3CNQS

Prosubtilisin substrate complex of subtilisin subt_bacam
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
CVSYGVAQIKAPALHSQGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQASWIINGIEWAIANNMDVINMSLGSPSGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTLPGGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Subtilisin BPN'
publication title Engineering substrate preference in subtilisin: structural and kinetic analysis of a specificity mutant.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 97
structure length 264
sequence length 264
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3cnqS00
2P4EA 4NE7A 3VSBA 1LW6E 1Y1KE 4CFYA 2PQ2A 1T1IA 2W2QA 1MEEA 4DZTA 3AJ8A 1AF4A 1T1EA 2ID8A 4C3VA 1GA1A 1Y4AE 5JXHA 3LPAA 1SUPA 4H6XA 5B1EA 1PFGA 3QTLA 1A2QA 1TM5E 2WV7A 1CSEE 5AMXA 4KB5A 1Y48E 3P5BA 4KG7A 1BE8A 3TI9A 3ZXYA 1R0RE 1AU9A 1P7WA 3CNQS 1C9MA 2IY9A 1AK9A 1BFUA 3BX1A 2WUWE 1WVMA 3VYVA 2DUJA 1HT3A 5FBZA 1Y33E 2PYZA 5AVJA 1ZVJA 2WUVA 3SICE 1IAVA 1SIBE 1SBIA 1GA4A 3EE6A 2X8JA 2ZRQA 3OSZA 4OV6B 5JMOA 4I0WB 4NE9A 1GTL1 4Z2AA 2ID4A 1AVTA 3DVSX 1WMDA 4DWWA 1S01A 3F7MA 1ZVKA 2DQKA 3DW3X 2SNIE 2QTWB 2Z30A 1SN7A 4BWGA 5I9SA 3F7OA 3DWEX 3D9QX 1KDVA 1EA7A 1OYVA 5ARDA 2W2MA 3LPDA 5JXGA 1T1GA 4NMXB 2Z2YA 1ST3A 4J94A 1TM4E 3HJRA 3QFHA 1WMFA 4AKTA 1SUAA 1UBNA 3UNXA 1YU6A 5CW1A 2V8BA 1NDQA 3AFGA 1V5IA 2W2OA 1C9JA 4M1ZA 1SBHA 2SBTA 2ZWPA 3DW1X 3I37X 1SUCA 4CFZA 1Y4DE 1C9NA 5ARCA 3VHQA 3WQBA 1Q5PA 2PKCA 1GNVA 3L1KA 2Z2XA 2GKOA 4WOCA 3PRKE 2TECE 1JEAA 4ZOQI 3DE2X 1GA6A 1SELA 2PRKA 3DE3X 1KDYA 2HPZA 1TMGE 2E1PA 1OYOA 2W2NA 4OMCA 5FAXA 3D43A 4WOBA 3DE7X 1SIUA 3I34X 1SBNE 1TO1E 1KDZA 1AH2A 1WMEA 1R6VA 3DE4X 1TM1E 1SBTA 3A3OA 1SCJA 1OT5A 3A3NA 1NDUA 5AVKA 1SH7A 5B1DA 3WHIA 1TM7E 4C3UA 1Y34E 3GCXA 3A3PA 2X8JB 1SUEA 2DP4E 3TECE 4LVOA 4ZARA 1BJRE 1Y3CE 3DDZX 4H6WA 4LVNA 3EDYA 1Y3FE 1THMA 3QMPA 2IXTA 4FONA 2HD4A 3DVRX 1ST2A 1KE1A 2SICE 1WSDA 1SIOA 1GTJ1 2Z57A 3ZXXA 3WIVA 1Y9ZA 3DE0X 3T41A 1TECE 2B6NA 1SVNA 1BFKA 3I2YX 1YJAA 4AKSA 5JXIA 1Y3DE 3GT3A 3BPSA 1IC6A 4B5LA 1SPBS 3PTLA 2Z58A 5ARBA 1R64A 1TO2E 4RYDA 1PTKA 1VSBA 1S2NA 3VV2A 1GT91 2PMWB 2Z2ZA 3GCWA 4JP8A 1TM3E 1P7VA 4KPGA 4MZDA 3GT4A 1KE2A 2PWBA 1SCAA 1AQNA 2PWAA 1XF1A 3EIFA 3LPCA 3DVQX 3H42B 1GNSA 1PJ8A 4OMDA 1GCIA 3VTAA 2WWTA 1SUDA 3DE1X 1NLUA 2G4VA 1SCNE 1CNMA 3TI7A 1SUBA 2Z56A 3Q5GA 3DE6X 1C3LA 2XTJA 1BE6A 4CG0A 3DE5X 1BH6A 5JXJA 4HVLA 3VV3A 1DUIA 5AQEA 1SBCA 2ZWOA 1S02A 3LXUX 4K8RB 1SCBA 4H6VA 3Q40A 2ST1A 3BGOS 1GTG1 1PEKE 1DBIA 1SCDA 1TK2A 2W2PA 1P8JA 2XRMA 4GI3A 1YJCA 3CO0S 1V6CA 4DJ5X 1AV7A 1Y3BE 4YN3A 5FFNA 5SICE 5K7SA 3WIUA 2SECE 3I30X 3DYBA 1EGQA 3F49S 4HX2A 3SQOA 1MPTA 3AJ9A 1YJBA
chains in the Genus database with same CATH superfamily
3AVWA 1PL6A 2QL5A 2W0SA 5JYEA 4OH1A 2IODA 3B5JA 3ZY4A 5CK5A 2CJXA 3DV2A 2ZJ4A 2I1LA 3ABQB 5FCDA 1U2EA 5KSZA 3GLIB 1NG9A 3FZEA 1VTKA 1Q0QA 5E6SA 1ECJA 2DGDA 5EHZA 2WF6A 2PX2A 2A5LA 3SQLA 1QM5A 1NLZA 2CLCX 3R6GA 1LX6A 2B1JA 2FR1A 1OBOA 2GEDA 3VTZA 3WLJA 4L72A 3BMNB 2HRCA 2IV2X 3KJHA 3RYHB 3ZX4A 1TLFA 1EDOA 1C1HA 1Y7PA 5IMBA 5IANA 5KOJB 4B3SB 1M2KA 2RK3A 4HDKA 5KPDA 4PTZA 1BMTA 1MX3A 3HKEB 5ALGA 4S3MA 3JYPA 4UZEA 3VR5D 4YFYA 4Z4QA 4FXOA 4KXLA 2FUCA 1VJGA 2YHUA 2ZUBA 3SDZA 4BVAA 4I7EA 4Y30A 1I7SB 1L4HA 5BT9A 4HWSA 3RBAA 4BMNA 1QMPA 4XUDA 3S7ZA 5LD2C 1RHMA 2GAAA 3C3BA 2V1XA 1D8AA 1NN0A 1OX4B 2V5UA 3VHLB 1QWOA 2IUFA 5JH7A 4V3CA 3AEKA 2EFDB 4HSEA 3VYTB 2WFMA 3R40A 3G88A 3C24A 1C30A 3OMWA 3HU3A 1ZNQO 3ESXA 3PPWA 1L3BA 2PNJA 2K7FA 2JFGA 1JJ7A 1O94A 4NP6A 2DETA 4F91B 3LBIA 4IJVA 5FF9A 4KVFA 1TD1A 1ZCFA 5BQOA 3RAGA 3K73O 3REQA 4AZWA 5KYNA 5I5GA 2OO3A 4I4TF 1WUHS 2RHLA 3J7TA 1SC1A 2NYVA 4QDZA 4NJMB 5IJAA 2C3MA 2JK0A 5LMCA 5ILOA 3VGJA 2R66A 4I6JA 2EW1A 1BGXT 1BMDA 1SM4A 2JDIA 1NP6A 4MUFA 1XNHA 1W47A 1Z5PA 4QEZA 4BNIA 4F38A 2HMWA 1N2ZA 1JHQA 2XMZA 3GGSA 4X84A 2QMQA 4FKZA 4OXXA 1P9NA 1TTQB 2CJWA 1GRNA 4DA6A 5L3QB 1Z4PX 4KWTA 1T4CA 4YRIA 1NWHA 3EGOA 4OAQA 4CKZA 2OHHA 4ARSA 2X86A 2HKIA 3UH0A 3EVAA 5IKEA 1M2NA 4PYKA 1EDZA 4B6SA 1RMYA 1FJ2A 4WLUA 4F60A 1E2DA 1SQ6A 2WUVA 1KYXA 1DSSG 2PG3A 4RLHA 4BNHA 5BQPA 2J4FA 3CGWA 1OYYA 4HGYA 4K5QA 4ZODA 1C3XA 1QG2A 4DIMA 6REQA 2HQSA 4KIWA 1Y7IA 1SIBE 3PX2A 3Q85A 4HDQB 2P9YA 3VOAA 3LWDA 5KDLA 5IEBA 1GA4A 3ZD9A 5C1BA 4HTFA 4FUQA 4LJ7A 3QITA 3LQYA 1TJ5A 3EDQA 1A8HA 2C94A 3RHTA 3T15A 6ADHA 4P3KA 1IATA 4DZZA 5A4JA 4QREA 9GPBA 2V5VA 3IUMA 4AP5A 1EUCA 1J09A 2WSIA 1PJ4A 4K81B 1FU7A 3UEOA 1FP6A 5A5FA 3UGQA 2BFAA 3ZHSA 1IRXA 4UCXA 4ERXA 4S1PA 1XLTA 1NC1A 5TS3A 1EWYA 2R8XA 4D79A 4PXSA 1M66A 1CUCA 4IFEA 5CYOA 2EGHA 1UZLA 1SUFA 2BCGY 2D2FA 4UPVA 4ZHQF 1ORHA 3D7MA 3HMQA 2YR0A 4J3JA 2P3LA 3JAMA 1RWOA 4HX5A 2FZKA 1IBSA 4GS5A 4AKHA 1NBOA 4D4JA 4P3OA 1Z39A 3EHEA 4QBIA 5K8VA 2Q4EA 4N49A 2VWHA 1C0LA 5IULC 3R9WA 3M5CA 1H2EA 1H9BA 1T36B 3JZFA 3GHYA 2AG8A 3B1XA 4WX2B 2BDUA 2Q3EA 1HZJA 3TIFA 5KHAA 3A10A 1S2IA 2AG5A 1OKKD 4MLDA 2GBCA 2C7PA 3CRVA 2CV2A 1P74A 2EGUA 2GFIA 1UADA 3FJOA 4I6EA 4Q4CA 3UF0A 3NCHA 4BCDA 4LMPA 5EZSA 3JD0A 3A1WA 5JQWA 4NU0A 1P8AA 2GEVA 1NG1A 3BE6A 3WXMA 3DKVA 1WBDA 4QEKA 3R2JA 2G1PA 1DUVG 1WHSA 2AW5A 4NZ9A 1T2AA 3LVBA 2P27A 1JSRA 2Y6VA 5E8RA 1PUXA 5F76A 4UXJA 4HZUB 2BKAA 1AKNA 2VPXA 3LK7A 4RYLA 3R7DA 3JQPA 1NBMA 1G2QA 1YIOA 5TDHA 3KUDA 1OU4A 4FHCA 4RIIA 1GM5A 2IIVA 2VHJA 3E0QA 4KFUA 4LRQA 4ZO4A 3AKZA 3HJTA 3R5JA 2BFEB 2UYCA 1L5WA 1WQ4A 3KOYA 1WZ2A 2A9QA 4J7XA 3R9IA 1SB9A 1JRLA 1HYBA 3I52A 4EFDA 4HN4B 4FMCF 3LUAA 3UBTA 1XJ0A 2H2IA 2VEDA 2WF7A 3ACCA 5KNDH 3CE9A 5JNUA 1KMIY 4AY4A 4QBGB 2XGJA 3CUYA 1TCUA 4X1IA 3RSZA 4QLOA 4EPXA 2Z04A 2DTEA 3L7IA 4N0PA 5I7SA 5KPJA 2OENG 2PS1A 3I12A 1GSIA 1LFAA 4JJ7A 2ANBA 1HE2A 1G42A 2ZZMA 1S8NA 1WUKS 4RSGA 2MR6A 1R0CA 1GUFA 1GNPA 3R74A 4XLTA 1ISGA 1ATIA 5UKDA 3IBYA 4L50A 2P6OA 3N7UA 4UJ5A 1Z18A 5BN3A 4YDSA 5CA0F 5AQ1A 3ZNNA 2KX7A 3ADKA 5AK0A 3I42A 5FUYA 1E99A 2XYPA 5CIQA 2JIOA 1A96A 3L1KA 4H7KA 4D3SA 3WSVA 1JLRA 3FMVA 1AX9A 4C4SA 1WZNA 3LLUA 2DF8A 3BRCA 4QQFA 4TQAA 2RB4A 3E2PA 5YASA 3AILA 3IVAA 2C83A 3OQOA 5EWJA 3O9ZA 3CNOA 1M34B 1XJCA 2AJ8A 1ICIA 1UKBA 1JHPA 4BATA 1RAIA 3IQZA 3DKIA 3S44A 3VZPA 3TZ6A 2TECE 3DL2A 1XMPA 1YR7A 2V7UA 2W7TA 4ID3A 5ANRB 2OCDA 3DE2X 1AY0A 1B0AA 2OGWA 4GICA 3COVA 3UJ8A 2R25B 4I50F 4RF5A 3GAFA 4Y3UA 3CIFA 2PUJA 5EGNA 1U1CA 1C8BA 1N0UA 2YFKA 1D2HA 1W5EA 4B82A 4PTYA 3JPYA 3DKPA 3FGNA 2BI7A 4JHLA 2YJ3A 4Z5XA 3IIJA 4IV8A 1UMBB 4GFDA 1CUJA 1DP4A 1HSOA 4JJIA 5BWCA 2OLJA 3GXBA 2B5VA 1A5TA 4FEYA 3ITNA 1J8VA 4OF4A 5CA1A 3H05A 4JZKA 2PGLA 3LGSA 1SIUA 1V4VA 1JSLA 3DBLA 3OQ6A 2C9YA 5FJJA 5PGMA 4ZAFA 1VI5A 4CKWB 4XFKA 4NCHA 4YPOA 4D9HA 1UPXA 3IVGA 3DEZA 3IEKA 2PZ8A 4KQWA 2GPSA 1GO2A 1Z62A 3GMTA 3FOAA 3GZNA 4OHUA 3FRIA 1Q1ZA 2XMDA 3JZAA 3V1MA 4QG3A 1EPUA 2GSWA 2JIZD 3OZEA 3S2FA 4UNIA 3UJHA 2PL1A 2ISCA 3OMXA 4NEHB 3GVCA 1TDJA 2WVAA 4BVEA 5JI2E 4IKOA 5LXTA 4AMYA 5JNRA 2QLTA 4CDNA 4YVFA 1GU0A 1U0NA 4JITA 1Y42X 4M8IA 4GG1A 1GDHA 1B43A 4L7VA 5J3JA 2BFFA 2WB2A 2QSJA 1USGA 4WADA 1C29B 1UPTA 4PC1A 1V0JA 2KPOA 2Q5OA 2VKTA 4C89A 3OM0A 4BN5A 4D3DA 1AV6A 2Y1KA 2NUPA 2WU0A 3CG0A 3LQ2A 4L2IB 5JLAA 1ZH4A 3Q1LA 1E59A 1FEZA 3D8BA 3WYAA 4BN4A 5BVHA 4P9NA 1YB7A 1Y6QA 1A8PA 4I9HA 5TNXA 4QHTA 1QV9A 1A88A 5HRCA 4QM6A 7ADHA 1Y3CE 4A0SA 2AXEA 5F78A 4IH4A 1RP7A 4HXFB 1YBVA 4QUJA 1QCZA 3NNDA 3KFXA 6ABPA 2RGRA 3DBHB 3AERB 3HBFA 1MOSA 2GZ3A 3OQ1A 3NIDB 4NV1A 4OXIA 2IXTA 2QL6A 2QORA 4QFBA 2BE7A 1MHPA 1V9CA 2Z1MA 3OWXA 2DPGA 4A0FA 3DYVA 1NM5C 2MSNA 4LHZA 1E7QA 3DVRX 4Y2QA 4ZOAA 2C8JA 3D31A 4A2WA 1XQ1A 2FPSA 1PJQA 2B8NA 3HV2A 2BN4A 5DHQA 3OQBA 1P73A 2F2TA 3DMRA 1KRHA 2IPXA 3FYTA 3EC2A 4Q7QA 1MABA 1KOFA 2VXYA 2FPPA 2XYRA 3ORSA 4WXRA 4Q1CA 2Z5VA 4MS3B 4B7AA 3OZWA 4UDNA 4Z0TA 3W6PA 1RWMA 1ZRHA 1TF2A 3HDYA 4TTIA 5FA8A 3DFMA 3SBDA 1S2LA 4L0MA 1TA9A 2FSVC 4LXTA 5CCEA 3I2YX 3EPHA 4RCVA 3S4YA 3EIQA 3K9CA 3KHTA 1YDWA 1ZIPA 3A1EA 2OHJA 3G89A 5D8DA 4PZ0A 4L1KA 1SD1A 1SU8A 4BLUA 3AEUA 1SOWA 2DPYA 4I4TA 1IY1A 2JBAA 3BTUA 4UCFA 4JCCA 3VAAA 3G8CA 1A27A 1MO2A 3PTLA 5IHXA 1TB4A 3LHKA 3TOZA 1KJYA 1TYZA 1WUJS 3FCUB 3E0XA 3G1TA 3OZRA 4OFBA 2WJVA 5EKXA 3AEZA 2A0FA 2I4NA 1N0HA 4MS1A 2C2WA 4B6FA 3WJAA 3JQCA 1R8XA 1TO2E 1TUBA 3F9RA 3LYHA 1WPXA 4KFSA 4FOSA 4P5DA 1JVSA 4CQMB 2J46A 1IXYA 4RA6A 3BB3A 1JHMA 5C7OO 4AJPA 2C7OA 5CH3A 4BDTA 3GFQA 1YE8A 3U7RA 3LH5A 2Z2ZA 3IAS1 4P0TA 3JV7A 2PL5A 5ALOA 4BNGA 4E2ZA 2IHTA 1E2GA 4HSGA 1BX3A 1N2SA 1GR1A 1TM3E 4TTRA 1GG8A 5DGTA 2VRNA 1FRQA 3WLPA 1MVLA 2JG3A 3KEFA 2WTBA 4ARIA 3KEGA 5AOBA 4BE7B 2QW1A 4TV9B 1UXKA 4JLPA 1NF9A 4TL8A 1QBGA 4H0FA 2VC2B 5CFQA 3BD7A 3NDPA 5FPYA 3RBVA 4C0HA 4MW7A 2EIHA 2VHVA 3KDAA 3CZAA 1LD3A 3UGKA 2R00A 1J7KA 3I01A 4N5IX 4RWZA 5AHWA 1NVVQ 2D0OB 1N5RA 3VBEA 2O5EA 4QWMA 3F6CA 3RC3A 4C4AA 1HE8B 3D6HA 3RI3A 2PMBA 3KJXA 1RYDA 3EIHA 3IDOA 4FUTA 1P0CA 2A2ZA 2HCFA 3PYMA 1K66A 2C9DA 4OG2A 3B6JA 3G8YA 2F43B 1H23A 1GOTA 3EDCA 1WA5A 4BGIA 1PLKA 2EZTA 3RE1A 4JX8A 4WBSA 2Z2JA 3WR5A 1RADA 3NUZA 4N18A 1E5QA 2EWMA 3DFKA 5A0FA 1WZUA 2FQQA 4DLUA 1CETA 2NACA 3NIWA 4LEIA 1JHVA 3AF4A 4PYQA 4Q18A 1BWQA 1NR7A 1XD9A 3KR1A 1HRDA 2MHCA 4GMHA 4KX5A 4NZNA 2OK7A 4OOEA 5GPBA 5C31A 4HEJA 2HRZA 3VNVA 5HQTA 3SXUB 1PV4A 1BN6A 4PC2A 1PJZA 2VF7A 5JXJA 4Y2XA 3JQ9C 1T26A 4KJZA 3H3JA 1SQFA 5AIAA 2RGWA 2WNHA 5AQEA 4DCTA 3DLCA 5C4GB 1N25A 1ORIA 2J5XA 4HCJA 3UMCA 3FBWA 5TQ2B 4AUKA 3GJQA 4AWAA 3GLSA 1U0RA 4JL8A 4MO9A 5T5QA 4HLCA 3AF5A 1Y98A 2A8YA 1YCFA 4EA9A 1GTG1 1SCDA 3FN4A 4JBNA 4XGKA 2E87A 5F5NA 1USIA 4XCXA 3OCVA 1CU1A 1XMIA 3PRJA 5DTRA 1L5VA 2H54A 4ITVA 3T4EA 2CNKA 3BMQB 5KUTA 2H18A 3AKEA 1SRQA 4TL6A 1IB6A 4RETA 4LISA 3RUIA 4WRRA 2WT8A 4POAA 1U7HA 4EY5A 2ZJ3A 1U8CB 1Y0BA 4HXGA 4F84A 3KWLA 1RAAA 2C00A 3KLBA 3IB3A 3M6WA 4ZOLF 4URWR 3U3JA 4RTKA 1CRLA 3O8BA 4CV3A 3HJFA 4X6LA 1T25A 1I7QB 3DYBA 3QMWA 1OLSA 3ES9A 1X7YA 4RABA 3CR3C 1BO6A 1MDFA 5GY7A 3RJMA 3TPFA 3F2VA 4CMKA 2G8NA 2D2IA 2BEVB 4R1PA 4Z4CA 4N76A 1LPAB 3IP5A 1W35A 3LOPA 3BCRA 4LYFA 3G9QA 3ZU3A 4UBKA 3OE4A 5CA0A 4WNIA 1V3QE 3U4MA 1TGYA 2NTJA 2PRSA 4UPEA 1K7XB 3QLTA 3FZQA 4JYBA 4TXLA 5HRAA 4NCXA 2ZYVX 3RSSA 2R6JA 2PQ0A 1O6ZA 1WCWA 5JEDA 3U6BA 1BMFA 4N5MA 2XUIA 1ZJ4A 2IYXA 1W5TA 5DWDA 3U37A 3SZMA 1T5OA 1RP1A 1Z37A 2DY1A 3CXUA 3L7DA 4R5MA 1MEEA 4FT2A 4R9RA 4BFLA 3K70D 4GC9A 3WOHA 2PZEA 3ENNA 4N5HX 3GA5A 2JL1A 2RDMA 2I5PO 4G26A 3AJ8A 3NKVA 3Q9UA 2V6BA 4IMPA 1VA5A 4EPWA 2AN9A 5CBPB 1ZU4A 2MDTA 2ZRLA 2H0QA 3LPAA 2V7EA 2FF5A 1S3IA 5K4GA 2ODNA 1KI6B 1L5FA 2W70A 4YQYA 4I50A 3QTLA 5IJZA 4KK3A 1RMTA 4KVGA 2BUAA 2UVPA 4URHA 4FBGA 4IHAA 1TQ2A 1V8OA 5JAPA 2B21A 5CD9A 3WL8A 1D6MA 3KZ1E 1QKKA 3C98A 2WZCA 4KB5A 3QW2A 3M6IA 5CEEA 1FNMA 4H7PA 1U8FO 2QTZA 2QRQA 4I6GA 2PH3A 5H4HA 4BU1A 2J09A 3PFCA 4KITB 4IDAA 4K0RA 1MB4A 1E1QD 3F4BA 4MWEA 4KDRA 1PKEA 3TI9A 1W36B 4A26A 1IUPA 2Y6UA 3OT1B 4J90A 1M2FA 5M2QA 1PQPA 3H9GA 4MS4B 3R8FA 1XD2B 2O1EA 2FR8A 3T7JA 1KEEA 2IK8A 2CJFA 2N42A 2XEXA 3BXOA 2RMKA 2H1VA 4M6WA 3GPIA 1IWBB 1ADFA 3IT0A 5C18A 2H52A 4M1TA 3ZK9A 3MA0A 1W25A 4Y8VA 2PSDA 2QZ9A 2Z0MA 4LXQA 1JT9A 4BNDA 4EAAA 1MGOA 2QX6A 2YMPA 2DUJA 4V24A 4JA2A 4X8OA 1IYZA 2PVPA 3JD1A 5FBZA 1LK0A 1R0YA 4YRCA 3DT9A 4YJ3B 4PAQA 1TZCA 2R4TA 4RD4A 1Z5ZA 4MK4A 3V1YA 3T7DA 8ADHA 1A0OA 2FG5A 2ZSEA 2OV1A 2ZGVA 3Q3IA 3R5SA 4FBLA 4HAUA 4LZOA 3VSCA 5A4DA 5P8WA 2CYAA 2GBIA 2B25A 4PLZA 2CDAA 4C14A 3H6HA 1ZVJA 2O8EB 2WD7A 4G5FA 1SKQA 4MQFA 4H7DA 3I39X 4H9GA 1NI5A 4LY0A 5EIAA 2Z9CA 4JJGA 3IP8A 2C98A 2Y2UA 3G2IA 3MSXA 3WKDA 3DBRB 5E6RB 3HH8A 4BEJA 2CFOA 1X14A 2VBGA 3U3OA 4XASA 5IYZB 2IS4A 1YKGA 3EPPA 2ORVA 1LWNA 3OSZA 3S68A 4F3TA 4OV6B 3KQMA 1NZJA 3EEIA 2ZTVA 3H2HA 2E48A 1DWPA 4QDOA 4ASUA 1C2YA 1AB6A 1UDXA 2X0DA 4E1AA 1VHDA 2AUNA 2P77A 1OGYA 2VUUA 5K8TA 2ATVA 3FROA 1AGNA 3FNIA 3F7MA 2AFIE 3QOFA 3RIEA 3MLAA 2O20A 4L51A 3W5IA 5CBKA 5HM6A 3MWDA 4RY9A 3GUHA 2ZSKA 1V3VA 1W9HA 2H08A 2NXCA 1G59A 2JJ2D 3E81A 5JCOA 1JSXA 4S24A 1WB5A 2IUUA 1QZUA 5FBLB 4CJXA 4BWGA 3IUPA 2R1VA 3IKMB 3RDPA 4MDEA 5FUBA 4FMBB 2A5DA 3LX8A 1WXEA 4UNNA 1KJIA 4RC9A 3W2FA 5A5DA 3LPDA 2JVKA 3LBHA 3ZDDA 1TC2A 2DAPA 2C4WA 4B3RB 1ZM3A 3MC1A 4AG5A 4IQ4A 4XPIB 1T9ZA 1U8AA 1P7PA 1WXQA 2QD5A 4PQEA 3U7JA 5AUPB 3GELA 3BFVA 2HY7A 3S2UA 5K3EA 3PDWA 1Z36A 5KINB 2D1FA 3X44A 2GAOA 4ENQA 3HRKA 4IRUB 5KJ6A 2R9VA 3FWPA 3QFHA 3O9MA 1OWPA 4GR9A 1JA0A 1VRWA 4YRJA 5GOTA 3BMXA 1ISHA 3LUJA 4XGNA 2D1SA 5FXMA 1XPUA 5LJIA 1ID8A 4WZBB 3TLEA 4IIGA 5DCYA 3PRYA 5ALMA 1ZNXA 4BO7A 1PCXA 2FOIA 2ZK7A 1PTJA 4EFKA 1YZ3A 3KD3A 1HTTA 2ADFA 1UZUA 2AOTB 3MJEA 4BGVA 2ZJ5A 2C9BA 2G4LA 3EGXA 3MMNA 1C8VB 5CW1A 3LP5A 1W88B 1SCUA 4DOMA 4EG3A 2CXPA 3RU7A 3ZLTA 1HEYA 3OICA 1JDJA 1TLLA 4NL4H 3VQTA 2EEZA 3AYZB 3WLMA 2G25A 4CMIB 1FMJA 3DZIA 1QIKA 4OI2A 4UBJA 4IIEA 1QTIA 4BLWA 4CR8A 1UJBA 4HEQA 1Z2PX 3CN9A 3VZDA 3MWJA 3MUNA 3RSLA 2PJRA 4JI2B 2JEOA 3OUTA 3F6RA 4IOKA 3U7EB 1HR0B 1CLUA 1JP7A 4QDJA 4NENB 5F9MA 2DWQA 1P4AA 2AG6A 1GN9A 2XKJE 4DPMA 5KVCA 5L4LA 4RL6A 1LDEA 4DA0A 3OX3A 1H2WA 2XDWA 3TDKA 3FHCB 2NWQA 2XTMA 1I7LA 2WU4A 2J0VA 4MQ6A 1ABFA 1KZ6A 5AKXA 5KTKA 2Z3VA 3MJTA 1IAQA 2XBMA 4GMKA 2HA4A 2PMCA 1CD5A 3QLJA 3WRXA 1QHXA 3RGGA 1ZJ5A 4TQ9A 2XI4A 1M6YA 1JI0A 3RHSA 4O59O 5J2UF 2YMQA 1GPDG 1MRNA 2OYSA 1KPIA 3CCBA 3IUNA 1YZNA 3GJ0A 2QYSA 5C51B 1MZPA 3ZZTA 3FRJA 4UHDA 5CJPA 4URXR 4OLJA 4HNUA 1F7UA 2C7GA 4OHZA 1HFKA 2YQ5A 2XYVA 4BQEA 4EQ6B 2DSNA 4ER3A 4L78A 5FBRB 3JQEA 4FR2A 4B6JA 3BAZA 3W2GA 3OE1A 2F7SA 5ESWA 1BH2A 3DEHA 1HO3A 2QQ5A 4PYLA 4HMOA 5BPFA 3B48A 1PWEA 4R69A 3O4GA 4HOYA 4WOCA 1GFIA 5CDFE 1QP4A 1PFKA 4Z4HA 2WC1A 5CVTA 5GGXA 4I5IA 4RMHA 1HSZA 1IHOA 2L17A 2IHVA 2ZSHA 3I9LA 3ZE0B 2WQ7A 2ZSJA 4TVKA 5EP3A 3RBXA 2DPLA 4GPEA 1I36A 3O8OB 1X9HA 3C5VA 3C5HA 4LBYA 1PQ4A 4WZAE 3ZDYB 1XZDA 2PQ6A 1M8JA 2I3DA 3I72A 4NK5A 1PW7A 1U6JA 1XUOA 2HPZA 2QQ0A 1TMGE 3U4GA 2VDOB 4N7MA 3VI4B 2CHFA 5EL0A 1ODJA 5C3MA 3RFXA 1FJXA 2EC5A 4JN6B 4KX3A 1M75A 4FHEA 1RIIA 4EMBA 3S3TA 4JENA 1H4QA 3WWPA 1J8DA 3A6ZA 3NVMB 1O5TA 1YHNA 3O03A 4K9KA 2VUTA 4GMGA 4ZANA 1FTNA 3ONNA 2C2YA 2UZIR 2FUG6 1XL0A 4QPNA 4E11A 1G98A 1XTIA 1C2TA 3R5HA 4JLOA 4ZCRA 4G5GA 2H31A 5FULA 4I2VA 5A04A 4L5JA 1Q1AA 1U2QA 4WAUA 2HHJA 5EYPB 3WWEA 2A3NA 3K1AA 2OESA 1UMDA 1NNI1 1WMEA 1AN9A 3OFNA 1GV0A 2NVUB 3ZBUA 2ZE6A 1XVAA 1YZTA 2VATA 1HMPA 1ZA2A 2IOQA 2P9EA 3GD7A 2AEEA 4P3PA 4XD7A 3WMEA 1KY3A 1IN6A 1QHSA 3GMDA 3LZ6A 1BX1A 1Z22A 4GVXA 4KI7A 1Y8QB 3FXAA 3EA0A 1P9OA 4FWBA 2XZDA 4ZOLA 4EYSA 1G8JA 3HXQA 4XSVA 1UBCA 5C46F 4C2AA 1XNGA 4CUJA 1X0XA 1Z45A 2LTAA 1NW5A 2Z5FA 3LXXA 1GQ2A 2IU4A 3SQNA 4ARZB 4EB3A 3WK7A 3JPWA 5DI3A 1XKXA 4ALNA 3EVTA 1UANA 3N70A 2BI4A 5CT6A 4B3JA 1J5XA 3B2NA 4DCSA 2IYNA 5C7YA 2DWPA 3AJAA 3GNTA 3UJ9A 3ZVLA 2RAUA 3SVZA 3SJBA 2UVDA 4S2EA 3B70A 3TZQA 4ZHQB 2O5CA 4L8LA 3WDKA 2XZOA 1ZCZA 4W1PA 3K6SB 2XZTA 5MFPA 1QIEA 2VOEA 1XMQB 1ZK4A 1F6DA 4MP8A 3T61A 3W9BA 3E15A 4MIYA 3IMCA 4HXEB 4K88A 3IESA 5FI1B 3ZVNA 1RC1A 4IJKA 1AHPA 3L04A 3ZQJA 3GJ3A 4H4EA 3CPHA 4PCLA 4BTLA 1UEXC 5FYDA 2YXLA 3PC8A 5IARA 1SZPA 1F0KA 3KFVA 3T7CA 2JJ8A 2A0XA 3JQAD 4J0KA 4CUKA 3EVDA 5L40A 1K86A 3H5VA 3TLCA 3VHXB 4YXFA 4JWTA 2VNIA 4NHEA 1XZLA 2AB0A 1CR4A 2RAPA 3GLVA 4GLBA 4OY3A 1Z7GA 1K3FA 4Q9LA 1VPEA 3T12A 2G1KA 1DJQA 1EUDA 2J0EA 1WP9A 2V9PA 3PDCA 5DNAA 4CTNA 1ORVA 2CSXA 1WDLA 3A7DA 2ZYIA 4IGAA 4ZP1A 4CKEB 3QKRA 1YS4A 1N34B 2JEYA 4RKEA 1SG0A 3FTNA 3ELUA 1DARA 1TEZA 4B87A 2AN5A 4ZJUA 1DV2A 1T9GR 1D2CA 5HOQA 2JD1A 3AHIA 2O3QA 2D3TA 1OXBB 2QW8A 1VE5A 1KMMA 2YUTA 4E12A 3H6KA 4JLKA 2HZBA 2FQ1A 2HLDA 3I23A 4S0XA 3G23A 3HB5X 4MWDA 4PNHA 3M83A 1WU7A 3KQQA 5EC8A 5IH3A 4D74A 3QELB 2HU7A 4O4JA 4QICA 4ZVPA 5FI5A 4TLBA 4FMCB 5ETJA 5JMPA 1M1UA 4O2AF 4DRYA 1E94E 1DADA 1MENA 1U94A 3PF9A 3L7NA 4MYHA 1S2GA 2AFIA 1XKTA 3CO5A 2P9GA 1XWIA 1N5JA 2A84A 1X9IA 5JJ5A 5LZ2A 2PT6A 1B26A 5CM8B 3CF4A 4F8EA 3R7NA 1YRLA 2ZI3A 4NEQA 2C2GA 2ZTUA 2WZDA 1BCSB 3MMSA 1XRQA 4ZYVA 1VJ0A 1FFSA 4P7KA 2EKDA 2VHTA 3EN0A 2ZUTA 4BEWA 1GGKA 1NQWA 2YVLA 4KAFA 2WJHA 3FTEA 1VG0B 4ZYXA 5E95A 2NOAA 2C78A 1I80A 2OZLB 1TU3A 2COUA 1LA2A 1GT91 3H9BA 5CM2Z 3Q3CA 5D5PA 4Z1OA 1EG2A 5BV8A 3BXHA 1G6KA 3AF2A 1J00A 1FBNA 2UYQA 4RTOA 4P93A 4OMUA 2WK1A 4D96A 1UFVA 3H7IA 3KLOA 3LC7O 1XLTC 1RXCA 5AVUA 1JPNA 1AC5A 1P5HA 2A1UA 5SZKB 3TNLA 2OV3A 1R4NB 4TTQA 1KO7A 1ZS9A 2PZBA 3G79A 2XB8A 5TGTA 2R751 3ZWOA 1LTQA 2W2VA 3C3KA 4TYPA 4D9IA 2I4RA 3NHRA 1PL7A 2O1SA 4Q02A 3C8HA 4BWVA 3SHVA 1DL5A 1R50A 1VYTA 2QX9A 3DMFA 3MTDA 2BP7A 2FN3A 4HNAA 2VPPA 4IJWA 2J5KA 1OIXA 1VE3A 4II2A 3ONEA 1KYVA 4EF5A 4EI7A 5D51S 3TAHA 3I8OA 2YIVX 3UC9A 3R0IA 4JLSA 1ZM2A 1IQRA 4TM8A 1GADO 2O7SA 3RRFA 3DEIA 4CNQA 4M7WA 5BNWA 1VJRA 1PRYA 1XXHA 3DP9A 3WB1A 1W19A 2FEKA 2IYAA 2K87A 1WKCA 1GZ6A 2PJDA 3DAFA 1PHPA 4FZ5A 1MW8X 2OXEA 1QR2A 1DQYA 3ETEA 2FLKA 3FFXA 4IHKA 2Z95A 4MVCA 1SC4A 2X5XA 3KNZA 5ALYA 3GZTB 3HKCB 2MYNA 4P92A 3OA2A 5FI3A 1CBUA 1KOLA 4CQMD 4NICA 1IVSA 1AMUA 4IJ6A 3WFZA 1GZ7A 3RSFA 2IL1A 3VOSA 3ZOZA 3QEKA 1U9CA 4KZPA 1WW8A 1VGVA 1XMSA 2PUTA 1ZCAA 1BE6A 3EMBA 2IKSA 3KD2A 4TUYB 4D46A 1N2EA 3GGCA 1C3VA 3IV6A 2O06A 2AR9A 1NQXA 3HP1A 4GOXA 4TLLB 4YP1A 5LQMA 2PD4A 2C5FA 4JQYA 4TT8A 1PV2A 4OB8A 5AW4A 3DOEA 1T8PA 1VB5A 2QYTA 5AW8A 4MKZA 3REFA 2QD4A 5JZBA 3ZV4A 1OD6A 4OLFA 1U6KA 3IVMA 3KKKA 3Q40A 1JKJA 4O1HA 1JX6A 4ZQHA 3TBHA 3NVAA 4Y2YA 1V1RA 1PEKE 4OHMA 4C05A 3GP8A 1DCKA 3ECAA 5ALNA 3Q0TA 1WTCA 2X9GA 4B6RA 1JQKA 4A3SA 1WKVA 4E5KA 2DHDA 5CDFA 4OA5A 1U3GA 3RAFC 4OKSA 4ZK2A 2LDBA 2XCIA 4BQFA 1YS2X 16PKA 4IXTA 4OHBA 3ZE2B 3D54D 1AKWA 2ZKIA 4QLBA 2GM9A 5TEVA 5KIAA 2FMTA 3ZIAD 1WJGA 4JUBA 5E7JA 1DXYA 1UFRA 1DKLA 4ZAWA 4LJYA 2BW0A 3BRQA 1Q0HA 3EXEA 4V03A 4WZAA 4LF4B 1G9SA 2JHFA 2B94A 2J08A 3BGVA 3C1TA 4Q3BA 3ZWXA 5K7SA 1TCAA 4K3UA 4NJOA 3QBEA 4XVQA 1Q77A 4WFQA 1HTWA 1OFTA 3TL3A 1Q0RA 2R2GA 1U3TA 3GN2A 3SJAA 1P1FA 2A3RA 2YXDA 3Q12A 4P7BA 4AZ0A 5J2UA 2ACVA 5CYPA 3SQOA 4K9QA 3PFIA 2GBLC 4TKMA 2B7BA 2QI9F 5BUSA 2Q5QA 3IE2A 4GUAA 4QU9A 2WPDD 1TKBA 3S27A 1HV8A 3NZEA 2H1FA 2I2XB 2RE8A 4QVIA 4CTMA 3LT2A 1T3SA 2NSYA 2IV3A 1WLSA 5CK4A 3KJIA 3TLGA 3OCXA 1CNFA 1TW2A 2NN3C 4J4HA 1STOA 1JEQA 2PQ2A 3LIPA 4NESA 3EPLA 3V46A 4ETIA 5C4IA 4D5EA 1ZBDA 4X3OA 3RAEC 3QHAA 8ABPA 2GGSA 5E4JA 1IIRA 4MUIA 1D0VA 3OEHA 1AK1A 4P08A 1YGYA 4O29A 3VR6D 4A0RA 4TZKA 5AVZA 1WXFA 4J6FA 4G5RA 4O0MA 3KSAC 2O07A 5BSVA 1J5EB 1JDSA 4H6XA 2UU9B 5DM1A 1U80A 1MQ8B 4Y6LA 5F23A 1T29A 1A1SA 1A2QA 1SULA 3WSTA 5JROA 3BB4A 1G21E 1GP2A 1KR2A 2DY0A 2VAPA 1L7AA 3AB7A 3ER6A 4HRVA 1UXJA 4I46A 5D3QA 5DVZA 5KU1A 4EYOA 1C7EA 3IEIA 2WLTA 3MWLA 3QFRA 4Z53A 4F1WA 1WOYA 2CXUA 4Q3KA 2GZ1A 4XQ0A 4GRAA 4ZU3A 1VPDA 4FXPA 3TLBA 4BZZA 2RH4A 4A4DA 4XR9A 1T4DA 1YZVA 1CQJA 2HAEA 2Q2VA 2DPMA 4KNYA 1XCMA 1GZHB 2FN4A 1XFAA 3EXG1 4FU0A 2BUBA 2NXEA 1OOEA 3RFTA 1JEDA 4NIMA 1PR6A 4XWAA 3TE6A 4ZZIA 4CLRA 1QUFA 3BREA 2IZ7A 3ZE6A 1ESDA 5FTJA 4GQBA 4I3HA 4ND5A 3L6DA 2QN8A 4RS4A 1T5TA 2HCTA 3JZDA 3OKPA 4Q3CA 4U2FA 3F4LA 3NS7A 4J0HA 1QRSA 1H5NA 3ITDA 4QPDA 3OQMA 1G6Q1 4GU5A 7MDHA 1Y8CA 2A9KA 2FQXA 2ZRPA 4ZMSA 2B4KA 1QIHA 1VLVA 3VDNB 3WLKX 2M98A 1GQFA 2XMRA 4KQHA 2XPCA 5DK4A 5C52B 2EBFX 2FFBA 1RHUA 3N7AA 4GM1A 1R12A 3AIOA 5K3SA 2O7VA 3U2QA 3V8RA 3N5CA 4IJQA 4BPBA 1MO5A 4RKFA 2R3SA 4C4TA 3IT2A 3IEMA 1C3OB 3THWA 2XEDA 3BL5A 1GAQA 4ZK6A 4X6UA 3J81k 1Z6ZA 1EVIA 4AZ3B 4GECA 4M2LA 1GPNA 4Y9DA 3V8MA 2VRCA 5JD5A 1GZDA 1SBIA 1L7MA 1F6WA 4DDWA 1DEKA 4FZVA 3BULA 1I5OA 1TK3A 4IG9A 2WSMA 1C0PA 4UXIA 2NUBA 3G0GA 1AURA 1QHHB 1V16B 3MT9A 3KE8A 4XWGA 3TAXA 4BRSA 4BX2A 4DKXA 1A3CA 2QLFA 3QXCA 3CMCO 4X20B 4QGSA 2PT9A 1GEGA 2WWGA 2W42A 4KE6A 1W36D 5LKRA 2BEJA 1BEEA 1G5PA 1KI2A 1WMDA 3AHFA 4KAAA 5DSZA 3UTDA 3TR5A 4DIKA 1G5TA 2PE5A 2B2CA 1ZMTA 1M8GA 2Q45A 3S8YA 1WCIB 4E94A 1JI3A 3D7NA 2JJ1A 2UVQA 4M53A 3I9JA 5E9AA 3DW3X 3PFKA 4CM3A 5T3UA 1TVKA 3Q11A 4ADSG 4BVHA 5AVYA 3W5VA 4OQFA 4IRXA 1QZTA 2I7CA 4NH0A 1XRLA 3DWEX 1NQAO 1XC7A 5EMNA 4AT1A 2BGTA 1Z6AA 5A9RA 4IXWA 1TVEA 3BJRA 2Q8QA 3NHUA 3GRFA 2RI6A 4ND6A 3GZ4A 3LF2A 4AO7A 1R18A 2G80A 3EAQA 4UU1A 1HZZC 3PUKA 3FFWA 2NU9A 1RRCA 4AJKA 1PT9A 5AXBA 5F5LA 5IZCA 1E4OA 1QO9A 2ZQ5A 2AFHB 1WMFA 3RFCA 4Z7NB 1BKYA 4KBFA 4KHPB 3MZ0A 1QH8A 4IQ8A 4G24A 1RYEA 1FP1D 1FYEA 3JD4A 4NQZA 5G4KA 3SF8A 5JCXA 2QSUA 4XWWA 4D9FA 3Q3VA 3RYTC 3GUZA 4OGKA 1RCTE 1O3YA 3D59A 3GJ6A 3QX9A 3V80A 3LO5A 3SIWA 1XKLA 3HSSA 4L85A 2CDCA 3UNXA 4LRYA 4UDXX 1Z28A 3G7NA 2Y99A 3KAJA 4DV0B 1R00A 3HRIA 3R1IA 1NDQA 2QPOA 3ED5A 4JLMA 1EK2A 1CEYA 2C31A 5CDUA 3ND5A 4LRSB 1UT6A 1YT5A 4N39A 1EE1A 3V6MA 1PS0A 5K2MA 5KNLA 4K8OA 2MT9A 1F9EA 3AHEA 3HZZA 1HPLA 2OV8A 3VKUA 2RIRA 1I4LD 2QN2A 2ZITA 3A3KA 3CR8A 4LQCA 3K6KA 4XTRA 5DYWA 1MUUA 4R2IA 2FZEA 2EF0A 4RH3A 2ACKA 1EQAA 3KELA 3Q8MA 3WTBA 3JCZA 2AKYA 1L4KA 2F3TA 1S0UA 3RC7A 3AIMA 3NEAA 4YJHA 1A71A 3I9OA 3M33A 1O58A 3Q7SA 4DANA 4IZ6A 5CEJA 1DKOA 1AO0A 2W2XA 4G0UA 4DWVA 5EWMB 4UMFA 3BWVA 3L01A 2WAMA 3UVEA 4LHVA 3O4FA 1U2DA 4J1NA 5KI6A 2WWYA 1YRWA 3G2MA 2VJMB 4OJMX 1JFFA 1KEZA 1P33A 4JWKA 1OLUA 4ZKDA 1QP0A 4HYQA 3KM0A 3QI2A 3SHQA 2OM2A 1OBCA 3PE3A 4J0GA 5I9MA 4M38A 3UV3A 4B0OA 4CFZA 5HJ7A 5LWHA 1IEQA 1DKPA 2H2FA 3GRVA 3VJMA 1ZN2A 1H42A 1XTTA 3VHQA 5TPZA 4KR3A 4R1SA 2DH5A 1XJ5A 1TE2A 4F2PA 1E6KA 1ZGBA 3H2JA 2FMIA 2WUFA 3IQXA 4IL5A 5G40A 3WLAA 3AVUA 1PFWA 3R7FA 2CJYA 1HQKA 3ISJA 3UXMA 1QC5B 3BZBA 5LZ4A 2WHQA 2X2FA 3PFGA 3QKSB 5FLKA 4GRIA 5FUXA 4CNBA 2L19A 4M46A 2QSZA 2VDLB 2VZ9A 1DAKA 3VNSA 3PHHA 5TQVA 5B5SA 1W96A 2JCVA 3GDFA 3MJSA 3KJGA 3OJCA 3EXAA 3D0RA 4PYRA 5G0TA 5HS4A 5KX5A 3OT4A 2FP4B 1I1QB 3RRMA 5SYNA 3OLYA 3KOWA 1H5QA 5JFTA 1TJ3A 1V4BA 2ACWA 3M8KA 1SELA 1UBSB 3TYXA 3QKUA 1NVWQ 1AKTA 2VQDA 2VSYA 3AO0B 2C58A 1E2NA 4RDHA 1FUIA 2JS7A 1DFIA 1ZXBA 2GD6A 2V3WA 1E79A 2JH9A 1A9ZA 1JXAA 2KYRA 5DGXA 4UZFA 3ENVA 4MKFA 1M10A 3EY9A 4N0QA 2VRBA 1U1EA 2Q6TA 2YJ5A 5A03A 2PSEA 5AI6A 4CGYA 2R8YA 4QULA 3UJPA 4LFAB 3LF1A 3IT1A 3Q0EA 3VC7A 1KMHA 3ESYA 3EZ9A 2VTBA 2XOKA 4D2IA 1IXKA 4EY3A 4OSEA 4NMWA 4B7UA 5J5CA 4RIGA 1Y1RA 1HGXA 3MRSA 2D1YA 1KDZA 4IDHA 3A32A 5HM8A 2ILVA 1C7FA 2WHEA 4I9GA 4YMWA 1KQNA 3USZA 4E31A 5JASA 1U2GA 2P2DA 2ZR9A 3M4ZA 3QTBA 4IAOA 1TM1E 1Z0IA 1E1MA 1ARZA 4W8OA 3THSA 5CB4F 3A3OA 2FWMX 3PC4A 5DF1A 3VA7A 3A3NA 3AHHA 5JZMA 1EVEA 4INJA 4RPGA 5TMDA 1Z9BA 1Q44A 3IJRA 1EP2B 1L5SA 1G21A 4J16C 2G9ZA 5DGIA 4B3MB 2ZZNA 4NJEB 3N8KA 1A9TA 1GUBA 4UEJA 1OVGA 5HUQA 2OP1A 2X1VA 2ZIEA 3MJVA 5FADA 5DH9A 1JDZA 3BN3A 2Q5LA 4MV8A 5IS2A 5AK3A 2QTVA 3QUTA 3H75A 5IFKA 2AKAB 4DJTA 2QRMA 4F2WA 1R6TA 3ESZA 1SXQA 3H3FA 3U16A 1AKQA 1JEYB 4Q9HA 2H29A 2NU6A 1YULA 5JC8A 5EXDA 2FWBA 1ADBA 1KQPA 2GKSA 2HJ9A 2XCLA 5JBNA 3AJDA 4CVNA 1JQBA 1VGRA 3LOQA 3M7IA 2OG2A 4LVOA 1T9GS 3TRJA 1C4WA 4O8CA 5L3ZA 2JI6A 2WUGA 2PUBA 1N75A 5C37A 1E1CB 4ZZ1A 5JQGA 5JSKA 3VXKA 4AK9A 5GJVC 2J5RA 1MQ9A 2EWVA 4OP2A 2DEUA 4XB6B 1XPRA 3ROGA 5ERYA 1DIGA 3TLMA 5BWOA 3L7MA 5J58A 1W46A 4AUMA 1KXZA 3F7NA 5E1DA 5K0LA 1BOOA 4H1HA 4E2FA 4N9QA 4QDTA 1FTWA 2O7RA 3OMLA 4WXPA 3WGYA 2C4VA 3QHQA 2QAGB 5JV5A 5ED0A 5I4IA 3V48A 3KHSA 2A7XA 1GTJ1 2J9FA 2KLBA 3OHMA 4HNSA 2RAFA 3EBLA 3QE4A 3RABA 1M0EA 2Z6VA 2IHJA 1PFUA 2I76A 3H5RA 1WB9A 3I2GA 3AEQA 1U65A 3C45A 4Q4JA 1DO8A 5JUWA 3UT6A 2J7PA 1YS1X 2ZIVB 4L4UA 3VISA 4MROA 4NBWA 2IGBA 1T5BA 4YWJA 1FY2A 1VBKA 4EY4A 4IDOA 1YK1A 5IAGA 3WLHA 4KR6A 1HQCA 1E61A 4CDGA 5BV2P 4Z8YA 5J47A 2G9RA 3BILA 2H17A 4N7BA 1CQWA 2BMJA 2P6PA 1WSBA 2PWZA 3NXKA 2C0QA 1UPUA 4XXHA 3MS7A 4C0SA 3WG9A 2IPMA 1KI7A 1Y3DE 3C3AA 5A2QA 1R0BA 1UJ4A 4KO4S 2A7QA 1USVA 4NXMB 2AXPA 3JW8A 3VGPA 1OLXB 1G6OA 4V3BA 3GMSA 3AUAA 3KT6A 3K9LA 3QFSA 3N7TA 4O2LA 4D4LA 3WNCA 4AMBA 1K5DA 4AF6A 4C29A 4KQEA 3AETA 1EGAA 4FEAA 4P4GA 1JR3E 5K51A 4UHEA 3U80A 2PZMA 3FUUA 1YK0A 3NQ41 4GAEA 3VZBA 2BZGA 1HM5A 2JJMA 5TMPA 3QEOA 5KSYA 3M6FA 3EEFA 3PIRA 2ZDGA 3CLUC 5A4MS 4EKIA 4YJ2B 4B44A 3BCSA 2I6GA 3F67A 3HCBA 3NONA 1EFUA 4R98A 5IC5A 3LLVA 2BR3A 3ZWQA 4BKPA 2I80A 4I8IA 4YMSA 3SXJA 1CZUA 1NJ8A 2OV2A 1JG4A 3TUZC 1V2HE 2HU2A 3LVRE 1VI2A 3K6JA 3H65A 2GTIA 3EUEA 2OKCA 1OI2A 4N65A 3LCCA 5EZYF 3UW1A 3PTAA 1ZM4A 1L5HA 1NUTA 2YMLA 5FOQA 1UPBA 4YAGA 1LQUA 2W37A 1MEJA 1SVMA 3OO0A 3QVGB 3OZXA 2PKEA 4L8YA 3RYCA 3D1LA 1XZNA 2P0AA 1OWMA 4JT8A 4RHEA 3RO7A 4Q4HB 4K6GA 1J0BA 3I5MA 5TR9A 1XRRA 1HRKA 1VMKA 4AYXA 4EW3A 3ZDEA 4KK4A 1IY8A 2HH9A 1PR0A 1L4MA 5KNDD 1ZI9A 3OF3A 4CM5A 5EJ8A 1OB2A 1KZ7B 2H6EA 4ZT4A 4GDFA 1YE5A 3I1IA 1SBZA 1OXXK 2RONA 3HLYA 1TMYA 4DDVA 2DG2A 3PPIA 3P0HA 1UC5B 5LM3A 5F7JA 3W9SA 3KOMA 5FUVA 1XAIA 3CPEA 1DEHA 2ZYHA 3NP7A 3W5UA 4OLHA 5CX1A 3WGUA 1MAUA 3DE6X 3O1JC 4H1UA 3QVOA 2FUEA 2VAWA 3OE7A 5C35A 1FVOA 5AVOA 3PC7A 4IEEA 3AVOA 3DFIA 1PNOA 1S3SA 3A28A 3FVWA 4O4HF 4EMUA 2QRZA 3D3JA 4NAVA 3AR3A 3G9ZA 5ICMA 3UAYA 3L7AA 3QEMB 4TRMA 2WP0A 1ZXLA 4WDRA 3W5AA 4HMQA 2DULA 3JX9A 1NVUQ 3DEFA 3QBVA 1QQ5A 4HZIA 1VP3A 1CVLA 1C4KA 3KLNA 4MNTA 4RV4A 3V1LA 1E1KA 4RH1A 1WW3A 1M73E 1UC4B 4JKOA 4MHTA 1Z4JA 4LRWA 1IBCA 2FSSA 2VCHA 3CSSA 4IP0A 1TU4A 5SY9A 3CH4B 5M29A 3CBGA 4W8GA 1UMKA 5F9FA 4B8ZA 3O8DA 3OTOB 2BZ0A 4Z8XA 2J9XB 1X86B 1JUDA 2H9IA 2PX6A 3CG4A 3OKFA 2B0JA 4L3WA 1RQ7A 3HCPA 1IZ0A 2PGJA 3TZEA 5JEEA 4NBRA 5J5AA 1A69A 4RFSB 3AVPA 2PKQP 1PR3A 4MQMA 3FTQA 3E4CA 4AJ4A 3R7LA 1GGVA 3BFXA 3VJKA 4DEVA 4L9WA 1Z5VA 1H4VB 1NQUA 2HADA 5KKNB 3QKIA 3FE2A 3SYKA 1Z0ZA 5K3CA 4QUHA 2X6TA 1RJWA 1BJTA 4FGZA 3FGPA 4FWIB 3U7GA 2G83A 3EH2A 3A1NA 3P2YA 1NQOA 4Z3OA 3RYFA 2H16A 4EJ0A 2D5AA 5FL7A 2OCKA 2C3PA 4XWTA 3RUPA 1XJQA 5I7RA 4PBRA 2ZCUA 2EATA 2X40A 3E8XA 3I2KA 4DV5B 1ILWA 1B7GO 3KE9A 1ECGA 3IP1A 3QBDA 4PG8A 2AW3A 4R2XA 1T2FA 1DOHA 3UK1A 3ESQA 1II0A 1RR6A 2H2DA 2VF8A 1Y1QA 3BCUA 3CB4A 5K6RA 3MD0A 3DOUA 4D82A 4UDOA 3X1JA 4RZUA 5P21A 4N0DA 2CXTA 1ESZA 1NTRA 1P0IA 4MMZB 4BP1A 4TOIA 1LJ8A 2AK3A 2CVFA 2GPTA 3CX7A 3PSHA 4HAVA 5IT9A 3CF4G 4U6QA 3BJZA 1A77A 3ICPA 4J2TA 4EO4A 1GA1A 3D2AA 3OOEA 4IXDA 2D4HA 4O2AB 1I4WA 4JL5A 2PX5A 5I9BA 4L6CA 3LU1A 3T9AA 1EINA 3CZ5A 1K7CA 2NUTA 3THYA 8AT1A 4S1NA 2O19A 1S3FA 3A9SA 3K8YA 2EBHX 3M5DA 3O74A 2OAGA 3GNQA 3D2BA 1PEDA 5EE5B 3ZE9A 1U6IA 3M1LA 4JOSA 2QLNA 3ANNA 1LLFA 2CT8A 1L4LA 4FCTA 1Z4LA 5AUOB 1HKUA 1UXOA 4LZJA 4QECA 5I51A 1ZW1A 2PUAA 1RJ9A 1T5SA 5EMLA 1K8XB 3FUWA 2WM8A 4PRYA 4ZVKA 5K8UA 2GK3A 3CLUD 1K7FB 2V4MA 5IKXA 1OH7A 5GM1A 2DT8A 3A27A 1PZGA 2RGAA 2QE7D 4LXIA 2F8TA 1EZ4A 2FEXA 4NU5A 2XVXA 2KW5A 4PWYA 1TUIA 3AU8A 3D64A 3NANA 2B5WA 4B3GA 2NYAA 4TLMB 2RHDA 4H27A 2R44A 3AL3A 3KO8A 4U7WA 3ZHYA 3G2NA 1KETA 3UUFA 4YCCA 1ZH6A 2WNSA 3IPXA 4XYEA 3VNRA 5CB4A 1R15A 4Q3LA 4RIFA 1KAOA 2IYWA 2X9QA 3QVXA 1EKXA 5EWLA 4OXYA 5JS2A 3UHAA 3ZUGA 1M0TA 1WRBA 1YB6A 5SY4A 1NL3A 4JHXA 3ROMA 4MCHA 3DP7A 3KOUA 3STXA 3ZHZA 2YVKA 2C1XA 1UJ2A 5CH8A 1CHDA 1Z06A 2C3UA 1JIJA 2F1JA 4L7QA 4QELA 3SS9X 2ZOSA 3S5UA 3TFQA 4EJ2A 4OJNA 3HUTA 4D3XA 4X5OA 2WTMA 2FDRA 3GGJA 1WCYA 1J2RA 3E82A 2VDMB 1LKZA 4RESA 1YL5A 3ML1A 5J59A 2JEZA 2P11A 1VYUA 4GYKA 4YASA 3EX7C 1PYDA 4V0ME 1TQHA 5K9ZA 3WRVA 3RSQA 4DCJA 1RABA 1G20E 2DFVA 3QYJA 2QROA 3IHWA 3GPCA 4JC5A 5HJ5A 1XHLA 2LNDA 1G8YA 1E0SA 5CTJA 1JGTA 1ITZA 4J1QA 2PIDA 3VUFA 1XTRA 4YYZA 2R2AA 3F4KA 4WACA 4XLLA 1ESMA 4JYZA 1MRZA 1XDUA 1ZRNA 2YHIB 3KT0A 4NE9A 1Y37A 3X1MA 4AS3A 5LKAA 3GP3A 4PXYA 3KQHA 2QL7A 4ID9A 4PZ9A 1FCJA 1NVDA 3X43A 4EECA 4KXWA 1BCRB 4B6QA 2C3OA 2J45A 4B3HA 1AJEA 4ZVOA 2BDTA 3VMFA 2HPHA 1THTA 2FZ5A 4RKRA 1AG9A 1LPBB 2FMHA 4GMXA 3QTTA 3UUWA 4W7HA 5IPFA 2R68A 2Y1EA 4QJ3A 3TBFA 2HIGA 4F4CA 2V0GA 4EKGA 4LX8A 2X3YA 3KL4A 4TTJA 3WQQA 1BWRA 1KVSA 2OOKA 4DVJA 2C2OA 3KHKA 3NM4A 3B2EA 2R8RA 1F4VA 1FSFA 1UL1X 3EWAA 4B6PA 4EOGA 5H1YA 5B6IA 4IJMA 3WLFA 5IBCA 1VECA 2C4KA 3OZDA 3O26A 3CEPB 3BVPA 2FFJA 1QK5A 3B3AA 5JCJA 2GHRA 2JLQA 3IEPA 1KYYA 1YIDA 2ADMA 2WJJA 5AKLA 1Q0TA 2QNIA 4FQ7A 1FP7A 1TYCA 4CR7A 4HUTA 2UZ0A 2J0QA 2IELA 1FDIA 3AR9A 3E5MA 1S4MA 2GPWA 3M6UA 4JEIA 4XI9A 1XK6A 3PGMA 1L5KA 5LQDA 3UHPA 3RRXA 4QTXA 1YACA 3CX4A 4QAJA 4OX9B 2P65A 4I66A 1D04A 1L5RA 4V0OA 2NPIA 3RS8A 3PDIA 2C82A 1GPYA 2XT6A 3OESA 2PLFA 1SVIA 1WPRA 1S1MA 2G08A 2V7GA 6GPBA 3U48A 1MIOA 2IUEA 4KQJA 4R9UC 1QGED 3T5BA 4DNQA 1DELA 3IJ5A 1X8LA 3EW9A 2I7TA 5T3YA 5EJAA 4UHBA 2AC7A 2DUNA 1RFLA 1Z83A 4G97A 3QU4A 5AKIA 4BQIA 2QG9A 3FPJA 1V39A 2XDQB 4AXBA 5M04A 3HR4A 4QRDA 5C9ZA 1QH1A 5ALVA 1JVNA 1MRSA 2AX4A 4FFWA 3L9XA 1QYRA 1Z73A 3GJZA 3GIDA 1F3LA 3GNSA 4DJFC 2ZZKA 3ZDAA 3F3SA 3D0QA 3QOYA 4E5SA 5A6SB 4LTNA 2VH2A 2X42A 2I6FA 3WYCA 1D2RA 1LXCA 1XOIA 2QUHA 4OLBA 3H4TA 3K0AB 4FD3A 4YRAA 2QSYA 4HX9A 3A6PC 3TSZA 4R9VA 4L5BA 5BR4A 4TRJA 2OMKA 5E6SB 2BAGA 2ZIUB 1A82A 1T4GA 3FPKA 3L92A 3ZQUA 2X7XA 3KTAB 3V4OA 2IW3A 4B2IA 3G0BA 1CFJA 2C04A 3UWDA 4H7IA 2FKNA 2SCUA 1PJAA 1JA1A 1W1IA 1RM0A 2QAGC 1YVRA 2R87A 3HVHA 4PLCA 3DCYA 3IEUA 1ZMBA 1RBYA 1ECLA 2O2DA 2Q4RA 2ZIAA 2W2KA 4LCBA 5CYFA 2WIAA 4WW0A 5TY0A 3RHFA 1E3EA 1O87A 4J8PA 1U8EA 3QPBA 4UREA 1JLLA 2BT4A 1QYVA 1CC1S 3PNOA 3QWIA 4YXWD 2FJUA 5FTWA 2UUAB 3O0DA 2I3BA 4O4HA 3VSDA 1AKEA 2BTEA 2VPIA 1ZK0A 3GLGE 3INYA 4AB1A 1NC3A 4KWEA 2DXIA 1WB4A 3TVTA 4TYNA 1P5JA 2GRJA 2C2KA 3IO3A 1I4DD 2ONKA 2EHDA 1T35A 3NDRA 1OYOA 4B34A 3PLRA 4M8KA 2I6QA 1FU4A 1KFKB 1L2TA 1SBQA 2AF3C 2WSYB 5EFOA 5IMSA 3KOOA 4CMGA 3TQFA 1M8PA 4QT0A 3M3DA 3WICA 1ODLA 2V58A 4D8XA 4XIJA 4C22A 5AVWA 2VHCA 3AL0C 3V5NA 3E58A 4FSHA 4LF8B 3T34A 2YRFA 1K68A 2WTXA 1Y9AA 4KOAA 3FSRA 3F3YA 3ZTTA 2XVZA 2JFFA 5ALHA 3P20A 4OB6A 4AJ2A 4CM9A 4HLQB 1B3RA 4XRGA 3W7VA 4WSOA 4I55B 2A9PA 1WPGA 2NU8B 2R62A 4XUGB 1PZEA 3IQHX 2WD8A 4MWBA 4PLPA 4B40A 3MUEA 4GI2A 1ESNA 4Z0PA 5ALQA 2X8LA 4II7A 4PSKA 4WKOA 2GCOB 5TF4A 1SBTA 1T5HX 1I3LA 3CW9A 4MKXA 4EZEA 2VQ6A 3COYA 2JAOA 1F2DA 2J8ZA 2P78A 1TM7E 1EE2A 3AOEC 4KQFA 4MW4A 2LV8A 4NOKA 4WNAB 3AU9A 5U4QA 3W77A 1MAVA 4D80A 4QGHA 5EHIA 5KMGB 3A1UA 1E3WA 4LV5B 3IBTA 3O3CA 4GPZA 1C7IA 2X22A 3FZNA 4PPYA 1PQUA 1X70A 1SVLA 5BO5A 4DUPA 4FGUA 4YQFA 3AUUA 1CJVC 3D6UA 3DDSA 4K1LA 2ZULA 3MOIA 4GQAA 4DN6A 2GK7A 1I6MA 4LECA 1XZFA 1F2UB 2XKAA 5FWYA 2I2BA 4R54A 1DPFA 1FRFS 1YMUA 1ZZGA 1CQIA 5HA5A 1F7VA 2DR0A 4KACA 3C8MA 1GDTA 3NU1A 4IWNA 4FZRA 2QXUA 3U0VA 5H59A 4WECA 3UK0A 1PQYA 1M2OA 3HN7A 4CEJB 2FWAA 2QN9A 4G0YA 1H9CA 4UAVA 2PRYA 1WX1A 3GI1A 4B3IA 1FFAA 2HQOA 1EK0A 2ALJA 1QOQB 4CMBA 1THMA 2FWNA 1SXJE 3T94A 5IJ9B 3DJFA 4H1WA 1I4TD 3U3DA 5J43A 4V0LA 2O7QA 4Z4GA 4MGZR 4OM8A 1PUIA 3GH3A 1JDNA 1P2GA 3EF1A 4X1YA 2AKEA 2ZWAA 1L0BA 1VKHA 2OAQ1 2RK4A 4MB6A 4NDZA 5IK2D 1HDXA 2OXIA 1Z6GA 3JQDA 3VU3A 4JB8A 3OFSA 5HHTA 1JB1A 2VDWB 4TYWA 4MWSA 3ZGVA 1EE9A 5JJIA 4MUAA 4C9BA 1HE5A 3OIDA 2PX3A 4F4HA 3DZ8A 2I7VA 3EY4A 4WCDA 1SQ0A 1IN7A 1XZPA 3KT8A 4V0MA 3QX3A 1ONPA 1QCCA 1PV1A 1SQGA 4R84A 1G20A 4PHTA 1NNEA 2MYPA 2QU8A 3BMOB 1GN8A 2O2CA 1JQJC 3HDHA 3LLCA 1P6QA 2OZEA 3DUFB 3PP8A 3WL5A 1Y1LA 2O3UA 3ZWVA 2KJQA 4BN0A 1M2VA 4G4JA 1Z0DA 5AM0A 3WP0A 4GDMA 1H1TA 4RK0A 1HNNA 4ZVVA 3TUIC 2VXOA 3OLZA 1NN5A 1I2DA 3T06B 1DLIA 1BDBA 1IHPA 3KSRA 2NP7A 3PDUA 3RS4A 3GEMA 3DZKA 1HT2E 2QNBA 4FC6A 2GEKA 4NDNE 2ZUFA 1ZINA 3BFJA 1SA0A 3PSAA 4GOND 3TQCA 1W0KD 3HVRA 1ID1A 1MC5A 4Q6WA 1U04A 1OXTA 4LOLA 3AI7A 4UULA 3QBJA 1R64A 3E2IA 4X54A 3SIXA 4NXNB 1D4ZA 3PCTA 1PGQA 2IBSA 1WR8A 2RB5A 4PZDA 3SP1A 3PNPA 2IITA 3VV2A 1FX0B 4NE2A 3NH6A 1I3OA 4M87A 3U31A 3OH8A 4RORA 3GUVA 5TGDA 4XJVA 2YJTD 4HFNA 4QATA 1JG3A 5B58T 4JI6B 1I7DA 4K3VA 5DM0A 4Y7DA 4OK5A 2IPNA 2QG4A 4MW1A 3ZIDA 4BMZA 5F1OA 5JDCA 3LNCA 2D2EA 4HYYA 2DECA 5JAMA 1ZUNB 3GUCA 3PFNA 3REOA 1OROA 1VMIA 1J1IA 3S0JA 1V7ZA 3LZDA 3R24A 4F3YA 1WUTA 3VM6A 1Z4MA 4X3PA 2NO7A 1FLNA 4KYIB 1MJ5A 4LE0A 1IWOA 4EHFA 4K46A 2WHXA 4BUCA 2JFBA 3GLFA 1VIDA 2YDYA 3GT4A 1BVYF 2CBGA 2OSVA 2VNKA 3EH1A 2PWBA 5BYJA 1IN4A 4MA5A 4ZEMA 5CG2A 2GUGA 2QTBA 3LRXA 3JVVA 1TCCA 1KS9A 1L1RA 5LZ7A 5ALZA 1L7NA 1Z6YA 2IDZA 3B82A 3CLHA 3MT8A 2I55A 1UBTS 5CH5A 1AIPA 3A58B 4LYYA 1ENPA 3VVLA 3GRZA 4CQNA 1KZGB 4JVSB 3PL5A 1PJ8A 3UANA 2CKDA 3W5BA 1Q21A 4F3KA 1T2VA 2BSAA 2HSEA 1THZA 3FOBA 1IHUA 4Z2YA 1Q74A 5JJLA 4B5KA 4CETA 4N40A 4MMXB 2V5AA 4IILA 3N86A 1I5RA 2RD2A 4AI6A 1BW9A 4PO9A 1GUYA 2CSUA 1XU7A 1CUZA 2GCIA 4WXHA 4ZXFA 3GPLA 2V7QD 1AZTA 4ITRC 3NEJA 2ZSAA 1DTSA 3NNNA 3QUAA 4DBVO 5I8PA 1U3UA 2CWDA 3TG8A 1G5QA 3R75A 1ZEMA 1I1OA 2YVAA 1XGKA 2O7NA 3MG9A 4MUGA 3DA8A 2XXAA 1DTWA 5LNK6 3KV1A 4BY9E 5H7XA 3BGDA 2G76A 1PG2A 4A1OA 4BGUA 5JATA 1MJFA 2Q21A 3M9LA 3IDZA 2AJTA 3EGIA 5MN4A 1CR1A 1LW7A 3GJYA 4EMTA 2C2ZA 2CNBA 4EB6B 1U7DA 3MQ2A 5KTSA 2ZBGA 5HE9A 1D1SA 5A3SA 4DKJA 1U9IA 3EGEA 3F8SA 3P97A 2FVXA 4JBIA 4LI0A 5CGZA 3FTPA 1CVRA 1LBTA 2VJKA 1ZC3A 4XSHA 1E1NA 3HVKA 2PH1A 3QK7A 1M67A 1YRHA 4I1OA 1P1IA 1BMQA 2ZRHA 3HFJA 1G41A 4YECA 3HJBA 2QBYB 4JUCA 3MHTA 1JNYA 3SEQA 3KRTA 1W8IA 1LJLA 2E85A 4YCBA 3DVAA 3Q3GE 2FU5C 2I2DA 4PCAA 3ESDA 3GZNB 1FP4A 4UHFA 3G68A 5DKFA 2YFYA 4CT5A 2CHGA 4MAAA 2GXQA 1P62B 1Q12A 3KZNA 4HDNB 1CDDA 4WL0A 2VF5X 4BB5A 1QFMA 4GBJA 5LXTB 1FXWF 3OURA 3PBKA 3WB2A 1QGAA 2ZTSA 3QVLA 2IKQA 3UC5A 1G2IA 3CZPA 2UYGA 3G7SA 4A9AA 4EVSA 3AKDA 2YYZA 4QJIA 3OPYA 5SICE 3EGDB 3WHKA 3G6WA 5A9SA 3GLGA 1RYMA 8OHMA 2HM7A 3F7TA 4A36A 3EEBA 3INNA 1DBQA 2YZ2A 5FAKA 4F4JA 4HAZA 1EP9A 4IIHA 2WW8A 2ZYUX 1G38A 1YBAA 2JRCA 4FX5A 4ROTA 3TTYA 5L3SA 3JAKA 4QOIA 2HRRA 4Y2PA 5D1NA 2W22A 2ZBPA 5LL6P 2UXCB 4KL8S 3ZWYA 3FCYA 3RF6A 4UXHA 5JSZA 1B6TA 1PDOA 1FSGA 4C0LA 3S8EA 3WL3A 3RC1A 1RLTA 4X60A 2ODAA 3OZSA 1CRWG 1DBSA 2BBTA 1N7IA 4I1YA 4V2IA 4ZREA 4ALIA 4YS6A 3B20A 2QRVA 1T2CA 1WY7A 4B43A 3L0OA 3DFFA 4PZLA 2UZAA 1M1YB 2W6ID 1KDTA 3EXHB 1CFZA 3G9XA 3WFIA 2B8WA 2BSXA 4J1TA 1KYWA 3GVIA 4MPPA 4ZDJA 1R3DA 2N75A 4PM4A 1MABB 3TKYA 4C3VA 2DQZA 2RGNA 4CMIA 4G2NA 4CQJA 3U3MA 4JT9A 1P6UA 5ECWA 1EVJA 1W5AA 4U2KA 4E70A 3HWRA 1NSTA 1OC2A 4FGSA 2B2NA 5EZ5A 4B85A 2RCYA 1LX7A 2BLLA 3PJDA 3SE7A 3R6TA 1CSEE 1QS0B 5DOVA 4MVJE 2PY6A 3EHDA 3CX3A 4RLQA 1YA8A 1D6SA 3ZZUA 4FYPA 5TPWA 2GF9A 4G9EA 4WE3A 5AJZA 4AULA 4KQMA 3EA5A 1PLLA 2ZAGA 1LPPA 3GJTA 2AQ8A 4K2AA 4MV0A 1GZ4A 5C1OA 2XUOA 1N0IA 2A59A 4RAQA 2DKFA 4PIVA 2QUAA 3ELDA 2COEA 2YY5A 3QVVA 5KNBA 2YWXA 3H1FA 3NOQA 4UM7A 2QI9C 3VZSA 1BQ4A 4NVRA 2QVXX 1SXJA 3B12A 4J0CA 4YT2A 1H2BA 4MS1B 4BO5A 2VHWA 2GN1A 1K08A 2H65A 3X1XA 5L7TA 3EVCA 5EZYB 5HS6A 1K6MA 1X80A 2EQBA 2VPZA 3JAWA 1FFHA 3NGXA 4BMOB 4DYHA 5KTMA 1U5BB 4ESOA 3MLEA 4DLNA 2O8BB 1HH4A 4PNEA 3DOOA 2EW2A 3PC6A 3QX8A 4O4IB 1G3IA 1GNQA 3AR4A 3MFQA 4LQLA 1Q11A 4M7OA 4MICA 4V39A 5LCXA 2IUYA 5CURA 3BQNB 1CWUA 1ZLXA 3OJFA 1OY1A 1QLJA 1LPOA 4IIJA 2FQYA 3ZWDA 4H6PA 3I2HA 2ID7A 3C1AA 3N2GA 3ZCRA 1ZGHA 4GMFA 2KWIA 4FW8A 4R40A 4ONEA 3V8VA 2A9RA 3TX6A 5E38A 2PX8A 3WK5A 3WZ2A 3NHFA 4K9LA 5AJTA 5EOVA 2GN2A 3GEHA 2Q3MA 5J5VA 4KH0A 3IQDB 5CNJA 1P91A 3NDIA 3MVEA 3U4QA 1U0OC 3K4PA 4GO1A 4UD2A 4UKDA 4EGQA 5B12A 3Q8KA 1IZ8A 3CTPA 1Z4KA 1P0FA 2C3YA 4RY8A 6CHYA 1NUAA 2AHRA 1D2EA 3P94A 3L79A 2FB9A 2GZHA 1BDIA 4EY7A 4DWOA 1GU1A 3C3EA 2CHQA 1PD1A 1IM2A 3A06A 3LECA 3N58A 2AR7A 3KKLA 5KQGA 3DVSX 4OX9Y 3CHYA 3DWGA 1TYAE 5ENZA 3OF2A 3R7WA 3D8HA 1REQA 1YRQA 1PR2A 4Y67A 1F2TA 4BLOA 4D98A 4UU0A 1CX9B 1QORA 1C3EA 1TZKA 3BTOA 3IBCA 1JQDA 1K4MA 2HNBA 4U7GA 4DY6A 3CNLA 4EAQA 1BWSA 2IW1A 1IXRC 5DYNA 3PI7A 1IBLB 1Y6ZA 1E1RA 2HV9A 3F7OA 4LYAA 1DDOA 2W43A 2ZM5A 1L8LA 2DH6A 4HB0A 5K0NA 3ZY6A 3VKVA 5DM70 3ISVA 3OQNA 2RJ3A 4M9RA 1EM8B 4DSNA 3UMYA 4ROSA 4ZJYA 1N36B 3TTUA 1UWVA 2ZLBA 2ZJYA 1AGPA 4DDUA 1FMCA 4FN4A 1V8DA 4M9ZA 2HF2A 3DEAA 4J03A 1N33B 3AY7A 3TG2A 4P4SA 5T64A 5HQ3B 2JD0A 3RLIA 3NHSA 5L8VA 1ZNWA 2K4MA 3IV7A 5J2TF 5FQNA 1CY1A 1W5SA 2P75A 2XE8A 3RVDA 2DWCA 2D2VA 3ZDRA 2BRUA 4FHGA 2Y8EA 2D4AA 2OZVA 3S28A 1AKYA 2FPUA 3INGA 1QG0A 1B6RA 2WU8A 2IF2A 5DHPA 2ZBEA 3RTCA 3GVXA 2JHAA 2ZANA 4QPJC 3EC1A 3W8EA 4BKUA 2ORYA 3OZUA 3STUA 5DX8A 1DJOA 5BNIA 2BKUA 2ZPTX 4BU0A 4QYMA 1XZIA 2ILTA 2ATEA 3CY6A 1QRDA 1XSEA 2C59A 2FE4A 1TADA 2JAPA 3C3WA 2HT1A 1FVFA 3IUJA 1I2CA 2IYOA 3UUGA 2KE5A 4RV5A 4WBNB 1YBMA 1RM5A 3K94A 3EIWA 1NOIA 4H7JA 2BTQB 2CUTA 3A05A 3E2MA 5JR3A 3LFUA 5JWRA 2H07A 4R2JA 4HDRA 4GR4A 3R0QA 5TT1A 1N2GA 4GVPA 4RD1A 1PNVA 2ZTLA 4W1RA 3VO9A 1TYDE 1Y5IA 1FSZA 3ROQA 5KOIA 1PBNA 1GPKA 2ETVA 2P90A 4AN1A 1G66A 1OXVA 1LZKA 2WYVA 2O2HA 3KPJA 3FB4A 1G7RA 3IAM1 2O2ZA 3PXXA 2VK1A 4MR8B 5AKEA 2WZQA 3PQ7A 2DHCA 3T3DA 3K53A 5CNKA 4DG5A 4DT1A 1ISMA 4PONA 4L73A 2G4CA 2W0MA 4PF1A 1C9NA 4C6TB 2WABA 5JD4A 2H59A 4KW7A 1E2IA 2EBWA 3ZWCA 1YS9A 4Q05A 1W9MA 1NDHA 6LDHA 4XYGA 2F17A 1GNVA 4EZIA 4I1UA 2ECQA 5CFOA 1N0WA 3DTVB 3W3AA 4U7TB 5KQSA 4IGKA 1L7DA 3FSEA 3R4VA 2BH2A 3DAGA 3JATA 1OQAA 4KMOA 1XRPA 4BDSA 2JGKA 5ITZA 1U1FA 4MW5A 1KKMA 4UUAA 3T5DA 1OI7A 2TMYA 1FC0A 1KK3A 3C0KA 1I3CA 3IQWA 4Y2JA 4CCWA 1A8QA 5KJCA 3GJ4A 2C2BA 2G72A 2LGJA 3ZX5A 1VCOA 1E3DA 3ZW8A 5EMHA 2BUCA 4NULA 1X39A 1WQ3A 1Y8AA 1ZVMA 4UUMA 1OSNA 1S8OA 5EQJB 3O0TA 3GRRA 1TM2A 1YZUA 2A86A 4ZQCB 5KCMA 5CRIA 4BP3A 5K0ZA 3MTQA 2QW0X 3ZDCA 2ONZA 2FRXA 4AROA 3S40A 4EZBA 5AW2A 2WKRA 1VL6A 5CVUA 4X1KB 4GOKA 5AK5A 5EIWA 3FR8A 4D8UA 3EVFA 3UMGA 1ZBQA 1W0JA 3I9V1 2J5BA 1GLNA 2B34A 4IBOA 3SZUA 2GCGA 1DINA 3HVUA 3OU6A 4YCNA 3K9NA 1LDBA 3I34X 3QPWA 3S2IA 4UVIA 1QVZA 3LX5A 1MFPA 3RC2A 4B3TB 1TT5A 3F5FA 3ASYA 2JB9A 4M9QA 4TKVA 3RS0A 4IVNA 5C8ZA 3WV5A 4BFYA 4JBWA 4P4NA 2FPGA 3QFTA 1ZWLA 2P5UA 2CF5A 3JALA 3GLQA 4MYSA 4BMSA 1L7BA 3OEEA 3V8PA 2CZQA 3PD7A 4A0GA 3W5SA 3A4NA 1CIVA 3H4IA 4TLCA 1XVLA 1IG3A 4UFPA 1KH1A 4FE4A 4L8FA 4LX0A 2OC4A 3OTWA 4BWFB 1DIBA 5B64A 2SKEA 1N3YA 5GONB 4FIDA 4PPGA 3V1NA 4BAZA 3KQTA 3R3YA 4AKEA 1SD5A 2VDPB 4MVJA 1JPJA 4KLZA 1NBAA 4UVEA 1JDUA 1GXSA 2EVWX 4W5QA 3GNLA 1K7SN 1LQ2A 5F2EA 2EDCA 4MGHA 5M5BA 4ZZ2A 3SR4A 1EH5A 5L51A 5EJ6A 3QF4B 4X41A 4ABYA 3L1JA 4K6OA 3FIUA 2QVLA 5BMVB 2A0YA 5IKOA 3Q3EA 2OPHA 3R5XA 4QNRA 5E9WA 1X1AA 2WSSA 3MJRA 2HLHA 4ALLA 1VJTA 2HNAA 5DBGA 5EAIA 3DBOB 4EITA 1XT6A 2FOLA 4LVNA 2CE2X 4MKRA 4E4YA 2B4TO 1Y3FE 2QMZA 1EFKA 2IEBA 1RYFA 1UT5A 1Z0UA 4DMFA 3OKAA 2FXIA 1IPEA 3ZNPA 2ODPA 2X77A 4KBYA 3FLMA 1H2RS 4JYCA 5TX7A 2NLOA 3W3ZB 1E9BA 1VPWA 1ST2A 3Q6IA 5CGQB 3CLVA 1NJFA 1Y9JA 2RH8A 3BWMA 3K5IA 4EKYA 7AT1A 3UOWA 3GLHA 1AUQA 1NVFA 2VLIA 5AJVB 5MN6A 4C04A 1E66A 4R2HA 5MN5A 4JP2A 1P2UA 2HHAA 3ILXA 3NV7A 4L95C 5CU7A 1QTQA 4C7KA 1E4EB 4DXDA 2DFLA 1ESEA 3O3MB 4R3UC 3G5LA 2GBGA 3W2IA 3KKZA 1CR0A 2GCEA 2V7BA 4QTUB 3TCXB 4M0EA 4WN9B 3MB8A 1J6UA 3AY0A 1KZ1A 5FT9A 2F4VB 4KUEA 2OCGA 3C74A 5LOVF 4ZCQA 4OD0A 5FTKA 1SVNA 3K09C 3OCZA 1E6UA 2NTNA 4KQ9A 1NNLA 4EENA 1V26A 3N0RA 2QQEA 1I0IA 3D6JA 3EARA 4R8VA 4CU2A 3NLLA 5I4BA 2GH1A 4UNRA 3WRYC 1Z2EA 1F48A 2W4QA 1YR9A 4LDJA 4ON9A 1H0SA 1JXOA 3OJWA 5KNCA 2TMDA 1XU9A 3PNMA 3Q7PA 3C8ZA 3MAJA 1CRPA 2Z58A 5ARBA 2DQSA 4MCAA 3UJDA 4INPA 5JALA 2WOOA 1E9DA 3BJEA 2QTRA 4MYRA 5HX7A 1GZVA 3TLAA 2QZJA 2NIPA 3L18A 4LKRA 5T67A 3O2NA 1J1UA 2PKYX 3MERA 1KF0A 3KQWA 4RKYA 4WA7A 4YAJA 1XB2A 2BMDA 4EG7A 1UBRS 3A4IA 1CY6A 2AUTA 3LQQA 4MGEA 5CLIA 4AJIA 2H8KA 4EUEA 3QWBA 3FPCA 3HKBB 4BV3A 1P81A 2ADOA 1CK4A 2QYOA 4BQSA 4JLAA 1T8YA 1T15A 1XMOB 2XYGA 1DQSA 2FMUA 2GO1A 1OXUA 2ZJ1A 1J9ZA 5BPHA 3OM8A 2PFGA 1ZJYA 3ENZA 3JQFA 4UE2A 3T4UA 2PS9A 4CN8A 4BBJA 5I45A 4CBVA 4N7JA 5GINE 1G63A 1AQIA 1QOPB 2FFHA 1Y8RA 3FDZA 2FPXA 3KPWA 1AZSC 3L6CA 2VPYA 4V02A 1I7PA 3MYRA 3UMRA 3CVVA 4MLCA 3KS9A 4B4WA 1XDZA 2QM3A 2C0PA 2CXNA 2GESA 3JR3A 3UKJA 2XT0A 4LDAA 1NJGA 2Q1XA 3GA7A 4WVLA 2DR2A 1GWNA 3UFBA 5MF6A 3EXHC 4J9VA 4RXTA 3DKKA 3Q88A 3OJEA 4Y2GA 3C3JA 3DFUA 4PSAA 4N47A 5TJ9A 5KSOA 3DVQX 5AJWA 1CY0A 5KJEA 3B2QA 5ELXA 1WZCA 3H42B 3PD1A 4C0AC 4TKUA 4WMLA 3MWEB 2I6SA 4TV8B 2PUWA 3M2TA 4DR2B 1KFCB 1BX0A 3DLHA 1L3CA 4JQZA 5B6PA 2NZ2A 1QFSA 3HJHA 4M1EA 4AWBA 2AZMA 1CNMA 2P91A 2HXSA 2EG5A 3HB9A 4C3ZA 2NUAA 4GLJA 3ICWA 2I7DA 5LA6F 2P3QA 3GIWA 4KE8A 1L3IA 4XJSA 3W6NA 4BTVA 2ZSBA 1KI9A 4QL3A 3KWFA 3AG6A 1S9DA 4HNGA 4DNXA 4BXOA 1D5WA 1A4IA 3JQ7B 3PKZA 4YGXB 3VR5A 5D3ZA 1VZ3A 1C1XA 2VXCA 4PQYA 4ICIA 1WEKA 4HUQA 4AP6A 1CB7A 2V6FA 3DDOA 4CM6A 3CTMA 4HH3C 3TO5A 2GD1O 5FR1A 3WGVA 5J2TA 3STYA 3PXEA 1QHGA 3RQSA 2RGCA 3LL7A 4TL7A 3FPBA 1JEJA 4D4IA 3P2IA 5K6TA 4F06A 4QO8A 1G3QA 1RPAA 1Q7TA 3SI7A 5A3RA 2JLZA 4AS1A 3EMVA 1TMKA 1I1NA 2ZAYA 1AA9A 2YJNA 3GT0A 1EFPB 4M7PA 2WIDA 2V3VA 1ODCA 1WXDA 1HI9A 4GLFA 2I87A 3AMVA 4K9NA 5H16A 1YFKA 1U7PA 2XMBA 4HRYA 4FDUA 3WOVA 1ORTA 4CIDA 5GVSA 2GF0A 4HGQA 3CWCA 5CG1A 1V7PC 3FTCA 4PLYA 4GZLA 4CLOA 3NTRA 3EJWA 3FYUB 1PGOA 4J91A 2RKWA 1R8YA 5JNLA 1ZNYA 1XRSB 1T2EA 3BXZA 3D2CA 1D3AA 1CUYA 1RKUA 1OAOA 3D0KA 5HXAA 1LRLA 4B4KA 3JXEA 1QAOA 1NXOA 1R0SA 3WIOA 2XWSA 5LN1A 3LPNA 2VZ0A 2VAMA 1Z5OA 4YBRA 2IVFA 5CPFA 4H31A 2G40A 4BIMA 4J0DA 1MP0A 1R4MB 2FRDC 4FYKA 1ZFNA 3CUKA 4HX2A 4QQRA 3GBPA 1DRJA 2W93A 4RACA 5CXUA 3L0BA 1WUYA 3EA4A 2HO5A 3B52X 4CMHA 5C8YB 4UHJA 4EIWA 3NAQA 1CJKC 3OU2A 3H11A 4U8HA 3NIBA 2QT1A 3W4IA 5H9VA 1JHAA 2OFOA 3G02A 1P80A 2A14A 2WF8A 4L9RA 4BE4A 1OH6A 3NP9A 3ST7A 4AN0A 2OD2A 3I2FA 3TGLA 1L7QA 1CDEA 3CCFA 3RTDA 5FUQA 5U1PA 3NDBB 2IQIA 1M76A 4PPFA 2D8AA 5DHRA 3BSFA 4NCIA 3PEYA 4FW9A 4M1QA 4CKCB 1NURA 2C2XA 4LYJA 5F12A 2W98A 2O0KA 2H1HA 2P8JA 4J07A 5BOVA 3W06A 1WXWA 1X92A 3B6KA 1XA4A 4TYMA 3FCAA 3R0VA 3NHMA 4FP9A 1YVDA 3HHPA 3RVRA 5CFPA 4KGDA 1BSVA 3HU5A 1RXSA 3MBKA 3FHOA 2C5HA 4G85A 4MB0A 1N6RA