1WDKA 1TW2A 1WB6A 4JIGA 4OUDB 3RM3A 4AY5A 4UVGA 1OX4A 3HABA 2K6GA 4BEVA 1IWBB 4EBFA 6Q21A 4G85A 1Q7GA 4LCBA 2WSSD 5M04A 1K2WA 2NYVA 3AKEA 1CRWG 3MMXA 2HJVA 4WESA 5L40A 4PTYA 3OPQA 4B7CA 4ZJPA 4CEHB 4WY8A 2TYSB 5KO2A 3HFRA 3WLLA 1J0DA 4KZKA 2AFHE 1Y6RA 1SKUA 3G23A 4MS3B 4RTRA 4OJNA 3JVEA 2WKPA 4N5LA 1QVVA 3VR5D 4HUJA 2F1IA 2I6XA 3FHCB 3PQ6A 2TRSB 1XCBA 3QEMB 4UDOA 3WGZA 4RMGA 1PYDA 5BMOA 4XJXA 3WBJA 2OBBA 1NTOA 1O7JA 2ZYTX 3R3UA 4RKRA 3DZCA 2COUA 3OLZA 2R6R1 1SELA 2O2HA 1BXRA 2WFMA 3G1UA 3PG5A 3OCWA 3QX8A 1FMLA 4GWGA 5DHAA 5KU7A 5EXXA 4NXNB 2FPRA 1DEHA 1GZUA 2D1YA 3P0EA 2BFEB 2YMMA 2KHZA 3JD3A 4CTKA 3RTBA 4CEHA 3DBIA 1TX4B 3GDOA 4EKEA 1SBTA 3RSHA 1YAJA 1T4DA 2AYXA 5FEUA 4F60A 1WEHA 2PTGA 4WK6A 4YRNA 3QLUC 2LXNA 4L6AA 3KDSE 8OHMA 5D8DA 1B41A 4GC9A 5BSHA 3W5CA 4KCGA 1SWWA 2YMPA 3AL3A 2ODEA 2NTVA 3OLCX 3V2GA 2DFTA 1JJBA 1M3SA 3KD2A 1P4SA 4OYYA 2TMDA 3N3AC 2N1BA 3MIZA 4BZPA 3KAPA 5GVSA 1VLMA 2JZOA 2OVBA 4G1VA 4TS1A 1IHPA 3P0IA 2WPDD 4O1MA 3JQ9A 5BSVA 1DBVO 5AQEA 3OOHA 3TO5A 3EBPA 1C0IA 4FDTA 1Z4PX 4R8KA 3QXSA 1SUSA 4ZWNA 1KJWA 2OBNA 2C0CA 1ORVA 4B17A 2DQSA 4FYHA 4D25A 2BFBB 4K6MA 4EGCB 5HKKD 1Z5GA 2C9CA 3UAOA 3N58A 3QVLA 2BL4A 1MR3F 1YE3A 2OB2A 3OFKA 4EPYA 1ACLA 1YMUA 1CWUA 1XMPA 1M33A 4OQ4A 5DLDA 3OFND 4CMAA 3DJFA 4ZJYA 1A95A 1TYEB 1DOZA 1TO6A 4NBRA 4OQXA 1FMCA 1OTHA 2BRUC 3E3AA 3AUFA 1WSAA 2RGWA 3FROA 4UTXA 3NBMA 1TZMA 3P1JA 1CY2A 1GN9A 1LV7A 1UMDB 4W9NC 4YQEA 1Q0PA 4GG1A 2HCTA 3VR4D 4ZEVA 1WULS 3GFGA 4UBLA 4C5BA 1UOOA 4QE3A 2GPNA 3WMFA 4MVJF 2DHEA 2IUEA 421PA 5IT4A 4H60A 4HKTA 2BFBA 3Q8WA 5JDCC 5LQJA 3IHKA 2GN9A 1K89A 2YHUA 1GD1O 1U4OA 5SY9A 5KJ1A 2EX0A 1JDUA 1KXJA 4DVJA 3L0PA 4MV0A 3GLTA 4LIPD 2A1TR 1TZKA 1G7TA 4KJXA 1ZYUA 3H5WA 3BWDD 1F4PA 2CCGA 2QN8A 3ACBA 4J6EA 4LDNA 4MUBA 4NMWA 4X9XA 1JDNA 1FLVA 1VPEA 4Y0AA 2KE5A 3ECSA 1A82A 1E92A 1ZGHA 2QENA 3H1EA 3KB1A 4OAOA 4W99A 3ZWWA 5D3QA 3TW0A 1P5FA 1ZJYA 2XUOA 3DMHA 4Q1VA 4DR4B 1OFTA 4R98A 4Z4FA 2NADA 2OCGA 4E22A 5EIBD 1F60A 3JZIA 3BGVA 1CJUC 1UPUA 5L53A 1DBWA 1I4WA 1N1DA 3EUWA 2WYIA 1DAMA 2ZUTA 4BZWA 1BA2A 3IOMA 4DQ0A 1C30A 1VP9A 5H68A 2HJ9A 5DHQA 5AI5A 3VSEA 4AZ3A 3HUFA 4C0WA 1UXJA 3JQFC 4C0AC 3TUJC 3C3KA 4G09A 5B1DA 3K6RA 2FYTA 3PVCA 4MLZA 1C9NA 1SXJC 1ZXLA 5EG5A 2DB3A 2AF4C 4RIHA 5JNTA 4GM4A 3T52A 1NKSA 4QXAA 2I87A 5BSUA 4RK7A 4DMUB 4ZQCB 4NYIQ 4WLOA 1E5XA 3CFYA 4EFLA 1VIAA 1M5RA 1EDZA 2CYCA 2X58A 4QUJA 4MKRA 3KAJA 2XBMA 2HA4A 3AR7A 4CEIB 4DFDA 5C32A 1F0NA 5J59A 2DQ4A 4QU0A 3HZHA 3GLVA 4C06A 4ZEXA 2WWYA 4X0EA 2ZAOA 1ETUA 1W48A 1KHTA 3BD9A 3BRQA 1NQ5A 3EXEA 4UEKA 4DAEA 1XVTA 5AJHA 4BJ3A 4UM9D 2GM5A 3A1FA 3WKDA 2WFLB 9GPBA 4UTRA 2GESA 2QVGA 4CHGA 2W6OA 3GDGA 4D4LA 2GXSA 1RC1A 1ZD2P 3DOIA 1Y7PA 1I2MA 3EA5A 4PGMA 4FHGA 4RESA 1ZM4A 4EJSA 1IN6A 2X6TA 1Y5IA 2QZPA 4OLBA 1U0GA 4KXMA 3GRYA 4AQYB 2D00A 3O3OB 3TCXB 4FHFA 4CQMD 2WFAA 3C3BA 2AD5A 5J5CA 3VQTA 4FD3A 4CEIA 5E38A 1E6CA 2W0SA 1E7RA 3TOXA 4XWTA 3ZZUA 3DBRB 4BN5A 3R5TA 4CM9D 1S2GA 4PCVA 1YJCA 4P83A 5J3JA 4CLOB 3W3AA 1WB5A 3HB7A 2R5NA 2JLAA 4J1QA 4JLUA 3AJ9A 4G0OA 3IBSA 1U7TA 3LXRA 3NOOA 5G4LA 1XVLA 2WFLA 1PQWA 4HGQA 3LSYA 3OO0A 1YU9A 4BQSA 2AZDA 2FEPA 3OLYA 5C81A 2CNWD 4RKFA 1C7FA 2I29A 1RVV1 4N5MA 2Z2XA 4MQEB 4ZAXA 1UH5A 2FOXA 3HJHA 2A5JA 1P0MA 3AQ4A 2FWPA 3U7QA 5FH9A 5KZMB 4PRLA 2PUCA 2Q0SA 4ZU6X 1JU9A 2IXTA 3OEED 4D4JA 3MCVA 5EJAA 3DBRA 4K6HA 1FTSA 3AKYA 1GQOA 1BQ4A 3GFBA 3GLRA 5SY4A 3NP9A 2PGIA 5TXGA 4TKMA 3VDMA 4EF4A 4CLOA 1XNRB 3CW9A 2PCJA 3A1SA 1VLZA 3AFHA 3DAFA 4BIIA 2FGKA 1QPGA 2PJDA 2G80A 3DS8A 3TNJA 3F5QA 2R66A 1J2YA 2COKA 1XZNA 2R8BA 4YJ2B 5T4BA 1HFKA 2FPMA 1R66A 3WK8A 3WJ2A 2VDVE 4W6ZA 1SB9A 3PR2B 1IXRC 5L4LA 1XZBA 1Y63A 4LDQA 4RH0A 2AJBA 3SU8A 4KFCA 1FSFA 3A7DA 5AJUA 5TQ0B 3WG9A 3ZX5A 2QAIA 3F47A 3SWWA 3AZQA 3KOMA 4FYPA 4B9AA 1Z3IX 1DEOA 2Q4TA 4P3YA 2J0UA 4JJ7A 2OCXA 3STUA 1EFDN 3GH3A 4JDPA 1XF9A 2HHCA 3EVCA 5JEDA 4RQBA 5LD2B 1NG1A 3K8YA 4UARA 1EVYA 1RFLA 1KOFA 1NN5A 3TI7A 1DZIA 1ECGA 1JQEA 1DRVA 2ZSUA 4FFBB 5AW3A 4BAGA 1W36C 1MQ9A 1H8EA 2YFKA 4FDLA 3NDPA 3EC7A 5NULA 4YJ2A 2DWUA 1E2LA 2O0HA 2OHGA 1Z16A 4QU5A 3AM3A 4NG5A 4R84A 5HFNA 4A5OA 6ABPA 1XDBA 3IX7A 4RVCA 1X1TA 2CYBA 3H1AA 1QP4A 4WGFA 3K5PA 2OGSA 3LAWA 2EW1A 4EM6A 5BT8A 3CWZA 4V2IA 5TQ0A 3K7EA 3RADC 4WK0B 4IOKA 3IALA 4ARZA 1QIEA 4WJLA 5DN6A 3ZYZA 5JY1A 4CIWA 5KSWB 2FEOA 3JQCA 3V1LA 1PS8A 3SC6A 2HMVA 3L06A 3V3TA 2IBTA 2AEMA 3AUTA 2A0UA 3EW7A 3X2EA 3SKYA 1QRSA 1TJ3A 2QMUA 5CBPA 1FS6A 3R24A 4UU8A 2NU7A 1ZBDA 1QOQB 2G8NA 3TSZA 3MUFA 1BYUA 1SCUA 4BLRA 3D8SA 1STOA 2NPOA 1MA3A 3KPUA 3H9QA 3QIAA 2I66A 3VDRA 5DWQA 2C5GA 4NNOA 1FFCA 1JQDA 1WZCA 4E70A 4YQZA 4D0NA 1BEEA 4PYMA 4Y98A 2EV9A 4M53A 4UOQA 1S2OA 4YCAA 4BECA 4QYWA 2GEUA 2VJDA 1WB4A 4WASA 4HDOB 1MC4A 2D1SA 1H6CA 3OIFA 2WIDA 4P93A 5I47A 3HFGA 1AMUA 1HLDA 2BY4A 3ZBPA 1EFRA 3W9SA 5JQGA 5IW8A 1W49A 3B1FA 1ZKDA 5E6RA 3CC8A 5FTLA 5F1OA 1CUWA 2QV7A 1ZK4A 2NVUA 1T4MA 2B8JA 1XZHA 1H05A 3CZAA 3SQLA 2W22A 2O3SA 2IYNA 2C58A 1Q0HA 1A9YA 2P11A 2ZJ8A 1P2DA 2GAAA 1PD0A 3OJEA 4KK3A 3EPHA 1PR0A 3ZCVA 1IB6A 1II8A 1SVSA 3KYDB 2A9KA 4ZZ1A 3M4XA 3O3CA 1OVGA 4XVCA 4ZMSA 4M8IA 2IJGX 4DLPA 1TQHA 2PZJA 3MWGA 4UEOA 1J99A 4BMSA 3FVQA 2BMFA 1X77A 3ASVA 4BMZA 4E5YA 2Q5IA 4H3VA 1DDGA 2OCKA 1D3AA 3MYYA 3RYTC 1E64A 1NDUA 1UBUS 2X1LA 1WKBA 4OH1A 4MRMA 1IFXA 3ZDYB 1WMEA 5B7GA 2VTBA 1RYNA 1UKEA 3P8ZA 1F5SA 2OBXA 4XWYA 1P2SA 1LWOA 1PE0A 5IT9A 1L5LA 4JGBA 4KIJA 4RTSA 5KNDD 4OHVA 1XJCA 2DUMA 2YWFA 5E6SB 4QKQA 3V97A 3FVWA 1OFGA 2FMTA 5SZKB 1XFAA 1QLHA 2JGEA 1YRHA 1P4AA 2R11A 1DHTA 2YXLA 4Y8VA 4RZQA 4DC1A 2P67A 5B4VA 1NBMA 3AVYA 2SHKA 4KMMA 2QL9A 1VMKA 5YASA 3B5JA 3UXHA 4KXNA 4DR5B 4MYRA 5HQTA 1FL9A 2FXVA 4AYWA 5EGNA 1FE8A 1LPSA 3F3KA 4R05A 1CZHA 2IT1A 3FFBA 1XMVA 2I4RA 2DHDA 1JNYA 3QHPA 4ZARA 4JP8A 1GV1A 2DCUA 4M8SA 3GX1A 1M34E 1Y6QA 4DM7A 3WKEA 1YC2A 2O7VA 4REQB 5BRAA 1OE0A 1WM1A 2BGIA 3LL7A 2EWVA 3LUBA 1E2PA 3O5AA 3ZUGA 2GK7A 3LW8A 2GAFA 1RQNA 5E6SA 3TR5A 2BTEA 3ZVNA 2J3DA 5H81A 1N5MA 1O89A 2PA3A 2R6ZA 2Y1XA 4C0BA 3SJBA 3FOWA 4JI7B 2ZWAA 4PHTA 1R0RE 2PZ8A 4BPRA 1MCZA 3U16A 4FHDA 4P31A 1L7OA 3AVXA 1CUCA 3B2QA 1JLKA 4WNAB 4BNKA 1WW8A 2OXFA 4BCDA 1E5TA 4TKLA 1S2LA 4QELA 3PL1A 3JQQA 5J4HA 2P6MA 3QVUA 1CUXA 3GVCA 1WUKS 3QKRB 1LC0A 1LH0A 1NR7A 1P1IA 3PA6A 1EXNA 4REQA 2GJ4A 2FF5A 4WGGA 5BWNA 4BFZA 2RBKA 1OX5A 2VPZA 1YL6A 4WN9A 5LZ7A 2F8TA 1C80A 1O54A 2F3UA 1WMSA 2ZUDA 1MN6A 2ZJAA 3NVMB 4GGPA 2QGZA 4PZEA 5DCYA 2IUUA 3KEGA 4CMEA 4N3NA 2FEMA 4RSRA 5J43A 3MF4A 5D6OA 4G1MB 3VHLB 2O59A 1NC3A 3IUSA 3WTBA 4B4DA 1Y4SA 2QXUA 2RHCA 1TD9A 3EVDA 3UKOA 3RKSA 1TOAA 4XWGA 1VDZA 4MDHA 3EXHC 4O2BF 2AOWA 2J59A 2EFHB 5KTYA 4TKUA 3JTMA 3HVKA 3WGTA 3E22B 5ERYA 1QZUA 1C4KA 2INGX 3I9MA 5D86A 1X9HA 4JQCA 1TAUA 1YONA 1QF9A 3DYVA 3QKRA 3R1IA 2RMKA 3QMWA 2XKBA 3OT1A 4F2HA 1M7HA 2FKNA 3AIOA 1XFDA 3GEBA 3QX7A 4X7BA 1E58A 4OCZA 3S1SA 1PV1A 1ZU4A 5U1PA 3PD1A 2V1XA 3GBVA 2SBTA 3MT0A 3E9MA 4P2BA 3WHLA 4NPCA 4BLUA 2J6HA 2GN2A 5CX1B 4YH1A 1OROA 2WF5A 2OP0A 2EW8A 3ZZTA 2FG6C 1MB4A 4ER7A 2FU5C 1XSEA 5FPSA 3VHXB 1CR6A 2VT6A 4J0DA 4KBYA 5CGQB 2FPSA 2AUMA 3E2IA 1VG9B 2ZI7A 3KVOA 2W6CX 1MNQA 4D46A 4RORA 4OYRA 1Q1