3CO0S

Substrate complex of fluoride-sensitive engineered subtilisin subt_bacam
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
VSYGVAQIKAPALHSQGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQASWIINGIEWAIANNMDVINMSLGSPSGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTLPGGKYGALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Subtilisin BPN'
publication title Structure of a switchable subtilisin complexed with a substrate and with the activator azide.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 89
structure length 263
sequence length 263
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3co0S00
1NLUA 5AVKA 1GNVA 3DE2X 2P4EA 5FBZA 3AJ9A 3LXUX 1TO2E 1PJ8A 2ID4A 3CO0S 1YU6A 1SBIA 2QTWB 2W2OA 1C9NA 2WV7A 3Q5GA 3T41A 1SVNA 1KDYA 1TM3E 1KE2A 1AH2A 3BPSA 2X8JB 3DVRX 1EA7A 3GCXA 3HJRA 3D43A 4I0WB 1T1IA 2ST1A 1Q5PA 1P7VA 2X8JA 2Z30A 4MZDA 4KG7A 1TO1E 3EE6A 2DP4E 2DQKA 5FAXA 4C3VA 1DUIA 3I30X 3VV2A 3CNQS 1MEEA 2ZRQA 4KPGA 2PMWB 5SICE 1Y3BE 1SBCA 1BH6A 2Z2YA 1Y48E 5JXGA 1SCNE 3DDZX 1HT3A 4FONA 1SUBA 1WVMA 2PQ2A 1SCJA 1V6CA 3ZXXA 1ZVJA 1Y9ZA 5JXJA 1LW6E 4ZOQI 1SH7A 4OMCA 1BE6A 1AU9A 3F7MA 3WIVA 3VHQA 3DWEX 4RYDA 1C3LA 3Q40A 1SIOA 1R64A 4NE9A 1TM5E 4M1ZA 3AFGA 1C9JA 4LVNA 3EIFA 1GTJ1 5K7SA 1SN7A 4DWWA 1CNMA 3UNXA 2WWTA 5JXHA 5B1DA 2W2QA 1SUAA 1WSDA 4JP8A 2Z2ZA 3GCWA 3DE7X 1TK2A 2PWBA 1TMGE 3LPCA 4K8RB 4HVLA 1T1GA 1PEKE 4J94A 2IY9A 1S2NA 2Z57A 5I9SA 1AV7A 4DZTA 4NE7A 2PKCA 2G4VA 2PYZA 1A2QA 3DE1X 1SUDA 1Y33E 1SUCA 1TECE 4C3UA 3DE0X 1AF4A 1VSBA 1BFKA 3SQOA 2SICE 3VSBA 4NMXB 3I2YX 4YN3A 1TM4E 1CSEE 3GT4A 2V8BA 3VTAA 3ZXYA 4OV6B 1SBTA 3DVQX 1BE8A 1P8JA 1IC6A 3WIUA 1Y3FE 2ZWOA 3TI7A 1Y4AE 1KDZA 1XF1A 3LPDA 1Y4DE 1SIUA 3WHIA 3DE3X 1T1EA 1WMEA 1NDQA 2B6NA 1TM1E 4CFZA 2XTJA 1BFUA 2ZWPA 3TI9A 3I37X 1AQNA 1DBIA 4H6XA 1IAVA 1Y34E 4Z2AA 3BGOS 4H6WA 5ARCA 4DJ5X 1YJCA 3PTLA 1SBNE 5ARDA 5B1EA 1R0RE 1PTKA 3BX1A 3GT3A 4BWGA 2W2PA 4WOBA 1PFGA 4CFYA 2IXTA 1GA4A 1Y3CE 3DVSX 4LVOA 2PWAA 4AKSA 1GTL1 3P5BA 2PRKA 1SBHA 1SUEA 1R6VA 3WQBA 2W2MA 1THMA 1KDVA 4AKTA 1OT5A 1ZVKA 1Y1KE 1GA1A 1SPBS 5AVJA 5AMXA 1P7WA 4ZARA 1ST3A 3DYBA 3F49S 2Z56A 1GNSA 2SNIE 2HD4A 2HPZA 2Z2XA 2GKOA 5ARBA 3DW3X 4H6VA 1YJAA 4OMDA 2TECE 3DE5X 2SBTA 4WOCA 3A3PA 1SCBA 1ST2A 3VYVA 3D9QX 1GT91 5JXIA 2ID8A 2W2NA 1MPTA 3DW1X 5FFNA 2WUVA 1SIBE 1AVTA 5CW1A 2E1PA 1SELA 1Y3DE 3F7OA 1OYOA 1C9MA 3QMPA 1SCAA 1V5IA 1YJBA 3QFHA 5AQEA 2XRMA 3AJ8A 3I34X 1EGQA 2Z58A 1UBNA 2DUJA 1WMDA 1S01A 1NDUA 3VV3A 2SECE 4CG0A 3H42B 1KE1A 3EDYA 3DE6X 3QTLA 1TM7E 1S02A 1SCDA 3TECE 3OSZA 1AK9A 1BJRE 3LPAA 1JEAA 3DE4X 1GCIA 4GI3A 1WMFA 3A3NA 4B5LA 4KB5A 1GA6A 3PRKE 3L1KA 1SUPA 5JMOA 2WUWE 3A3OA 1GTG1 4HX2A 1OYVA 3SICE
chains in the Genus database with same CATH superfamily
3P97A 2X6RA 2FG6C 2QM3A 3OTHA 2IPXA 4KVGA 2Q1YA 2OD7A 1CF9A 4CMGA 2WTNA 1OA0A 1PR1A 1AO3A 1U1EA 4PLCA 2IV7A 3AJ9A 3A04A 1NN1A 3D6UA 4PSAA 2EQ5A 3DLTA 3TQSA 2VP5A 3P4XA 4EG6A 1CR2A 5KWJA 3IMEA 2OXCA 4MJ3A 2LCFA 2XVAA 3U7IA 5D3MA 1OV4A 4ALJA 1JSCA 3HSKA 2PA0A 4IZIA 5FPHA 1HE5A 3L06A 4C0QC 3QVVA 4D0NA 1PR9A 3BMNB 4Z86A 4E1BA 1AKTA 2JD0A 3OHMA 1US8B 3NEYA 2IE0A 2WKRA 3KR9A 1LNZA 1Z3IX 2FOIA 4WN9A 4DJJA 4EYKA 3H0EA 4J2HA 4O59O 1SWVA 1WXXA 3KYCB 4K6KA 3WV5A 3GEHA 2XOXA 2VEOA 1KDYA 1KE2A 1QYVA 1UFOA 3FPCA 4LDAA 1YRYE 1Z9BA 2WG2A 5F52A 3ZCTA 1MIHA 1BXGA 3ZDXB 5FBVB 3IP9A 5HUJA 3BK2A 3J81A 1YVPA 1IE3A 3ACBA 3CRRA 5DDIP 1E64A 4RY9A 3UGTA 2OAQ1 3DHVA 4YMGA 4AZ0B 4LFAB 2VPPA 5JAZA 3GLFB 2FWPA 4UUNA 4MQFA 2H31A 5CIYA 1NVAA 3KKNA 2CXTA 2R1VB 3SOZA 5IN4A 4CLDA 1RADA 3DBRB 4Y2TA 2VK2A 1AGNA 5DHRA 4ZQIA 4JSYA 4NU0A 3KOYA 4GVLA 2COEA 4XJSA 3SQLA 1QSGA 2CYAA 1V26A 2NXNA 4X85A 4LYJA 4UXHA 3STWA 1VM6A 3BWVA 1G64A 1W46A 1WPXA 4OEHA 1JFSA 4MCAA 1ANKA 2CJPA 4KU4A 2BCJQ 5CCEA 2BKVA 2AN9A 3FLEA 1RYMA 5K3AA 4LOAA 1KNXA 3G5LA 3WYEA 4XH9B 3NTOA 1W9HA 5CH5A 4XLTA 3DEJA 2WHXA 1U8TA 1N0VC 3I23A 3TFOA 2UYHA 1HSOA 1S3SA 3MLBA 1BDJA 3HSSA 3W9YA 5JUWA 3IT1A 2PMWB 4OCZA 4I08A 2ONJA 4MSUA 1XI2A 3FCYA 1E2HA 5I9TA 4GPBA 3ZY4A 3LPLA 1AMOA 4KZKA 3UPDA 3JQQA 3ZW8A 2CL7X 1AB6A 2H9YA 2H5LA 5JRDS 2IWHA 3OJWA 3Q12A 5B64A 4N3CA 3ZXXA 1RQLA 1OAAA 3IB3A 1S89A 2X8LA 2P9YA 3PIDA 3UUWA 2JFYA 1XVIA 5CA0A 1BWPA 2P9EA 3TSAA 4ZA2A 3G9XA 3RJ9A 4HLUA 4BNYA 3I2KA 3K9WA 1RFLA 3GRPA 4K9KA 5E2IA 4NCHA 2C9OA 4NCXA 1X92A 1BU8A 1LFAA 4KN9S 3WNQA 3G2MA 1PHRA 2IP4A 3B2QA 3K9CA 1MVNA 2EWMA 2OILA 3PC8C 3O8BA 2QRPA 1W5AA 4RVSA 4XFJA 5EIOA 1BN6A 4EB6B 3ZDZB 5HK9A 1CTQA 2J4FA 1WNFA 2RGNA 3FRJA 4Q3CA 1L4NA 2CDNA 2QXUA 4UVGA 4NESA 3MERA 1U7XA 3ABRB 3ICVA 4TRNA 2O8DA 3D7NA 1BGWA 3DV2A 3QBTA 4JZYA 2EZ4A 3DULA 3WYFA 2REQB 3QEMA 2PT9A 3CLUC 4JLOA 4UM9B 3AYZB 2AHOA 4R0NA 4K81B 1CVLA 5DN6D 2AFIB 2WP0A 4L57A 3BGSA 2A9JA 3IAS6 3MMZA 4FHDA 3G0CA 4YBRA 3VPGA 4RV9A 3GEGA 4TXMA 1RKVA 4W5JA 3CRW1 4ZXPA 1UZLA 2CSUA 1NBMA 2K2QB 2W2QA 1HQYE 3LUBA 3BFKA 3MT0A 4FDAA 3EZNA 3K8ZA 3LGSA 2H29A 3JYQA 4HADA 3ZGNA 1QG6A 3DFUA 1U99A 3EGVA 5LFAA 3HCOA 4FMCB 2BJHA 3I3OA 1QE3A 3V8QA 4F5EA 4Z2YA 1ZMXA 3ASUA 1RHQA 1LWNA 4BU1A 4BQNA 1DCKA 3FHOA 4MW9A 2H18A 4MWEA 1ULAA 4KXFB 1YNOA 1OQAA 3SYKA 2FOLA 3PXAA 3A6GA 1JG4A 4DM7A 3PD1A 2WVAA 3OAAD 1YZLA 3NRJA 2DR0A 4RSGA 2QORA 3LYLA 1NJ5A 1YQUA 3S7TA 4LXQA 1RKUA 2RONA 1CUYA 2WU1A 4E32A 2E4XA 5L7YA 3T38A 3D3WA 5IW8A 4WX2B 2NUPB 3K3PA 4BFCA 4ZYUA 3FTNA 1XF9A 1AZLA 4G4JA 2CLLB 2VJBA 4TKLA 2J8ZA 5DPMA 5ITSA 2D6FA 1NQAO 2KHZA 4XQ9A 5IUKC 4QLBA 3RNLA 4OBWA 3L7DA 2OYCA 2JFFA 4EJSB 1Y33E 2XXAB 3MF4A 2WU3A 3A1CA 2W6ID 5FULA 3DAOA 1Q1EA 4RY0A 5CM8B 1W5TA 3PFBA 1H2RS 2EJCA 4G0OA 4LMBA 5THKA 3RT9A 4JV5B 3CLTC 4FDUA 4AJIA 3DLIA 5KVVA 1XZBA 1ENZA 2IDJA 1X7XB 2GB4A 5JALA 4AJPA 3EXG1 3CG4A 4DREA 2LRHA 4MEJA 1C81A 2QUBA 3AUXA 4NAVA 4EUHA 1EK2A 2CEAA 2B2NA 2F62A 4K0RA 2FEMA 3CZ5A 4WCVA 4DA9A 3HXKA 5HRCA 4ZI7F 3RU9A 4HGNA 3DDHA 2I0FA 1XRSB 3KQMA 1XTKA 3HUUA 3OF3A 4JFRA 1TJ4A 2I4RA 1N6KA 3FYDA 3HKDA 2GYVA 2WC1A 2X13A 1B76A 4KV9A 1YVRA 2DBRA 3E0XA 4OAOA 5IK2A 3ZWMA 2GLXA 2AF3C 4FHGA 5K5EA 2GDZA 3R0QA 3GJ3A 1DXOA 3KKPA 1Y81A 2VBCA 5AK0A 3AT1A 5DFAA 1ABBA 4Z4FA 5AVYA 3IUYA 1DRKA 3CLVA 3PQ3A 4RXTA 2BDUA 3UMSA 4YNBA 1VOTA 2WTMA 1ISGA 4BEVA 2F43A 5A1JA 5KTPA 4MYSA 4INAA 3X0DA 3VR2D 3ZKWA 3ZDYB 2BHSA 3TO5A 4DLXA 2AFHA 3DXXA 3A9RA 2A86A 2Q1TA 2GBCA 3QBJA 4FFBA 3BRQA 3WO1A 3AG6A 4XSHA 1NQUA 3T7JA 3C3BA 1I4DD 1X1SA 1OLUA 3BD9A 3FA2A 3L4EA 4HZGA 3W0LB 3NVDA 2OCLA 4LOKA 5BNTA 1CDEA 1UBKS 4KFUA 4Q1VA 1V3QE 2FGJA 1NT4A 1KH2A 5FL7A 4DCOA 221PA 4ETMA 1XZLA 1V1MB 3PWZA 2OCGA 5IC6A 3TB6A 3VX3A 1HYQA 4HC4A 1UBTS 3Q3VA 2Q1SA 4NEHB 4YAEA 3BVPA 3EGDA 1N7HA 2IKSA 3PX3A 1NXSA 1NVXQ 2J5XA 4FZJA 2HHJA 1O94C 2R4TA 4CFSA 5A06A 2NVOA 4W8HA 4LY9A 4I55F 1QG0A 5ALMA 3I52A 1LGYA 1U65A 2C00A 4HEA6 4D0GA 2OORC 3PPWA 4BJ1A 4E5DA 3KPVA 5DULA 4RS4A 1OMOA 2WHYA 1GRCA 4D9GA 1W1WA 4XR4A 4AF6A 4DYHA 3TIGA 4EGSA 6REQB 4MP3A 4GM4A 3HKEB 2QYOA 2ATVA 4JT9A 1N2CB 3RRYA 3S1AB 2DU8A 4N0DA 2UZ4A 2IW1A 1GGEA 1ISIA 2FHPA 1L8LA 5ECDA 4EPTA 3G8YA 2IYYA 3GDGA 5CD1A 3OIVA 4PYJA 4I66A 5DT2A 3LBYA 5E1MA 2HFJA 1Z6ZA 2FUCA 4N3AA 5GGXA 2HTFA 3NHJA 4KLRA 3BXHA 2Q6LA 3GG2A 3RK0A 3ST7A 5JROA 3AO0B 4CIAA 1AD2A 2UYOA 1KXZA 3LIIA 4DDWA 1O6FA 1Q84A 2XAAA 2CCGA 4LBVA 3RVPA 4A0FA 3QFFA 1HLPA 2PWAA 1NF9A 4Z4EA 1EFPB 5KYXA 1GTL1 3DP9A 4P54A 4C2BA 4DJAA 1B23P 1DJMA 5KVSA 3DBLA 4BV3A 4EFLA 1KQNA 4EKYA 2V54A 1JSXA 5BOSB 2HGSA 1WZUA 2FFBA 1ZJZA 2OD2A 1Y1SA 4Q1BA 4ZXFA 2V55B 5LP6A 1QX3A 3RUEA 3VDXA 1A8IA 2PJRA 4LN1A 4EIWA 3HJAA 2PX6A 3ZJYA 3S55A 3O47A 4C76A 2WHRA 1SZCA 3Q9UA 4EPVA 3V4ZA 2ZTHA 1L7DA 4AKTA 1ZVKA 1I1HA 4NECA 1SPBS 4PC7A 3EPJA 3EG5A 1K98A 4ASUD 1EE9A 4CI9A 4R1LA 3LLVA 4NJMB 4D9JA 4IVQA 4TYQA 1P4GA 1L5WA 2C99A 5BV0A 4RDHA 2VPZA 2AK2A 3K20A 2BHNA 3CC8A 2BR3A 1SVKA 4N12A 1ISPA 3HADA 1TGVA 4EZBA 5BNFA 4G0ZA 2PWPA 1CZOA 4I2VA 4K6HA 1N0IA 1N7JA 4ICIA 3QYPA 5TPWB 1QU3A 4MVJP 2QP9X 2C9ZA 3HDYA 3KTOA 4PGAA 5J1TB 4W1RA 1VI5A 5EIBD 2R11A 1E5VA 4C0KA 3SDSA 1NW9B 2XNSA 3C7KA 3LOUA 1EUYA 1INLA 3KUKA 5HZHA 3I61A 5EMJA 3AU8A 2QXYA 4P7BA 1JE0A 1BOOA 3BD6A 4KQIA 3AL2A 1J22A 1JT2A 2A6PA 3KTFA 4UHDA 2Y0CA 4I4TF 2BF4A 3W1VA 4AT1A 4EVRA 5MFPA 2VF8A 4X97A 3D6JA 1PZHA 2JGKA 2QSYA 3A36A 4QVGA 4IIGA 2CHEA 3K70C 3UMBA 4BPBA 2Z5LA 3HUEA 1TIPA 2BFDA 3P45A 5A9TA 2NUTA 4F93B 4TTQA 1H4VB 3ZDEA 2E1PA 2BHRA 4UHFA 2B7CA 3VNVA 1E58A 3ER6A 4MV4A 1KI8A 3BAFA 3S1LA 5IAGA 3S8MA 2CNWD 1BE0A 4O2RA 1J0EA 2NPOA 1PQUA 4MLCA 1WVIA 5DBGA 1ZJYA 4OBBA 3WGLA 1UPTA 4MQEA 3TGWA 1FDWA 5BSGA 3ROEA 2VPXA 1J00A 5KU7A 4DA4A 2DH5A 2IDMA 1GKYA 1JEQB 3G8BA 4MWDA 4ZEMA 1U04A 4R9RA 1QGUB 1LK0A 4RA9A 2IBTA 1LDGA 5DHAA 5JMPA 4EWLA 3F5MA 2Z3WA 3BSFA 2XH8A 3ECSA 4Q3EA 4BNDA 4BB5A 4RFVA 2QD4A 1U90A 2X86A 3I6BA 4JP5A 4M99A 3NG1A 4R41A 3VH3A 5KPDA 5AXAA 4CQMA 3OIYA 4XIJA 4B6RA 1CK4A 3EUAA 3JZFA 4HO1X 5AJUA 3KOOA 3GFBA 3ANYB 2Q5CA 2VAWA 4U9IS 2HPAA 5HTKA 4CG0A 1DAFA 1NJ2A 3H42B 3VMFA 5KX5A 3OU7A 4KPUB 1VGVA 4JQOA 1BGVA 3JVVA 4J43A 3U4HA 1CP2A 4EJ2A 4EZIA 2R7NA 1DUSA 2I6TA 3AW8A 2NUBA 4C89A 1M5UA 2FXVA 2GWRA 4QU8A 2ZJZA 3V34A 4OMFG 5DM4A 3VTKA 5JNSA 4U9HS 2WJVA 2OL4A 4DCGA 5CFNA 5AW6A 5I45A 4UDYX 2I71A 1FYDA 3DNPA 2ZB8A 5JO0A 1FUYB 1SQ0A 2B1IA 2VJDA 4LHZA 5EWMB 5H59A 4DSOA 1AS0A 2PN1A 2P6UA 3DHNA 3NYQA 1XDWA 4U0JA 4A2QA 1DV2A 1GUBA 1RLIA 4PINA 5KTRA 5DGIA 3PK0A 1P1RA 3AXSA 4BFZA 1I36A 3DVLA 1OXXK 3DL7A 5BSTA 1QO9A 2QNIA 3PI7A 4E07A 4ZVLA 3IURA 4DZRA 4WBNB 1DL5A 2AJTA 2CSXA 1GN9A 2E55A 2P8JA 4R0VA 4PSCA 1V9CA 1K8YB 4KAXA 4RSHA 4EG7A 5LWQA 2QN6A 2V6JA 1TRHA 2CNNA 3UHPA 1UWKA 3B7GA 4CL2A 2AFVA 4LVCA 4V0NA 1G1MA 3AY3A 4KI7A 5B3KA 1Z5OA 5A9RA 1M0WA 4UUQA 2E4VA 3A31A 3L40A 3DF9A 4PZ0A 3R9XB 4RPCA 3ODGA 5JDCC 1Y9JA 4D0RA 3KOXA 3FWZA 4KWCA 1EFAA 2Q7OE 2IZ1A 3NH9A 3B1KA 4EOGA 1XKTA 4RJKA 3W05A 1C4XA 2IHZA 3FTDA 5JDIA 5DMXA 3V00A 4LCBA 4LZPA 2ENWA 1AHIA 2ZKLA 2K87A 3GDWA 3I42A 3QKUA 4L4ZA 4Y0NA 3SEAA 2VI5A 5JMOA 2NUAB 3IEPA 5BUZA 3AUAA 5EJ7A 2DUMA 2I4LA 3GLQA 3W3AD 1SXJA 2HRBA 2BFOA 3LY9A 4TL7A 3JR3A 2WIBA 4JUFA 4W9MC 3C6QA 4EKDA 1D2RA 3OQVA 4N7JA 3WWCA 2QYHA 2RJOA 3LOQA 3QKSB 4WZBE 3R3WA 2BFEB 5EWLB 3U0VA 3WJ2A 4KDEA 2CDRA 3D7MA 1NR1A 4OJTA 1N1MA 1T5LA 3UW3A 1E2GA 2JH3A 2SCUB 5IABA 3OZTA 4Y6RA 1UQUA 3MGCA 1NPDA 1XZQA 3ONDA 4QIHA 2FRDC 4KVFA 3GPDG 4K05A 4P3OA 4ARSA 2ZRKA 3O21A 3M3DA 3G9TA 4TKZA 2A9VA 1T5DX 2ZYVX 3IRVA 3N0TA 5CGQB 2YOHA 4OLBA 5TEWA 2M6RA 5AXCA 1IUKA 4MVJM 2AMFA 4NXMB 3X2SA 2R7AA 3BF7A 3W7AA 4KCGA 4CR7A 4QASA 3DKIA 2JFBA 1KIAA 1PW5A 2PMFA 5KTKA 2GN9A 2C1EA 4FDVA 2PUTA 4M89A 5BXYA 3CSSA 4JI7B 1V8OA 2IOQA 1H42A 3KUCA 2ID7A 3OZRA 3NPAA 4IFEA 4HQNA 4RF4A 2H3HA 1EVJA 2XB6A 5B55A 2D1YA 4ER5A 1F0KA 2YOGA 4L22A 2IIQA 3DLAA 4ZANA 3NVKI 1QLHA 3RJTA 3T41A 3AINA 2BOVA 3FF1A 4BTVA 1H3FA 1OLOA 1V8ZA 4GMDA 1W0KD 2WDZA 1XTZA 3DVRX 4QC2A 4LEIA 2XKKA 4XM1A 4GPD1 5CVJA 2I33A 2XT9A 3K0KA 1NFFA 3K71B 3IXMA 3O82A 4FFMA 3O93A 1XQ1A 3QYFA 3WGIA 2JIRA 4FQ8A 2OCKA 2D4HA 2GAAA 3KWJA 3ROKA 4WWHA 1LRJA 5BMVB 3W5VA 4GQBA 2I8CA 4NHEA 5BMOA 3RFTA 3OMXA 2G1PA 2HJVA 2DC1A 3C6MA 2GZ2A 1VPDA 2YH2A 4R71A 1YE8A 3N07A 4OGLA 1P0QA 3CF0A 4U7TB 3FHLA 3KT6A 4EGAA 2PFGA 2NSHA 2YY6A 4UE6A 4BO5A 4ROSA 4URUR 1CE8A 1RXUA 3IX7A 3TAHA 5AVQA 1U3GA 4JL5A 3HY6A 4QWWA 1UZAA 4DV0B 1CIVA 4Q4AA 1E7WA 1FW8A 2VO1A 1V8BA 1T3ZA 4GYJA 1I5OA 4C3VA 1DUIA 1QIFA 5T64A 5K20A 3V3KA 6ADHA 1ZEMA 1A4XA 4BVKA 4JI8B 2FZCA 3OWOA 3VPXA 4W5HA 4ZYLA 3F90A 3LM8A 4BZXA 1Z4KA 5E4TA 3QEKA 5JY1A 2W6CX 1GNRA 2WICA 3ISTA 4HGPA 1NY6A 2KWIA 2VJNA 2YTZA 4GLLA 1GPWB 2REBA 1LLFA 1YQXA 1X15A 4PBRA 3LDFA 1G3QA 2QR3A 2W4IA 3DZCA 4AECA 2HPVA 5JXGA 1DOZA 3RVDA 5I7HA 1ZUHA 2ETVA 3GD5A 3L3BA 4WBSA 2BGRA 4B1FA 4CXMA 4PYQA 1ZLXA 2MSDB 4DLYA 4I8XA 1KDRA 3H75A 1L5GB 2FPGA 2YRFA 5DCWA 4BVBA 1FCJA 2IYFA 3WB1A 3HV2A 3RV3A 3EXEA 4KIGA 1AF7A 1PYDA 1VLLA 4ZOBA 3ESYA 1U3UA 3RFVA 1EINA 3RU7A 1UJ6A 4GAEA 3ZDBA 3BRSA 2BMAA 2IEIA 3MJEA 5G2OA 1XD9A 4J0DA 3HU3A 1E1YA 1ZJ6A 1Q12A 4RD3A 3TMAA 3VHQA 3WGZA 4C7MA 2F8TA 3NV9A 2BRUA 3HFJA 1C3LA 1XYYA 2R6AA 4FC7A 4B47A 1VKRA 2GSWA 2IXFA 4AJOA 5AM3A 3FNFA 1HV8A 1VE7A 5EPUA 1PAUA 5C34B 4CJXA 1ONOA 4K40A 5JBIA 3UB3A 2L42A 4EHIA 2CBZA 3ESRA 1WABA 3B5JA 3F78A 4RD6A 2IHKA 5AW4A 1J1IA 5CTJA 3EZYA 2G17A 5GV8A 2IXAA 1H2WA 5AVWA 4UFOA 3NW9A 2A0FA 3K1TA 3V6LA 2B1GA 3KTAA 3JQFC 3C41J 3OE4A 2Y68A 2CV1A 4CR8A 4BVAA 3QJ5A 2DQSA 4I6EA 2AKYA 3VR5H 2JBAB 2QTLA 4BX9A 4DEYA 1AS2A 3RKRA 5JAUA 3N76A 2IOYA 2JGNA 2WTUA 2PD4A 1NZJA 2UVPB 3MS7A 5FUWA 3PD7A 3LBAA 3E22B 1W4RA 3G9UA 3KG2A 1ECBA 4S05A 1BS9A 4O1HA 1VJ0A 2XZDA 2YHIA 4C4TA 2IH2A 3IL2A 4JUBA 3ISJA 3PG5A 4O1MA 5LU8A 4X0EA 3BIFA 1CS4C 1XR3A 4A2WA 2ZWVA 2JAPA 2ZQ5A 4Y0AA 5CB4B 2DPGA 5LR6A 2QNRA 2ZROA 3PA8A 3C7DB 3HWWA 4AC9A 2XB8A 2JFGA 1CY7A 2NIPA 4Q47A 4A23A 4OX9Y 3SEQA 4OLJA 4DUGA 1DWPA 5I3CA 3CVUA 5LIRA 1H4TA 1FFBA 3DEYX 5LL6P 3EVFA 3C1AA 4ZK6A 1PEKE 3ZV6A 4HRAA 3CCCA 1JDBB 3C3YA 3DG9A 1QU2A 1FTNA 2JS7A 3HQ4O 4TV9B 5K8JB 4MVJG 3GU3A 1CQPA 4B6PA 1K7EB 2V96A 2V4MA 3NTLA 3VSDA 1L5FA 4DZTA 1T9DA 4NE7A 4I4LA 1ULHA 4I9HA 4B8WA 1EFTA 1IY0A 3N59A 4E22A 4LF5B 1WIWA 1JHRA 3W6UA 4ZQEA 1V43A 3JALB 3ND8A 4TGLA 3DYVA 5KYYA 4XUCA 3OQIA 3UWKA 2DLCX 2JGDA 2V6FA 4C3UA 3H97A 2M6SA 5JNWA 4YUYA 1TKBA 4RHYA 1GV0A 4U6SA 3TQOA 1JKMA 2Y93A 1G21A 1N8SA 1XVTA 5DRTA 4B75A 4DGSA 2VUSA 3Q15C 1YE3A 4BE4A 4MOWA 3SLRA 4M1SA 2Q49A 1D1QA 5JCPA 1LTKA 3RGGA 2FYTA 1QQAA 1ZH8A 3UB2A 1QVWA 1J25A 1TQ8A 1RKXA 1ZKMA 3LCUA 1E4EA 3DMTC 3QUBA 4ONEA 2ZM6B 1P81A 2QUIA 2PA3A 4V1CI 3E8SA 2CB0A 4RA6A 2DHDA 1YS7A 1T9GR 1FSZA 2VJMB 1NJ6A 2VRWA 4L2IA 3UXYA 2V7XA 1VB5A 4RETA 3C7AA 5AOBA 4FOLA 4JJ4A 4RDCA 5IBQA 1OBVA 3LD9A 1ZJJA 1E9FA 4ZCRA 4RKWA 4POOA 2H63A 4HT3B 3GMTA 3SE7A 2J33A 1FXUA 1J7JA 4FDTA 1KGDA 5K8TA 3ZHXA 2D2XA 1J09A 3H1AA 4Q7LA 1W19A 5AESA 4CM9A 2YFHA 2ZR8A 4Z1MD 1V37A 3RODA 2DCUA 4BQSA 4YPOA 4ECAA 1MC5A 5C5DA 1Y4AE 2RIRA 3GRYA 2RGBA 4MW0A 1KDZA 2HJHA 2ICAA 3IAS1 1JYFA 1ZQ9A 4TRMA 3OETA 3S5JA 5L7WA 5DLDA 1YB6A 4AG6A 1G4AE 1SHLA 3IPCA 4H1UA 4W1PA 1WPRA 3WK9A 5E95A 4HGZA 4NCAA 3IQDB 4G2TA 3FDFA 4H18A 2XPCA 4NBNA 3TGPA 2XTJA 5EIHA 5JQWA 3TI9A 3KSMA 4RCZA 3PL1A 1G8PA 1TTPB 3EWAA 4BZWA 2I7XA 4R2MA 4FUQA 2QG6A 3GY0A 2RHJA 3MMNA 4Y6LA 4W1QA 2A59A 4GGOA 1ZK3A 5SZJA 2PYDA 4LHXA 4MR9A 5CURA 4MO9A 4WEOA 1Z13A 3H9JA 4IXDA 3OCCA 5I47A 1G6OA 3LO8A 4II2A 4K88A 1DB3A 3PVZA 4H15A 4YV0A 4RGYA 2PDAA 3KR1A 1I4TD 2YWGA 4K6OA 4I81A 4S0XA 5KU1A 5CVCA 3BQMB 4R9SA 1I1NA 3IIEA 5KVQA 2XI4A 4TWRA 1NSYA 4IILA 5F9MA 5C3UA 3GUVA 1K89A 5AUQA 4AIIA 2EZ9A 3V8EA 1PZXA 2XWSA 3MTDA 1JBKA 2YIMA 2HIGA 2VXCA 3K1AB 3S99A 3Q8LA 2BZGA 2HSEA 2HDOA 1OC2A 3W6ZA 4WUTA 2GESA 5A7GA 1N9GB 3ZD9A 4AY3A 5HZKA 5CITA 5IMSA 3I4FA 2PMBA 4JENA 2NACA 3MJHA 4R01A 1D3AA 1B7GO 3EIQA 3OPXA 4AJ9A 2RGCA 3DO6A 3GGJA 5CP8A 2JFPA 2ZJAA 3LCMA 4L9RA 5EHGA 4G89A 1JPUA 4DYDA 3ZVNA 5TQ0B 1N32B 1X77A 3O6VA 2GJAA 4JGGA 1VP3A 1JKXA 1SOMA 1NQVA 1Y3CE 2J3QA 4J9VA 1T36B 4HN4B 1W1IA 5DOVA 1J99A 2IHNA 1GPAA 1T8RA 4XIFA 2WILA 3CLSD 3IMKA 4QO7A 1VPTA 1NU8A 2N1BA 2ZJ2A 4EGQA 3ZX5A 4YRDA 2WHQA 1EE2A 2CY0A 3IT2A 4IMPA 3X1XA 5B6PA 4BGIA 3RLFA 1KO8A 2IUEA 3NDBB 4J4HA 3BMQB 1M8PA 2YYYA 4MB0A 1OVMA 4S1PA 2XB2A 1ODKA 1HLGA 4XUEA 3ADKA 3EF3A 1Q7TA 3G59A 3KETA 4H7IA 2XNDD 1AXGA 2LPMA 5A3SA 1Z4OA 1Z82A 2D5BA 4LJ8A 4TMYA 2ZVPX 1VKHA 4X60A 5EJMA 5JAQA 4AURA 4MDHA 4EB0A 4LMRA 5HJEA 5HA5A 1EB8A 3N0RA 4RYLA 3TFWA 5CDTA 3EY9A 2R8OA 3AVPA 1LBTA 2W6ZA 3A4VA 3K0FA 4YASA 3S6JA 3DGEC 4HWSA 4QDOA 3TECE 1WY5A 2FXIA 2Y1DA 3F74A 3HCNA 4P3PA 4B4OA 2FX2A 1PF7E 2BMVA 2I4NA 4DBLC 2WWIA 5DX1A 2R0QC 2FFHA 2Q3LA 2RGWA 2EG9A 2NYUA 3NKFA 4XUDA 5JWHA 3TLXA 1SBZA 3I2GA 3PFWO 5MN5A 2LKDA 4DLNA 1WNTA 1I4EB 4YAKA 1H5QA 2C95A 3QTBA 3WLMA 5EUCA 4C3ZA 3QH4A 1YQ9A 3PXXA 2A3RA 5KKAA 4OP1A 4FN4A 3C6KA 3TDKA 4CQJA 3X3HA 1RQRA 4CIWA 5K45A 4I5DA 4L8YA 1VE3A 4JJZA 1YWGO 5HJ2A 4HEA1 1IOZA 4ZAGA 5CW1A 3HI4A 3TRJA 1O9BA 1FS6A 4CKZA 2VWHA 3RUCA 1SC3A 3BMOB 1DDOA 4I7EA 4MP8A 5L45A 1DAEA 2J7PD 2X0IA 2XTNA 2F1JA 3ZK9A 3QMPA 2WJZB 2A0UA 1B43A 1NY5A 4MI1A 5DCLA 3ZHYA 1AN0A 2WE8A 4AYTA 1YJBA 1Y6FA 1R2QA 3DQZA 3KAQA 4P7GA 2C31A 3S8EA 3OHSX 4KXVA 4JOSA 1RJEA 2UYQA 3SX4A 3NV7A 4A5OA 1N34B 2BCGY 3Q5DA 4INOA 4UEJA 2XZPA 3VPHA 3GAFA 4I4TB 4LXHA 2GFIA 2VNAA 4KYIB 2H2GA 4LTNA 3RRJA 3VPDA 1X1TA 2RBGA 1AX9A 1QHNA 1UP4A 2GK6A 4IHQA 1ISSA 1JH8A 1I33A 3VV3A 3FCOA 1QGOA 2GHTA 2A9PA 4Z3DA 2X5OA 3UFXB 4MQ4A 4ZYTA 2PU7A 4E30A 3HDQA 3PC8A 2O2HA 2ZAYA 2VHQA 3LG2A 3QVOA 2XGMA 1GTSA 1SKYE 3PZBA 5E3JA 3OLVA 4QXQA 4DT1B 2I2FA 3CBQA 2JAOA 3NRCA 4E5UA 2C58A 4QRDA 3RVSA 3H2IA 4PLFA 3DPSA 3UUGA 2Q45A 2O7SA 1L8OA 5KHLB 2GRJA 4EUNA 2O1EA 4LF6B 4ZI5A 1THZA 5DSZA 2Q5EA 4FZVA 2BUBA 1OTYA 1T25A 2BM8A 3DV0B 3JY6A 4HUTA 2A5FA 1AURA 1DE0A 1YONA 4V0RA 3Q87B 5L3SA 2OV1A 2HA3A 1PIWA 3RS2A 1NN5A 3D8BA 1UEJA 2HIMA 3D5TA 1JIVA 3O03A 1P44A 1RXYA 2C4KA 3GXOA 4LE0A 4YONB 4IR7A 5EIWA 4MYHA 4BXOB 1X87A 2MT9A 3PE6A 4XVRA 1Y6QA 1O2DA 4Y6SA 3OQHA 4NJEB 2ZUVA 2I6XA 5JJLA 2JEZA 2DFVA 3CUSA 1XNHA 4EVIA 2HCBA 4OI4A 3AERB 3QKTA 2ZM5A 4PCAA 4MKXA 4KFSA 5FA5A 4E5YA 3EGXA 3FLMA 4MVJE 3TX6A 1ZY2A 3CX8A 5JNUA 1M1NA 5AWFC 5EVJA 2PAFA 3HNRA 1E7RA 1JLKA 1Q0PA 4N3BA 1PWHA 2Q3EA 2G09A 2UDPA 2V3WA 2PZGA 4OJQA 2YRWA 4D45A 1JT9A 3G13A 1YR7A 3GZJA 4Z9AA 5DVZA 1KK0A 4IOMA 4A8TA 5EZ5A 3PB3A 1W4BA 1P75A 1XTSA 1UEXC 4Y2UA 3LP8A 3CH5A 2TMDA 5D86A 5GONA 3MUNA 2WY2D 2ZXUA 4FKZA 1BVHA 5BYKA 5M3BA 2IDZA 2OD9A 3FR8A 1I7DA 4I1VA 3RWOA 1O96B 1RXIA 1E1CA 1B74A 1L4KA 3OP1A 1XRQA 4YRLA 3PHHA 4JY7A 1MV5A 3RRFA 1GZDA 1GNLA 3KCQA 4PZYA 1EZ1A 1K63A 3HGMA 1SZJG 3JQPA 1M6EX 1Q1GA 2G6TA 5AKHA 3WP0A 3LF1A 2FW1A 3DAYA 1L7EA 5EP1A 4EL0A 4H2DA 3G9QA 3A06A 3CSUA 4QFBA 3RARA 2QV0A 1E9RA 1QH9A 4JBNA 3QXHA 3CB2A 3M6LA 4FW8A 4Q7QA 3G2NA 1F8XA 3KZVA 3CZAA 3EXFA 3EZ9A 1NL3A 1NYRA 1OPXA 2ZUCA 4FNOA 4OK3A 4X8HA 4E0BA 3ET5A 1GCAA 2I9PA 3HA7A 3DQPA 1AK1A 3E0QA 1IK4A 5J47A 3W2GA 3L7NA 1HRKA 2YBEA 4DIEA 2I1VB 1E0AA 1N5DA 4NQRA 3KOMA 5DCUA 1TNDA 5JIBA 1Q57A 3O1JC 2AOUA 4TS4A 2P7IA 2JGIA 1L5HA 4KPEC 1M1YA 1M5TA 1OOEA 3M4NA 4NATA 1QGYA 4WXMA 1A77A 4ITUA 3U26A 3V2GA 2F3UA 3L8HA 3WGUA 4TTPA 4EFMA 3SJUA 4PYKA 5J5AA 1P31A 1ZR4A 3L0BA 3HABA 3Q7TA 1R15A 4G09A 5A4FS 2C9YA 3LX8A 2ZRJA 4HYEA 4US1R 2O8BB 1FK8A 4MV5A 1TK3A 1ZH0A 2WM3A 1FP2A 1UWCA 1OH6A 4MR7A 3NU1A 4G5OA 1RZRD 4TRRA 1QC5B 3PJEA 1OKKD 2E48A 5DZSA 3VVLA 7REQA 5JI2E 2AYYA 1T1IA 2ST1A 1TAUA 3EGEA 4LKRA 1ZO8A 4XZ3A 4OUKX 1PFQA 1CCWA 4MS1A 3D31A 4Q39A 4QT0A 1J2YA 2VPIA 5AICA 3V8NA 5C53B 2IEGA 4EW3A 5JEDA 1U81A 3K2BA 4W1SA 4ZEXA 1FEZA 3ZBTA 5FX2A 1YDFA 1JV2B 2D8AA 3P26A 4BQQA 5BWOA 3I1FA 3SY8A 1Z17A 4HFRA 2L0XA 2MSWA 3WKAA 2QQGA 5C8YF 1USVA 1YHNA 1SVUA 1JE1A 2MCFA 3ZVKA 4DYVA 1O94A 4Y18A 4P98A 5U4QA 2XOEA 621PA 1TAHA 1TEXA 2B5WA 4HWPA 3TLEA 1KJQA 5AVTA 1JLRA 2OORA 4YUWA 3IEKA 1EUCB 2LXNA 2FN9A 1P2VA 1HFJA 3GUUA 3ZOKA 3LX6A 5BN4A 1NRXA 2FWAA 3GRFA 4RLHA 2C3UA 3KQSA 4LHYA 1Y3BE 1UDRA 1ULSA 1UUFA 3A37A 3LBNA 3Q4GA 3AF5A 1N25A 4J0HA 1R5OA 5EE9A 1KI1A 2Y92A 4GU5A 5B37A 1IBMB 1UDXA 1QDLB 2V7PA 2KLBA 4D6YA 4GUAA 5FOUA 1O57A 1PEDA 1GAEO 3MWEA 4OK5A 2HJSA 4JLAA 4KWEA 1EDZA 4ZVMA 3E8XA 3M6UA 4KFRA 2QL6A 2D7CA 4QQFA 5JYDA 3EIXA 3IKTA 4KRFA 2BFBA 4ZI7A 2JW5A 5FL3A 2Y77A 1KH1A 3A1UA 4HATA 2GHRA 3BGDA 4JS0A 4XLZA 3QA9A 2BD0A 3BHMA 2HCRA 4DJEC 4YTEA 2HJGA 5DW3A 2VP6A 1MJGM 1O9HA 3KSZO 1D0SA 2W70A 2HY7A 3HHPA 3I01M 1WBJB 4KV7A 2DWOA 2FWNA 3RVQA 3SMQA 3ZHRA 2DPHA 4KMRA 2OSVA 3F5FA 4J16C 3UXHA 4RESA 4IH1A 2XNJA 2A5LA 2HJRA 1JW9B 3H4IA 3MIIA 4E6EA 3C43A 1FDUA 4CHTA 5H9WA 1U5BB 3TRKA 5FDFA 5TMPA 4S3MA 1ODIA 4N01A 4DCMA 4XYLA 4YBZA 2ZYUX 1TYDE 3PE4A 4GGMX 3M6VA 1C9JA 4A9AA 2PBZA 3ORFA 4B79A 3M89A 4B09A 3QKRA 1RWQA 3ES9A 4BCDA 5T3UA 3HB4X 3MTQA 4UC0A 3RANA 4DWWA 1JEYB 2VTEA 4Q1AA 2GN1A 5C1DA 2VSYA 1RPTA 3MFQA 2G7ZA 5JV5A 3JYHA 3FPBA 1PGNA 4NOMA 5E1OA 1GNQA 2IEZA 1E2LA 1DZIA 1TLTA 3G7SA 3CNNA 5L3ZA 3QOWA 5LUBA 5JRJA 1OJ7A 5ALNA 5ERYA 3S2IA 3UK0A 4D9BA 4D9NA 1QZUA 5EXPA 1PJ3A 2CFCA 3A10A 3W90A 1KKMA 1Q77A 4TOIA 4AYWA 1KZ4A 1P5JA 3LP5A 3QV2A 1D7OA 1T1SA 1MW8X 1ZGHA 3LZ6A 3NATA 2Z2ZA 4MROA 3U7GA 1J8QA 1NVWQ 1Z47A 3GCWA 4ODIA 5IZCC 3IMCA 4Z4CA 2PS9A 4YDQA 4DG9A 4I55A 3SJCA 1CBUA 1TK2A 4MS4A 1Y8AA 3B3QA 2HV8A 4RHFA 4RZXA 3M34A 4TXHA 5B3JC 5FEUA 2RIPA 4GIBA 3TLGB 3N2LA 1QFZA 4F8YA 2WW8A 5HCIA 1OE0A 2YW9A 2ZSBA 1M1ZA 3PZRA 2OY0A 2Z57A 1HTWA 4A82A 1AS3A 3VBCA 5AJYA 1XJWA 1U1CA 2Q8QA 4AF7A 1PQPA 2X9GA 3MJSA 3P7MA 3SQXA 4TMWA 1DFHA 5JJ5A 3CLKA 5KSPA 4YUVA 3K9LA 1ESDA 2YHSA 4AO6A 2A9QA 1GGHA 3QQPA 5J59A 4QUDA 1RMYA 3TLAA 3JAWA 3DE1X 1L7MA 4EA9A 1T8TA 4G23A 1SUCA 2CNDA 3OJLA 4EITA 1PWXA 1KAOA 3UAXA 4BU0A 2RGGA 1BXZA 2QVLA 3W8RA 5LQAA 3O26A 4OSPA 1OASA 4EFNA 2GLTA 1K5PA 5DBIA 5B12A 2OQIA 1AZWA 2J45A 4W5QA 4YV1A 1T8YA 3BFXA 1SCQA 2O4CA 1Z7GA 4BMPB 3C5CA 3R09A 1Z5VA 5K8UA 4BMNA 3ZHBA 2OFWA 4PLYA 3B5IA 1A7KA 2WNIA 3GEDA 3A1EA 3HWRA 4OB6A 4YP7A 5JT1A 4DABA 3GJ5A 4QELA 1REQB 4G5FA 1CSEE 2GBGA 4UBJA 3AR3A 2I03A 4Z7JA 1QRTA 4PGHA 2IA5A 3OCVA 1ZR2A 3RASA 4OKIA 5IS2A 4XDYA 3R5FA 3M33A 3PX2A 1DT3A 1VZ2A 2OB2A 2P91A 3CJQA 3OZVA 4ON9A 2JATA 4WCFC 3TMYA 1LX7A 4MWTA 5EP3A 2XUOA 5G4KB 1NPTO 5FPQA 5SY6A 4IIVA 3A7EA 3VNSA 4IWYA 2A3NA 4J0CA 1ECJA 1FFXB 2OOSA 1WM1A 2VXOA 4MPJA 4Q9DA 4WDQA 5ETJA 2QM7A 2O7QA 3E15A 3K94A 3SF8A 3C3DA 3VSCA 4Z1OA 5IKMA 4GLOA 1PQ4A 4PGGA 4Q9JA 3FPAA 3CZQA 3V8RA 3ZHCA 2H9IA 4FOTA 3BGWA 1T43A 4G9GA 4HNQA 4EF6A 3EK2A 4NBKA 1DDIA 4X20A 3ZWQA 3WISA 2PBFA 4NARA 1WHSA 1FVFA 4MV9A 4Q7JB 3C45A 1TYAE 2B7LA 2FRVA 4BFVA 4C43A 2NQ8A 4R16A 4BC0A 5KYTA 1TCAA 4K0KB 1X13A 2OLEA 1H5NA 4X94A 3KPJA 1R8XA 2R5WA 3PFKA 2X19A 3GJZA 1SA0B 4RD1A 3ZHVA 1P1JA 2B6NA 2HNKA 4XD2A 3L5OA 4HMOA 4D46A 4R5HA 3FETA 5AHXA 1MT0A 5DHUA 4DA7A 1E7YA 4ZVKA 2WKWA 3L7AA 1ESNA 4K86A 3ENZA 3DP7A 1ZXBA 1EFVB 1P0IA 5CX1B 5FUQA 1IRXA 2YWBA 4GX2A 1SJ9A 3BCHA 1E6UA 1QIIA 1NUQA 2X4LA 1M6YA 1R7RA 1HDGO 1RQNA 5BUQA 2JKVA 4O4LA 2YHUA 2BP7A 5C4GB 3W6PA 4JVLA 4TT3D 4HDMA 3JWEA 1NGSA 3BG5A 4YRCA 3PUHA 5LB2A 1QCYA 1VMEA 5F1OA 1C7EA 2JCGA 1BWSA 2O3RA 2V7QA 3E5RA 4JLUA 4PNEA 1P60A 2O1SA 2QD1A 3GD7A 4LV6A 4RC9A 1FB5A 2DXIA 1ZD8A 1ACJA 3HWX1 1II8B 5ARCA 5JNVA 2XDQB 1KEWA 1WCWA 1QHGA 4TPKA 3PTLA 4TQAA 2G0NA 4BVJA 4IIDA 1BMDA 5IC4A 3OKCA 1SC4A 3RT1A 2A1UB 1YC2A 4OXNA 1T5IA 5HRUA 4YMUA 2O5VA 4FR0A 1XX6A 1URPA 3PV0A 5L4SA 4L9AA 4IYJA 3W7BA 4LYEA 3AEUA 1UPBA 3SC2B 2XGOA 3AW9A 2FF7A 2Q3HA 2OVBA 3TPFA 4C6TB 1CJBA 1HUQA 5T3YA 1ZXXA 4N47A 2FTKE 4ADSG 1C7ZA 4FFOA 3RRNA 2YUTA 4OLFA 1E66A 4QGBA 5FPSA 2ZIGA 2VJLA 1NHWA 1MQAA 1DMRA 3NEJA 3OKPA 4OHMA 1BSVA 1DTWA 1YO6A 2ZIXA 1YZVA 1P6XA 4CLEA 2FEPA 1CEEA 4JHXA 1C1HA 2W2MA 5JD3A 1J07A 3H0CA 1KJIA 2RHWA 1I32A 3CVWA 4GYYA 3R75A 4F04A 1WZEA 2WMDA 3GLHE 1MIOB 1XAGA 4MV8A 5AMXA 3GK3A 1T3SA 3RKUA 3U3DA 4CIDA 2NTEA 2FY8A 3HNOA 4N7RA 5DT9A 3Q1LA 3F49S 2Y76A 4XB6B 5HS4A 1FTGA 4LTDA 1GNSA 1I7SB 1G8YA 1XHLA 3COPA 3MT9A 5GMOA 3HDGA 4DHEA 1E9EA 4IDQA 4H1HA 1IRIA 1OZHA 2WSBA 1AZSC 4ZRDA 2ZJFA 2ZTSA 2Z09A 4JJKA 4RSMA 1T9HA 4RVCA 3U31A 4ANFA 2CHGA 2WG1A 4BAZA 1HDIA 4RK1A 3PHBE 3VJKA 1YDEA 1WB4A 1EQ2A 2G9RA 2PMKA 3M7IA 1R27A 5TGZA 3LE8A 3RQIA 3AU9A 4B6JA 4IUBS 3PKIA 4ZT6A 1SCBA 2DBZA 2FPUA 2HYIC 1O0SA 1ST2A 5FPYA 1GQSA 3MINA 1DG1G 2QTCA 3AEQA 3K2IA 4H7FA 1R4MB 5AKKA 5LQKA 2OM6A 2NSLA 1YGPA 2UVQA 4DTCA 3HL0A 5TGTA 4Q05A 3RUPA 1Y1TA 4DARA 1VL2A 2WFZA 4XWGA 5I4BA 4FS8A 3DHWC 3MMPA 4R4JA 4BJHB 4KQJA 5IXYA 5FFNA 2ZUEA 2X0NA 5P21A 4ZKDA 5JZ9A 1TUIA 2I3BA 1KAQA 1I2CA 2OCXA 3K7EA 4Q4LA 3MTJA 4FMPA 1VQ1A 1A8HA 1QAOA 2D2VA 3H84A 4BNNA 2VHCA 3HL4A 4JXKA 3SDBA 5LYJA 2HLDD 4R05A 4AN0A 1S4QA 3PNYA 3FAKA 3QBDA 1Y89A 2ZG6A 4DMHA 1VXRA 1UBCA 2R7KA 1GFWA 3SBXA 3I34X 5C1OA 3U5ZB 1RXEA 4NU8X 3A6EA 2O3QA 3KXKA 1K8RA 2JHFA 2XWPA 3AIOA 4NWIA 1VG0B 4GKAA 3KQWA 4OB8A 1KPHA 1MXHA 1QRAA 1IBSA 4UTRA 5AUOB 3D4NA 4DMMA 5JZSA 2XNHA 3A4MA 2PTGA 2DFLA 3I32A 5JH7A 1GAQA 1NF3A 1JHMA 1NT2A 3MK31 1UOQA 2Q9BA 1QIDA 5FV7A 3WL8A 1JBQA 3EQ6A 1QV9A 1BDIA 5LPNA 2E4YA 5J43A 3QVXA 3NB0A 1KZ1A 4I9GA 1BD3A 4G3XA 2Q5JA 3ZWKA 2ZRNA 4PZCA 1EWVA 2I2XB 4BIMA 4GL2A 2POCA 3N8IA 5HIJA 5EA2A 4BE9A 1WCV1 8LDHA 2X40A 5SZHB 4BO3A 3KQQA 3FBWA 3VR6H 3X2FA 3ZIUA 4LI0A 5ICEA 4OM8A 1FJGB 5HYVA 3TQIA 4EUFA 1FL9A 2ZYHA 4I50F 1TVKB 4N5LA 2EL7A 2IXEA 1X1DA 1TFRA 1SXHA 2E0IA 4JYAB 3PLAE 1ADYA 2R62A 2N3ZA 3R8FA 1L5LA 5KMGA 4RE5A 4ENPA 4HH3C 1EQAA 1GGNA 1OXTA 1DJNA 1XLUA 3MOGA 4QPCA 1X8LA 2EYQA 1U0NA 4F1WA 1MO3A 2ATCA 1XGKA 2I4OA 3AG5A 4LVUA 1Y3IA 4NENB 1IXZA 4Z51A 2HA2A 4ZALA 3MRSA 5CT6A 5BQPA 4RULA 1E62A 1YZHA 2PIDA 2ORIA 1JDTA 2YX1A 9LDTA 2JLVA 4E5SA 1WLYA 2GCPA 4RHUA 5AOAA 1NP6A 3E9RA 5TDHA 4PQEA 4WT7A 5DKFA 3QY9A 4TS1A 2R6GA 2Z3ZA 3FH0A 1LQTA 4LXYA 2B30A 3BZBA 3UMYA 1Y63A 3AIMA 4FILA 4XGNA 4IZ6A 1E2DA 3V7YA 5JNLA 2DT8A 2J9YB 5F21A 2Y1XA 3A9VA 2IODA 2QA5A 3UOGA 2OO7A 2PFKA 2QVXX 4V0OA 4OVKA 1P9WA 3UIEA 3A2KA 4GOND 2W0SA 4ZDJA 1MNAA 2CYBA 1Q7RA 2D1RA 4Y7DA 1SCIA 2NSDA 2WK1A 4ML3A 3VHRA 5LZ4A 3VZBA 3LGXA 3W77A 5JS7A 3NTXA 1XKLA 2YVUA 3JQRA 4CMBA 5HFNA 3WIOA 4AMGA 4CTNA 4C1BA 1GTG1 1OWMA 4DBVO 1RWOA 3TLMA 3EJ6A 5FTMA 4LBWA 1C8KA 1ACMA 4YALA 1X0VA 3DD1A 1NHGA 4HLCA 1CY1A 3MNFA 4NZOA 1L5KA 3H1GA 1WMSA 1ZS9A 5EQJB 1VKOA 5LQRA 3TF5A 3VOSA 1B14A 4W9RA 5HBGA 3IPRA 1UBEA 1KSFX 4PZEA 2CE7A 1K6MA 1P7YA 1JLMA 1GZ7A 1PJBA 1KJNA 1RAHA 4H3VA 1SEVA 3AJEA 4V38A 2OYRA 1UMDB 1TRKA 1NUAA 3HGTA 1RRMA 3EEOA 1BTOA 4KR2A 4FEAA 5FBZA 1WDKA 3LYHA 4TX1A 4AP6A 1WKBA 4HAIA 1NLYA 3KO8A 3DMTA 1KEVA 3JD4A 4E08A 3E7XA 1G18A 3A6FA 4PAWA 2FEAA 4X7PA 4LNAA 5F1PA 4FWBA 4M9ZA 4WZZA 1YBHA 4OYLA 1OCEA 1JHVA 4UHHA 4CLXA 3SXJA 2A8YA 3ZDQA 3A9CA 1SBIA 4U2CA 1ISJA 3I09A 2X76A 5EJFA 4A1OA 4EA8A 3ZJUA 4FGZA 1V1RB 5KOHA 3JAKA 4HR7A 1E2KA 2RI6A 3HB0A 4FT4A 3B2EA 5TJ9A 2D00A 2EWVA 2YBDA 3QSGA 4K2AA 1NVEA 3KQVA 3ZBPA 3L1JA 3VJRA 3DOJA 4GZ5A 5BYAA 3B6ZA 3RSGA 3FSGD 4JH0A 4KKXB 3EG9B 3PPYA 3TKLA 3KQHA 4PYNA 2BEWA 1JEJA 3ISVA 3T9AA 5DYTA 2ZBGA 3ONNA 2AD5A 2W2VA 3Q7QA 3NHRA 3SG0A 1QR2A 1ZMOA 2V3VA 4N18A 2GF2A 2IIPA 4U2GA 3H1EA 2C2MA 2R65A 5A3JA 4MW4A 4IQ8A 3CJRA 1PK8A 4IS3A 3LDUA 1JDBC 1D8AA 3GJTA 1Q0UA 1XDBA 3LT0A 2HXGA 2WFLB 4ZU3A 1TA4A 5K3EA 4FYYA 1WHTB 3WNZA 2VHVA 3OTIA 3WLPA 1YS4A 3ETJA 1QVZA 3KLPX 1JG3A 5FLEX 3NC0C 3KSAC 1BCRA 1C30A 5C7OO 1C80A 2ZDHA 1YB1A 1CZKA 3GGDA 4QDXA 1EFLA 1DRJA 2QT0A 2EJUA 2QN7A 3H16A 1QIGA 5K3DA 3MD9A 3ZU5A 1D6JA 2Z6UA 3CPEA 5CX4A 5AOCA 1EBUA 1ARZA 1RIIA 4W9NA 5DWDA 2AD1A 4HBZA 4IH4A 1RHKA 4IKOA 4G37A 4OATA 2NXJA 4RL6A 3WTBA 1X9HA 1Z29A 3IBTA 2C7PA 1ICEA 4JNKA 4WJLA 1NVMB 5BW5A 2Q3CA 4JBWA 4F3TA 4KAAA 4BNTA 1U7OA 4K9NA 4RF5A 3PNQA 1Z0JA 5KBYA 4I1OA 1TL7C 2H08A 2WA1A 1TAGA 3ND9A 5SICE 1MAHA 4MAAA 3D1VA 4HDCA 1Y8RA 3CN9A 2Z1MA 1RABA 2Z2YA 3ROTA 2XE4A 1C50A 1DIHA 1RXVA 4EX6A 4LQLA 4YDHB 1R00A 1XZJA 2G5PA 3PQ2A 2B34A 4HZIA 1SCNE 4YPVA 1TYEB 4CF4A 4DDTA 5C8YB 3B6EA 3F6PA 4HSEA 3SZOA 2ZEJA 2ZJ0A 2ZSDA 4DA0A 3F3MA 4OI0A 4M36A 4LDQA 2JI4A 3R20A 4ZT2A 5K2OA 1XZIA 2W90A 1RQPA 3CR7A 4IIFA 1L4BA 2FPMA 1XHFA 1LW6E 4MQUA 4E1VA 2B3DA 1V9SA 4MMZB 3UJBA 1TLFA 1O08A 3LCRA 4M8NE 4TN1A 4PVCA 4Z0HO 3B51X 4FYIA 4W99A 4EAAA 4Q7MB 2HMVA 4K46A 2WMYA 2GPNA 2B8EA 1Z4NA 2H57A 3OZCA 4RYDA 1KI6B 3SJ7A 2BWJA 4R2IA 4EG1A 2H8GA 3OTGA 3PU6A 2Z83A 1NBME 2JIZD 4ZU6X 5KNDH 4RVDA 2UU9B 2P7HA 1PQWA 5JASA 2HLPA 1VECA 3K0SA 1UJCA 2A35A 5B58T 5B58C 3TYXA 1IAQA 3OEHA 1NNEA 1RQXA 5E4YA 3M6MD 4C88A 1F4VA 3DR5A 4L08A 1IU9A 4PN3A 2MOKA 2EXXA 3GGPA 4BQRA 1I3KA 3AHJA 1GTJ1 3VZDA 4D56A 3AUYA 2YMLA 1J6UA 2UXDB 1OXSC 1U31A 1Z6XA 3L92A 4IX9A 4YRAA 3N53A 3NIFB 4XIYA 3S2SA 4KP7A 3II6X 4L85A 1T8PA 3OZEA 1XZPA 1N2BA 5F5NA 2CMHA 5IDYA 2PV0A 5FOQA 4MDEA 4FB4A 1KARA 3WSTA 1A69A 5DGXA 2G7MC 2XUJA 5EZ6B 2AMJA 2CLIB 5LA6F 3VKUA 2QTZA 4H7EA 2XXBA 3B9QA 2H2AA 2VDKB 1Z2PX 3AP3A 2CFSA 4KJZA 2FMTA 3JVEA 3R3VA 1SVIA 1BZYA 3HCBA 3DTVB 4PO3X 4XGQA 3FOZA 2YV5A 2WT8A 1M6NA 4DSUA 4L3WA 3AGQA 2PWBA 1W7AA 2QRZA 1SU8A 3HPRA 1GL6A 1OAOA 5LOVF 3INTA 2F3QA 3DEFA 3T54A 2OMKA 1HOTA 3ZWXA 4BRZA 3JQ8A 4J0KA 5EG5A 4RDXA 2IY9A 3IBCA 1Y42X 3HN6A 3NM5A 1EX6A 3CE6A 4KGVA 3SS7X 2UZ1A 3P8ZA 4QUBA 1EWKA 2JVJA 2ETXA 2OV3A 4QYIA 5ICFA 1LSSA 1U9IA 3L8GA 5ALKA 3B70A 3DWFA 1RNLA 1R0WA 1XVAA 4JUDX 4PLZA 3T9FA 2NV0A 3UHFA 1QUEA 2HW8A 2BBSA 2PXAA 4RLFA 4FCWA 5J9FA 2O8FA 1Q44A 2PS0A 4TWZA 1YB7A 4Q9KA 3FHTA 2VS1A 4HDKB 2B2CA 3LA8A 2IYWA 3JQAB 3IVAA 2ZRPA 3HVUA 2QX4A 1PWEA 4HNHA 4OH1A 2AVNA 4XX0A 1BFKA 1RXSA 1JAXA 5CFPA 1LB1B 4U8GA 5BNZA 1F5NA 3FM9A 1XU4A 2QN8A 1CHNA 2Z9BA 3AHEA 3PSAA 4G81A 5K3CA 4ZICA 1FDTA 2YYAA 3BOSA 1AM4D 3VZRA 5C46F 5MGBA 1FLVA 2ZT5A 1GTZA 3L4BC 5TMDA 4YO7A 4TUYF 1K1EA 4PXSA 2DB3A 3QWAA 2VSQA 4IFTA 3JD0A 1YULA 2JFHA 1CW2B 3KEMA 1UT6A 3SFZA 4Q93A 1TUBB 1YAJA 4LZAA 5JLAA 3B1WA 521PA 3VXKA 4Q3AA 1VYVA 5TR9A 2A9KA 1MMFB 5LQMA 2NPFA 2Z0MA 5GJWC 4BB0A 1OI4A 2X58A 1OH5A 1HBJA 5KVCA 4OAPA 1A98A 4TXLA 2W83A 4FZ5A 1B6RA 1GZVA 4MV0A 5AJTA 4CV0A 3VTZA 5KAPA 1K75A 1FFSA 2H00A 2YZKA 4IWNA 3P2OA 3WLOA 2H4ZA 5JRZA 4IJMA 5TARA 4EGJA 3QE0A 4HPJB 1DBQA 4DJTA 5K8LA 3IPYA 2PBRA 1YR8A 2H0AA 4WMLA 3E27A 2O2JA 5JSYA 1T1EA 4V0QA 2DFNA 5FI1B 1OXMA 4QGFA 2X2PA 1MFZA 3GBVA 1ML4A 4ZO4A 5EQDA 4ZYZA 2XZOA 1RW4A 2PNJA 1J0DA 1GKLA 3DMPA 3FG9A 3I37X 3PNVA 3GUZA 5DP1A 3NUGA 4M0KA 1JAZA 1EUDA 3RVNA 3KJIA 4BTEA 3DL4A 1H8EA 4FP9A 4N82A 4LGYA 1IXRC 4QBHA 5F77A 3FCSB 3FPFA 1FNBA 3STXA 3UATA 5FTNA 1WL8A 5KNDA 5A1TA 4EUKA 2QVCA 1A9XB 3T5AA 4QOHA 3RU3A 1SD5A 3L4SO 5E0OA 2XMGA 4DCUA 3I0MA 2H1LA 2J6BA 1KHTA 3RFCA 1NXWA 2HNAA 3CE9A 3IOEA 4L4SA 4NRDA 1H8HD 1Y80A 4DJ5X 2PZAA 5H80A 4YAUA 5CBKA 4EVQA 4BN0A 4AJEA 4CKBB 1YZ3A 1SO8A 4NZNA 1MG0A 5AP9A 2WPDA 3T5PA 2DM6A 2R6FA 4A0GA 3S81A 4ZZ3A 3IUSA 3JQ7A 3F5DA 4IDEA 1M2WA 1Z8HA 1DSSG 2QI9C 4HAUA 5EXSA 3AKZA 5TY0A 1DEKA 4X63A 1LDMA 1KO5A 3D8HA 2QPOA 5IJ0A 1BX3A 2G6BA 1Z6AA 3GHYA 3U39A 3K6KA 1F6WA 4DRZA 3OQMA 1U02A 1NVDA 2GZSA 5AHWA 2YV2A 1NTOA 3MS4A 3RKSA 1IJBA 2HYDA 2ZJ1A 5J4VA 2V3CC 4URHA 2Q5IA 4EL5A 2OC4A 3E2PA 4RMNA 4CQMD 2ORVA 2O7RA 3CKLA 3IUNA 2Y3IA 5C37A 5I01A 5H16A 5KC8A 3NEPX 2Q7DA 2AFIA 2NU7B 5CXSA 5M2QA 2ZIAA 1VE1A 4ZN6A 2VSFA 2AOXA 3N2GA 4WZAE 5HPYB 3MWDA 3EAGA 3FCAA 4P31A 4BX8A 3ERCA 3WL6A 1GD1O 1E4YA 1SUEA 2Q0SA 4GMGA 2C5SA 1F48A 3DJFA 1K86A 1NATA 1XTRA 1DXYA 4LS3A 2XA1A 2R8XA 2KW5A 1JUDA 2HXYA 5I7FA 2ID9A 3ZWAA 5KTOA 3THWB 1PBTA 3G2QA 2CDCA 4B7AA 1CWUA 2VYVD 1F06A 3COWA 3TQFA 1JA0A 4NCKA 4RABA 2BDTA 2WEKA 5ECGC 5THXA 1KVQA 4Q00A 1BMQA 2HD4A 3RC7A 4B9EA 1YZQA 2YIDA 3LW7A 1Z5PA 4CM3A 4YP0A 5TT1A 4CLRB 1JJFA 1J42A 4II3A 5JCJD 3U09A 5F98A 2V74B 2WPNA 3U9TA 3UJ8A 1X7WB 3BB1A 4MV6A 4V0MA 3DFKA 3E9MA 4F71A 3T7AA 4ENRA 4KQEA 4MB6A 4ZI3A 3H5RA 5HRAA 1ZM7A 5TV2A 4B40A 5K6RA 2AX4A 2B0CA 5AK4A 2P90A 2WF6A 3OMLA 3EEBA 2HF7A 4AUMA 3L1HA 1IEXA 1U8EA 2C59A 1KP3A 2AHRA 5GADl 3FOBA 2BH9A 3VMMA 2YINC 1QANA 2JFZA 5ALIA 2ID8A 4RD4A 1YK0A 1R66A 3UKJA 3VU9A 2W2NA 1L5YA 3AUSA 3EIEA 3K6SB 4IWXA 3L2OB 4ARIA 5JCOC 3WL5A 1UMCB 5IDWA 1LEHA 1PR3A 3TTUA 4YHHB 2C04A 3U4GA 3GRVA 3ABIA 3WIDA 2POQX 3OO0A 3H13A 4RL4A 5DP2A 3SOPA 4F4JA 4P3YA 4CM1A 5M5BA 3W2FA 2ZQYA 4AQYB 4N76A 4Z4GA 2FW0A 1XC7A 3UXMA 3C6ZA 1C8VB 1JIIA 1SCAA 5CLHA 1LLCA 3RK1A 1EESA 1CY4A 2OO5C 2OUIA 2KI5A 1Z73A 3JASA 4FE3A 4W7SA 5AKJA 3SVZA 4B6GA 2PSJA 1QVRA 4UM9D 4W82A 2QMOA 5DNDA 3L8FA 1WW8A 1ESCA 3K4PA 4IRXA 5AI6A 2J0EA 3PPVA 3VJMA 3WQQA 3OOYA 1VCNA 5U1PA 3FGOA 3X1KA 3DS8A 3IP3A 3RC3A 4DW8A 3ADPA 4HH0A 4IJUA 1QQ5A 2B20A 3PQFA 4MLZA 3M5WA 2PZJA 1XXHB 2QAGB 3CU5A 3KYBA 4H9GA 3WDKA 4UMVA 4H1TA 4A1FA 3RI3A 2QBYA 4G4IA 3PA6A 3B38A 1SG6A 3CMCO 3DOEA 2YUIA 4HQRA 4JVSB 4WERA 4EJMA 1P72A 4KNYA 2JHGA 3I2HA 3A4IA 4G41A 4RVOA 4QEKA 5BYJA 1VE9A 3MJDA 4M1MA 2FQ1A 3C8MA 3CX4A 3DEKA 4R8SA 1ONNA 3PLNA 1SVMA 3NWEA 2AG6A 1GUDA 4ZJYA 1BDHA 3IRUA 1W75A 3D02A 3IE0A 1WP4A 4HDSA 4ARZB 2GN6A 2QYSA 2WJPA 2GN2A 5F5LA 4OKSA 1TM7E 1TEZA 4GLBA 4KE8A 3KJQA 2OZLA 4I8DA 4YRKA 5HQ3B 5E7MA 4QUAA 1G0NA 1UFKA 2J6CA 4IIJF 3VOBA 2P40A 2ZWMA 1U2ZA 3PPXA 2O07A 1EGAA 3IJPA 4QYMA 3U7QB 4ZPXA 4EHNA 4BNGA 3GFVA 2VP9A 4G1UC 4UUPA 1KXJA 5K3BA 1FMCA 3HK2A 4MVJF 5DSXA 4U7HA 1O6ZA 4BZZA 2PUCA 2JJ8A 4ND1A 1C41A 5IH7A 1AUXA 2WD8A 3GARA 2QIPA 1VL6A 4MQLA 3VC7A 1LBIA 3D6HA 3H99A 3M81A 2CW5A 2XECA 3D1LA 4F45A 3AILA 5J1SB 1PLLA 4UAGA 2IP2A 1KC3A 4AQDA 3WB2A 1YR1A 1K2WA 3F6YA 3GG9A 4YQEA 5IZCA 5EJ5A 2PZLA 4PS0A 4ZO7A 1SXJE 2PQMA 4NYJQ 2CVPA 2GAFA 3HE3A 1FX0A 4QOJA 1T5HX 3HJGA 3VR4H 4ZI2A 2WBLC 4JA2A 5C81A 3NBQA 4I50B 2HSDA 5U4XA 1G7RA 1XMJA 2AYXA 3UCFA 2HIHA 4KXYA 3ADCA 2JFNA 3DDOA 3A32A 2HQSA 1U0FA 4TV8F 4LECA 2XF8A 4BDTA 3VPSA 3EGIA 2CZCA 4WD3A 3VOTA 1RC8A 4EI7A 4ZT4A 3CMMA 2TS1A 4DR4B 4CCSA 3HLTA 1L7RA 4LF4B 1OPRA 5I7AA 5JD4A 2WI8A 5F1YA 5M7EA 7ADHA 5IC5A 4P35A 2JI7A 2XQJA 5AXDA 3W1WA 3EBPA 3OX3A 4FFRA 5IWAB 3AL3A 4A2CA 1JKFA 4Q12A 2AJCA 2VPYA 4OQNA 1L5SA 2M9MA 3ZJVA 3A2NA 4BFSA 5JQGB 1AQYA 4NK5A 3NGMA 1RC0A 1ZCJA 3DOIA 3OKAA 1RWVA 3NRBA 3AEXA 1XU7A 4XPIA 2BSXA 2FLKA 2OYSA 2AZTA 3BH7A 3HB1A 1N2JA 4KE6A 1F17A 1Y6JA 4FWIB 4M6WA 5CPFA 1BA3A 3MVEA 3G7NA 3AEKB 2AOVA 2EW2A 3WMGA 4PR3A 1L7BA 1Q17A 3RROA 4B87A 3U19A 1T0IA 3G79A 4WCFA 1JYSA 1T9AA 3RS0A 4GPEA 1FXWA 1WULS 1XQWA 3RHZA 1F2TA 2BKXA 3P96A 3ULKA 3NBFA 2LZ0A 4DCTA 2JGRA 1NXOA 4TZ0A 1ZK4A 2XMCA 2ZSJA 5C8VA 2JGAA 3MAJA 4LYYA 1J9ZA 5JSZB 3BPSA 3PDJA 1V0JA 1TAQA 1CXZA 4HXEB 1IH8A 2RGEA 4WZ6A 1XPUA 1ZM4A 2R8RA 1UJBA 1RRGA 2ZI3A 4UATA 2H9AA 4LQCA 2IITA 2GAOA 2WJJA 2QVGA 1C3VA 4PXYA 4WV3A 1BAPA 4RQUA 2J3LA 2YNMC 2YWDA 4KXQA 1XCGB 1ACLA 1TW2A 4E2FA 4DLRA 1V8DA 2JFUA 3AWIA 4BO1A 1QK3A 1HYBA 2OBNA 4NOLA 4PW0A 2NYAA 5E0KB 3DBHB 2KYRA 1LQUA 4OHRA 4CV1A 1MFPA 1VP9A 1YRBA 1OGYA 2Q07A 2X8BA 4QTXA 2CXOA 3FNBA 1LBHA 5ALUA 1E1RA 1GCGA 2OXFA 2KS6A 1NUHA 4M46A 4ND4A 1DO2A 2VNKA 4JB3A 5FA6A 4YYZA 5FPKA 2IQ5A 3SIRA 4YIHA 3NP7A 1K92A 2TMGA 4NR0A 1BXRB 3OPQA 1X6VA 4LYDA 1DKLA 3PITA 4FLFA 5GTDA 1N33B 4TS3A 1CQIB 3CNQS 4M86A 3OMWA 3IIJA 4RDIA 4WFIA 5EY5B 4ZYVA 1C7JA 1SUWA 1QB8A 4L27A 5KJFA 2O52A 1XP5A 1MJHA 4GP7A 4F46A 3DC2A 4NP6A 2MYTA 1KOLA 3A4YA 5LKAA 1LBSA 4O2AF 1T2DA 3PDCA 3W6NA 5I7RA 5AM2A 5B1YA 1QMPA 4GMFA 5M34A 3EIHA 2ASVA 3OQJA 4IEFB 2EJTA 2GGSA 3UC5A 4TS9A 2GTIA 2VHUA 1E96A 4UU0A 2H4YA 3CX6A 1Z2OX 4TTAA 3L7JA 3U4AA 3WKBA 2FSHA 2C3PA 2P6MA 3KSDO 4YJ3B 3MAAC 1X86B 5EZYF 1SGWA 3CFYA 2WG0A 1EAYA 1M8KA 1N92A 4PO8A 3YASA 1P2GA 1SCJA 2XW6A 4PYOA 4CN8A 4C1NA 1L8QA 4BKUA 4HEQA 4OQPA 2IW3A 4UTPA 4G0PA 3PJRA 3H8JA 2O4UX 3HR7A 3EYWA 1BC5A 3RWMB 3V46A 3ZU6A 2CUTA 4G4SP 4O4IB 3WKDA 3GFSA 3DBIA 3LRTA 3C6XA 3CH7A 5E3IA 3DWEX 5FBLB 2VK8A 3I2FA 3VR4A 4BNKA 1Z4MA 3W9UA 2ZBUA 1I4WA 4ER6A 5A2QA 3N05A 4FCVA 2OFXA 3R6WA 5F73A 2VTBB 3CWQA 1B0AA 4WUVA 4O0LA 2X9VA 2BTQA 2GEDA 5BURA 2RSLA 3NNNA 4ABYA 5K8VA 3D6VA 1P29A 4GDMA 2PZ8A 1E9BA 2H11A 1WCIB 4B3DA 1ZIPA 2ECPA 5MGNA 2ZZNA 3A6JA 1ID8A 3TRIA 2CDBA 2GNAA 5IHPA 2XV1A 2YFYA 1M6VB 2DWPA 1Z0DA 3M6AA 1H2FA 5DK6A 5BRJA 1FNSA 4F5ZA 5CLQA 2OQRA 1OB5A 2GTHA 1G8AA 3I5MA 2NSYA 1TYBE 4G5SA 5KQPA 1EH5A 2L17A 5D8DA 3X1WA 1TUEA 1CRQA 3L8ZA 1NE7A 3U7RA 4M9CA 3HKCA 4MRRA 1P1KA 2PLRA 3GPIA 3NDRA 1PZFA 3T6KA 4P2BA 1NONA 2NW6A 1KMNA 2GK7A 4KH0A 4PFKA 1GLGA 2XSZA 3N0VA 3OQBA 4DS3A 1H9CA 1DMSA 2NO4A 2JEYA 5LBIA 5BR8B 1RHMA 2GHIA 4UXJA 2WWYA 4Y98A 3A11A 3R77A 3H5OA 2Y1FA 1ISHA 3GPBA 3Q85A 4HDAA 4EYSA 1Z6PA 2FPOA 1CRZA 2LE0A 4P93A 1PV4A 1D2CA 2HTEA 1TPYA 3P2IA 1G21E 2QG9A 2WJGA 4FYXA 1K6EA 3UFBA 1EVYA 4HQKA 4F1KA 4G07A 4HZUA 3GIDA 3MCWA 5LXTF 3SIPA 1JFTA 1TX4B 1ZNWA 1P4JA 3FTFA 3KQKA 4BVHA 4MHOA 4G1BA 1QNLA 2FQYA 3G5UA 3L07A 4CG3A 4G8JA 1AKWA 1XQ6A 3ABSB 3FUTA 3I9OA 3Q2KA 5LA6B 2NO6A 1RTKA 3PUZA 3ZPXA 5AVRA 2GZ3A 1TZKA 5KKCA 4LNUB 3VR5D 1X1RA 1PR4A 3GJSA 4ZT3A 3NYRA 1X80A 3AM3A 4N65A 3JQEA 1I2DA 3F5QA 3O91A 1KFCB 1PCXA 3L43A 1L4UA 4HTAA 4EMUA 4YRIA 4J0IA 3ZEAA 1X7DA 5ELLA 3WLEA 4EPWA 5KNBH 5LOVB 2A0XA 3COVA 5BRNA 3SJAA 4KO4S 2R1TB 3QX8A 5B7PA 3IAM1 1JIQA 3PCTA 4I5GA 2EKDA 2XUHA 3VKVA 3X1JA 5FFFA 2RJNA 3OC0A 2GPSA 3BH0A 5GINE 1W36D 3L6DA 1G5QA 1C0EA 3Q3CA 2D0DA 2I2DA 2JASA 2P0AA 2HEGA 3K0HA 2WIDA 1K4MA 1P3DA 1TZJA 3KB2A 4LJLA 4CTKA 2I1WA 5CA1F 1ZX1A 5AVVA 1GLNA 3BSSA 1V5EA 3LVBA 3KZXA 4QJ5A 4TTTS 4A8JB 2Q99A 1II0A 4UAUA 2C92A 4Y9TA 5E7IA 5F3DA 1LK5A 1IC6A 2DLNA 4ILKA 4EY7A 2V7VA 1FPQA 3UJ6A 5LNK1 4C14A 3IPXA 1PZGA 5BN5A 4B3RB 3FPLA 3LUFA 3L7LA 3H5IA 4UBKA 3SFTA 3HO6A 2BIFA 3FCXA 4L02A 4ZVTA 3TIXB 3U81A 3WNVA 4C4RA 4KMMA 2Z6AA 2FX3A 2O2ZA 4HDRA 5CU7A 3JPWA 1EP3B 5BUCA 3JQDA 3KVRA 2VUIB 1XELA 4IMRA 4BNHA 4FNMA 4D4MA 3V97A 1CU1A 1Q19A 2I6QA 4JLMA 3UZUA 4AJKA 4X61A 1NP7A 3EVAA 1Y4DE 3FUVA 4C30A 4MKHA 3OEWA 5K1ZA 2C9DA 5IJ9B 5C31A 2ZI7A 1QFMA 3WQSB 2RB5A 2O0LA 2BZ0A 4TUYB 1T6NA 3K1ZA 3ZTYA 1DKUA 3BDVA 2OV4A 2ZK7A 4ZQGA 3TOZA 4HRYA 5LM3A 5ALGA 1CQJA 3RVOA 4HNAB 1PZEA 2Q4EA 2CV2A 3IHTA 2JLUA 2VDPB 1GDHA 3M1YA 4N7BA 5CUQA 4EKEA 5F7JA 3NFYA 3RYIB 4TLLB 1E69A 3I6ZA 4B84A 1AE1A 4IGIA 3O92A 1KTVA 4CIYA 1AUQA 1ZAYA 4O3FA 2FUNB 3OIFA 3C4VA 3UPUA 5E9AA 4RTNA 4BVGA 1Y3HA 2XE6A 1VJGA 3IESA 1QP7A 2WYHA 4RMHA 8OHMA 2JJ1A 5F51A 3K1YA 5LDGA 1L7OA 2B83A 2HSJA 4AKHA 3NONA 2IF2A 3TKAA 2NXEA 4LOJA 5CFRA 3TZQA 1DI0A 1KDOA 4OI2A 3M4ZA 5KJEA 5ALDA 1YJCA 1PU2A 3FBTA 4M0FA 2A14A 3T7IA 2FAXA 4LG1A 5KOJB 1DTSA 1RWPA 3ZE8A 1PL6A 3ANMA 1TZ2A 1M34B 3N3AC 3OCUA 2CZQA 2IRWA 4B34A 2FPXA 2VPWA 3P0FA 4OXIA 2QSZA 3QMMA 2YV4A 1UAGA 4DPKA 1TDJA 5JQGF 2E49A 1K66A 2EW8A 1GUYA 4ITVA 1OIVA 1YZGA 3PFIA 4WOBA 2IZ5A 2ZBRA 3R9WA 1J21A 4XYBA 1T4DA 5HE8A 3H83A 3IC5A 4LOHA 3MRVA 1VPVA 2GUGA 3N0WA 3R7WB 5J4LA 1QOZA 2BHTA 1GAJA 1B0UA 2B25A 3RH0A 3BJZA 2AMLA 2WWWA 4MX8A 3WBBA 1D4AA 4M7OA 5JSFA 2P5YA 1EEXB 1KZGB 1Z7YA 4R1NA 2J59A 2WF7A 3HYNA 3QVTA 2B9VA 4LSMA 4P5EA 1ONBA 1VHJA 4Y6PA 2CLEB 1E3EA 3VVMA 4BMXA 4LPSA 3H4VA 1L4FA 1QTRA 4JK3A 1GVHA 1T4MA 3QRWA 5K3SA 1P4RA 3ELDA 2YXNA 5BV1A 3AR6A 1ZZEA 1WUYA 2Q2NA 3GLVA 3N7UA 1U4NA 1G7CA 3D6NB 5AVJA 1NUUA 3RSOA 1XQVA 2XTMA 3DL2A 3S7ZA 4P92A 2PGNA 4LYAA 1ST3A 4AI6A 2RI0A 1ZA2A 2C96A 1JP7A 4O33A 4EF4A 5K0SA 4JB0A 3F97A 2JRCA 4KRGA 3HJFA 4RS3A 4UM7A 1OLXB 3KDAA 4IDNA 1ZNZA 4U1RA 3H18A 4BKPA 5F23A 3VKFA 1OH8A 4RPLA 3GAAA 4RD2A 2F64A 3DMRA 5HQJA 4CM4B 1QB7A 3DW3X 5FV4A 2P2YA 3B9BA 1U4SA 1YJAA 4C0LA 3HBFA 1C1YA 1F8YA 3IAEA 3PDIA 5C7IO 4ZHQF 1TU3A 5FI3A 4CL3A 3X1ZA 1Z5GA 2SBTA 2XXJA 1DQYA 3OLWA 4EHDA 2D0OB 2QPTA 4MUHA 5EPEA 1Z45A 4L6IA 2EOAA 4EEKA 3E9CA 3EB9A 4A8HA 4WZBA 5CAEA 3M49A 4M7PA 3EVEA 2W8BB 1YA6A 1GG2A 1IIBA 1IWBB 1RI2A 2H8KA 2A5DA 3PUVA 4H6PA 4US2R 3L7BA 2DHEA 1YB2A 3UF0A 1U80A 2HQ1A 3MXTA 4RPIA 5EGNA 2R6ZA 2FUEA 3G0OA 1G60A 1JXQA 2J6IA 4V2UA 4D5GA 1W52X 2AB0A 4DQUA 4W63A 2VIIA 5AHKA 4MEAA 1NMQA 4W5OA 2XODA 3WWPA 1ZOLA 2IL1A 2I99A 2R2GA 5FLYA 1X42A 1DBSA 4MW7A 3FMFA 3HV0A 2OG1A 5EI5A 3WLJA 2FKNA 3R6LA 1B8PA 1DXQA 2GBPA 4HB3A 1ZM2A 4M38A 1HT2E 3FI9A 1A7UA 4ZOLF 2PRJA 4FHCA 2GPAA 2D5LA 3NC1C 3DL0A 2PJDA 5ILGA 1E2EA 2YWCA 3K96A 2OQ2A 2XQFA 4LJ5A 1PFKA 5ALRA 4OI1A 5TJHA 1AJEA 5DM70 3IQIX 3EVBA 2AJBA 1L7XA 1HE2A 2ZIEA 3IP7A 4YX9A 4C3OB 3ZNPA 4OHOA 2C3OA 3GVHA 4G0YA 3QHQA 2R97A 3P9CA 3KQNA 4EI2A 1WMDA 3UYKA 2P4SA 2WSIA 1Z6YA 3FN4A 4F9GA 3UWSA 3W4JA 2HWXA 1OFUX 1ZUWA 4Q4JB 4CM6A 4HWKA 5IYZA 4GI1A 3U3JA 3MOIA 4MIEA 2HX1A 4OO3A 2RH8A 5ER6A 3WJAA 3FOEC 4ARAA 4IHJB 3O1IC 2XAUA 2GNPA 4RPHA 2VOEA 3Q1KA 1U7UA 3EPRA 2V4UA 1G4UR 1YZNA 2ZE5A 1DLJA 1I9CA 1RWBA 3FB1A 4G67A 4N6NA 2KLHA 4MYUA 2CB9A 5KJ1A 3TGLA 3TVYA 1IBCA 1UK8A 4ERNA 5EXDA 4F0JA 2I8LA 4HH4A 3NM6B 1Q0SA 1Y5NA 1DKMA 5DN9A 4Z99A 4HHEA 4GOMD 5FWDA 3KZ1E 1QE0A 2QTVA 1RP1A 3AWDA 4OU5A 4B3IA 1OTHA 3B6MA 2II6A 3KRTA 4OA8A 2ONYA 3D7SA 2O2SA 3ZDCA 1NUTA 3GCDA 3KLBA 3GGCA 1A8QA 3BMCB 4H0NA 3I72A 3CRZA 2WJ6A 1CLUA 3NHLA 3WSVA 4WVLA 2EIHA 4X7MA 2KJQA 1VI2A 5E8RA 1DRWA 5BW6B 2GZDA 1ZCZA 2CK3D 1PLKA 3I9KA 1N2SA 2PYIA 1WMFA 2MSLA 2GARA 4AKEA 4E5PA 4JJEA 4JLDA 3OU2A 3K4QA 3ITKA 1UJ2A 3KEGA 3OE5A 2X7XA 4WXPA 4FI3F 5AI5A 5AW8A 1ZRMA 2G07A 1Z7WA 3M0EA 3DD5A 3F9IA 2QP3A 2JGMA 2DVMA 5KI6A 3HPQA 3WFZA 3TLYA 2PTHA 2IS4A 2XCOA 4H1VA 1T10A 5IT0A 1T0HB 3NJ8A 4DDMA 3PNOA 1XMXA 3B7PA 5IARA 2WAOA 4QFCA 2G67A 4M0DA 3B78A 4CM7A 1E7MA 1CUDA 4PQRA 3GB9A 1OBHA 1V7CA 3RLIA 2MYUA 1TU0A 4YUAA 2MSNA 1JQBA 2XMPA 3MELA 4HX2A 3NCHA 1Y5MA 4HAYA 4CKCA 2ZJOA 3RF6A 4ETIA 3EXAA 4A5SA 4DE5A 3VH4A 5BO5A 5YASA 2NTVA 3UAZA 2BFPA 2FPIB 5BR4A 3FOAA 2XCUA 3T12A 2HLHA 3I39X 2AX3A 3ZE1B 4BO4A 5CLLA 3WRVA 1M1YE 1E8MA 3NHAA 4RQBA 3UH1A 3PDUA 2AL7A 2V59A 3N2EA 4WDRA 2HHLA 3WYBA 3A14A 1NKSA 3ED5A 4ID3A 4NIMA 2IZ0A 3JQBA 2H85A 1NSFA 4WINA 3CRMA 2FEXA 3NYIA 3NMUF 1QHIA 5EMNA 3USES 2ID4A 3L4BA 1FIUA 4M3NA 4J3FA 1Q0LA 1XE3A 2FN7A 2PUHA 1EU1A 1AGPA 3Q6IA 3MYRA 4YB8A 5DNEA 5DNUA 1TT5A 3N8DA 3AR8A 4PG5A 1G5FA 3TLZA 2EBFX 4XXHA 3A1TA 4LOLA 3PFGA 4GQIA 5FOWA 3TTWA 4CMKA 2ZSAA 3L0IB 4X1KA 1C1XB 2CJWA 1QTIA 2P9ZA 1M54A 1TCBA 3IP6A 4OY3A 3KJNA 4HNGA 1EZ4A 2ZAGA 3WZMA 2HSZA 1OD6A 3I2IA 4DRXA 4QUIA 4ZREA 2GKSA 3N1UA 4DM4A 1KPIA 3RHTA 4BC1A 4MKIA 2Y99A 2QF7A 1N77A 3Q8MA 3WLRA 2DF8A 1PG2A 2IXBA 3HJRA 3TZBA 1Z0FA 4QBFA 2REOA 3TWOA <