3F49S

Anion-triggered engineered subtilisin subt_bacam
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
266
Chain Sequence
AKCVSYGVAQIKAPALHSQGYTGSNVKVAVLASGIDSSHPDLNVAGGASFVPSETNPFQDNNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQASWIINGIEWAIANNMDVINMSLGSPSGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPFSSVGPELDVMAPGVSICSTLPGGKYGALSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Subtilisin BPN
publication title Anion-triggered Engineered Subtilisin SUBT_BACAM
rcsb
source organism Bacillus amyloliquefaciens
total genus 91
structure length 266
sequence length 266
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3f49S00
3BX1A 5ARBA 4WOCA 1ZVKA 1GCIA 2ID8A 1NLUA 3I30X 3F7MA 1BH6A 1EA7A 3EDYA 3DE0X 1JEAA 1NDQA 2SICE 1V5IA 3H42B 2X8JA 3I34X 1TM3E 4NE9A 1PJ8A 4YN3A 2Z57A 2IXTA 3I2YX 2P4EA 3GT3A 2B6NA 2PYZA 2ST1A 1SUAA 5JXHA 1SUBA 3WQBA 1R0RE 1MEEA 1TK2A 2Z30A 5JXIA 1BJRE 4H6VA 3ZXYA 1PFGA 1T1EA 1HT3A 4NE7A 3BPSA 1TM1E 2PRKA 3DW1X 2Z58A 3LXUX 2W2MA 2ZRQA 4M1ZA 4CFYA 3TI9A 1P7VA 3DE7X 1Y34E 1Y33E 1R64A 2WUVA 1TMGE 1YJCA 5ARCA 4AKSA 4HVLA 3QMPA 2WWTA 1SIUA 2WV7A 3UNXA 1C9MA 3DWEX 2SNIE 4FONA 3DW3X 3VV3A 2XTJA 1LW6E 1THMA 4HX2A 2ZWOA 1TM7E 1GNSA 2HD4A 1EGQA 1P7WA 4H6WA 5FBZA 2SECE 1SUEA 2XRMA 1SCAA 4Z2AA 4GI3A 1AVTA 3VYVA 1ST3A 1SCBA 1Y48E 3GCWA 1P8JA 3DE3X 3A3OA 1V6CA 1XF1A 3SQOA 1S02A 1SPBS 3P5BA 1SH7A 3DE1X 1VSBA 5K7SA 2ID4A 2WUWE 1SCJA 1C9JA 3DYBA 3Q5GA 4KG7A 4ZARA 1SCNE 3TECE 4H6XA 1Y4DE 2PQ2A 3ZXXA 3SICE 5AVKA 1WVMA 5FFNA 4B5LA 1Y3FE 3QFHA 1IC6A 3OSZA 3GCXA 5B1DA 2PKCA 3LPCA 3WIVA 3DVSX 4WOBA 1WMDA 1AQNA 4JP8A 2X8JB 1AH2A 3GT4A 2W2NA 2Z56A 1WMFA 1Y9ZA 5CW1A 2PMWB 3DE5X 3L1KA 1A2QA 2SBTA 1SELA 3DE6X 3BGOS 2W2PA 3LPDA 3DVRX 3VSBA 1BE6A 2G4VA 1SBTA 1SBIA 4CG0A 1C9NA 3D9QX 5I9SA 1GT91 1KDVA 1T1IA 3F7OA 2HPZA 2ZWPA 4KB5A 4AKTA 3Q40A 4J94A 2W2OA 1OYOA 2TECE 1SCDA 1Y3CE 2PWAA 1GA1A 4NMXB 3WHIA 5JXGA 4DWWA 1GTG1 1C3LA 1Y3DE 1TO1E 2Z2ZA 1KDZA 4OMCA 1SIOA 5ARDA 1SVNA 3VV2A 5AQEA 2DP4E 4LVOA 1SUPA 5JMOA 1WMEA 1KDYA 3TI7A 5SICE 2Z2XA 1BE8A 4OMDA 3DE2X 3D43A 1S2NA 2Z2YA 1KE2A 1MPTA 1ZVJA 4ZOQI 3HJRA 1GTL1 3QTLA 3AJ9A 2GKOA 1OYVA 1SUCA 1SN7A 1WSDA 3I37X 1ST2A 1TECE 1DUIA 3DE4X 2V8BA 1GA4A 3A3PA 3F49S 3PRKE 4C3VA 1YJAA 3EE6A 2DQKA 1DBIA 1T1GA 3WIUA 3CO0S 1OT5A 1SBHA 4KPGA 1SBCA 2QTWB 3A3NA 3PTLA 1KE1A 1AU9A 2IY9A 1CNMA 1YJBA 4RYDA 3DVQX 1BFKA 1Y1KE 5AMXA 1CSEE 4K8RB 5JXJA 1Q5PA 1SBNE 1S01A 3EIFA 1NDUA 3CNQS 3AFGA 1IAVA 1R6VA 2PWBA 2W2QA 1GTJ1 1Y3BE 1GNVA 1BFUA 4C3UA 3DDZX 1AF4A 5FAXA 5B1EA 1UBNA 1TM4E 1AV7A 3VHQA 3T41A 3LPAA 4I0WB 4LVNA 1SUDA 1PEKE 4MZDA 1GA6A 3VTAA 2DUJA 4DJ5X 1YU6A 1SIBE 1TO2E 1TM5E 4OV6B 1PTKA 1AK9A 5AVJA 3AJ8A 4DZTA 4BWGA 4CFZA 1Y4AE 2E1PA
chains in the Genus database with same CATH superfamily
3SF8A 1IMJA 2I7TA 5ARBA 2WWVD 1QE5A 1G63A 4WOCA 4Y2SA 1NG9A 1JFTA 4L3OA 5C53B 3MUEA 1KZ1A 5HNKA 5IKEA 1ENYA 3RTAA 2QWXA 4G1UC 1W88A 2RKBA 4KDRA 4LMAA 1UPXA 4MV4A 3VSAA 3WLJA 3UMVA 4PHFA 3S2SA 1PW5A 1KH3A 3D3WA 2CDRA 4ZJPA 4D56A 4NXNB 4PONA 1K6MA 1I2MA 2G83A 4UUBA 3F5MA 3A3KA 3B7GA 2X0IA 3GXOA 2VG8A 2Z5VA 1O6CA 2WKPA 1JEAA 4G25A 4MYRA 1H8ED 2PYIA 4IH9A 3O47A 5DHFA 1C8KA 1GYQA 2CYCA 1X0VA 3BMXA 3LQKA 3WBJA 1R8XA 1ZW1A 2B21A 3O2QB 3BMQB 4YFVA 1E3MA 1LQUA 3H9QA 1SXIA 1F5NA 1WOYA 1R0WA 1L5HA 4URUR 1M0SA 3MGKA 1P1FA 2N42A 2WJGA 1I14A 1JKJA 4HMOA 3ABRB 2B4QA 2X0JA 1ORVA 4B0OA 1UXIA 3LPLA 2QDKA 4QODA 3QU2A 1I1QB 1YIAA 5EG5A 2XADA 4YMIA 3HYNA 5KVAA 2PK3A 3N2ZB 4JQSA 4MLZA 2CVOA 3DOIA 5AUNB 3I28A 3DO8A 3VH2A 3HWWA 1SVIA 2DR2A 2WICA 3QPDA 2FAXA 3VR1A 1WPQA 2WT4A 3I8OA 4AUKA 4CTJA 4D9KA 4HNVA 5K3FB 5I7UA 1H94A 4DTIA 2Z30A 4I9NA 3DZ8A 2HU7A 4PZ9A 3P0EA 2CVHA 1TZMA 2OHFA 4I2NA 4RK4A 2BBSA 1QBGA 1EJBA 2I3GA 2O2HA 2HCRA 5LL6P 2EWMA 2C2YA 1LFAA 5EYPA 5COAA 2QTVA 3ZD6A 1GPJA 3TZCA 1SA0A 1NX9A 1VIDA 3H5NA 1XC7A 5T6MA 3JYPA 1RC1A 1P75A 1V3QE 1BS1A 1VJDA 2DF8A 5DK4A 3K1AA 2C5SA 2AFIB 4NEGA 4AX8A 3M4NA 4IOJA 1FFXB 1BWRA 1HOTA 3O38A 3UTCA 2QBYA 3LLMA 4P4NA 4MUYA 3AIOA 1JHVA 5IDXA 1CZUA 2AJCA 2ZJ5A 3U81A 3U4QA 2HEGA 3G89A 1TM1E 1ISHA 1W5EA 2OBMA 4I2VA 3WP0A 1KYWA 2XWSA 1CHNA 1VIYA 3V5NA 4IIUA 3ZGLA 3I2JA 3UMMA 1KMQA 5H9VA 2BOVA 4L8GA 2IX9A 5EMLA 1HFWA 4DE5A 4DN6A 5J43A 4D82A 1LPBB 2I91A 1YDGA 2ECFA 3DL7A 4X41A 4ZO6A 4EVQA 2VJMB 1QWSA 5FL7A 2WYIA 1Q7TA 4IJWA 4Q66C 2DPLA 1FOEB 2YHUA 1DUVG 4EFNA 2PUDA 3WDSA 2W8ZA 1LK0A 1YULA 1OVMA 3HVJA 2PGOA 2R85A 4ZAYA 1BVHA 2ONYA 5EKXA 2FRDC 2I5PO 4Q00A 3CWCA 1UPFA 5EE5B 2Z43A 3M4XA 1R27A 2GYWA 2AFHE 4GPD1 4A6DA 3H97A 2GZ2A 2XGGA 4R7ZA 1J07A 3PGA1 3IXQA 4FCVA 2JA1A 4MQFB 4PAOA 4LDRA 1UODA 3ZD7A 2Q0QA 1UP4A 1C9MA 2COUA 2YTZA 2Z5LA 3CZRA 3HC7A 4QPDA 4J9VA 5KBYA 3OOWA 4C0WA 4QA9A 3STTA 3RS0A 5FOSA 5HBGA 2H2AA 4HDAA 2J5BA 2PD4A 2GJ9A 5C5IA 4B74A 1BDHA 1TT5B 1A69A 3COZA 3ZH9B 2ZJOA 5K4GA 4IJMA 1DINA 4WPGA 1PFQA 5DLEA 1H8HD 4HX2A 3U48A 3WE7A 3WS7A 1KTIA 2C7PA 3RSOA 1EHCA 2QAGC 2ZWOA 3IJPA 4UTOA 5TQ0A 2HD4A 2GZ3A 4BO5A 1RSZA 1I80A 2YWBA 4P2GA 5TPZD 4C4XA 3T38A 5BN4A 4MPJA 4CT5A 3F6RA 4D41A 2VCYA 1YS6A 4JLPA 2A57A 1GFSA 1CUXA 4IHQA 3T5CA 5EJFA 3BGSA 3C6ZA 4NOMA 1UP6A 3IUYA 3BORA 1DO0A 3PYMA 3VR4A 3TVTA 1C2TA 4OGGA 3ANYB 1YTUA 1ESMA 1HE1C 4CR6A 2NT3A 2QF7A 2PU5A 2WOJA 3GCWA 1KDRA 2BTEA 5DNAA 1CR4A 1W0KA 4D9IA 1QPBA 4K8OA 5SY6A 4YNBA 1MQ9A 3PHJA 1C1XB 4B2IA 4BVKA 2VJBA 4DJDC 2FJUA 4DG5A 5TR9A 2WDZA 3OE4A 3VH3A 4L9AA 3WJAA 2XIJA 4W8GA 4RVSA 4CM1A 3ZI4A 3MRSA 4YT4A 3S1SA 3DTTA 3AETB 4OHBA 5AVOA 3K0SA 3RAFC 4D0LB 1I13A 1J0AA 1LI5A 1YZGA 4JJIA 4V0LA 3UFXB 3E35A 4A0RA 3HK2A 5A71A 1LJLA 2OLJA 4Q21A 4ZCMA 5K8UA 1KK0A 4Q0MA 2ZIXB 2CMHA 2WB2A 1C7IA 1YAJA 4JUBA 3SAJA 3NFYA 5K3OA 4TT3D 4RZXA 1N9GB 4PY2A 1TB4A 1WW3A 2YHBA 2LW7A 4IOMA 5FV7A 3SKYA 1G1MA 2IF0A 4Y2JA 3TXXA 4ARUA 5B7NA 1QQ6A 5CUQA 1TGYA 4PHCA 2V65A 3QLEA 2GERA 1F9AA 1VG9B 2C92A 2IUSA 4G4IA 2FWPA 3CVOA 3RO7A 3KXPA 1RDFA 2XUGA 2ATCA 2ES4A 5EIXA 1JH9A 3AVYA 3V8BA 1NW8A 5TF0A 1QF9A 4IEIA 1CFZA 4OB6A 4BB5A 4V1CI 2WYHA 1RW4A 1W7AA 3FJOA 3OPYA 4XFJA 5KTNA 3KSDO 1OTXA 1IJFA 1YGYA 2A5FA 1PKEA 4PZCA 2JK1A 3OHPA 1N36B 3SIRA 4ARCA 2QVGA 5AKYA 3DHYA 4XFDA 4QKQA 1B8VA 4J0CA 4WCDA 2I2DA 4GMDA 4MW0A 4QOHA 5CBPB 2HSZA 4HWSA 1JFRA 4YRCA 4BHTA 4D0RA 2OC4A 4A82A 4DRXB 5AQ1A 4EECA 1LXCA 4GM0A 2EAUA 3LXRA 2FJPA 1U4OA 4QREA 3CRMA 4M2LA 4ERNA 1M1NA 3F4BA 5D3ZA 4TLLB 4DC1A 1DAFA 3V1NA 4PLYA 1XVAA 5JECA 4YJHA 3F0TA 3IVXA 1QIJA 1KDOA 2F3PA 3E9QA 3KPJA 1BMFD 4QYIB 1X1AA 4ZOCA 4EY6A 4F3YA 3I39X 1QB7A 2CLEB 1Q92A 2IRWA 2OCLA 1RQPA 3GG2A 4HFRA 4K1XA 5CRIA 5DWVA 1Z13A 1FRVA 4ZVKA 1K27A 2YC2C 2QVBA 4JP1A 3T5GA 4Y7CA 5E0KB 1JXQA 4LRSB 3USES 5H9WA 2WWYA 2DY0A 2P67A 4WK6A 1TGVA 4MR7A 2BGUA 5EHNA 1JQAA 4OLBA 1CUIA 4MB2A 3S8MA 5JJLA 2CDAA 2V7TA 4UD2A 1RLUA 1O9BA 2AHRA 2HB6A 3M6WA 1PL6A 3GPBA 5EJIA 5JVDA 3R8FA 1T4BA 1IN5A 2YOHA 1T2UA 3HKDA 1Z5NA 3L1KA 2WE8A 5EGSA 2GEVA 3X3HA 3FX2A 2QNIA 3GQBB 2Z4TA 2ZJ0A 4G63A 5FCDA 5FRDA 5IMBA 1G4AE 4EGSA 3GUHA 2FPIB 3EXIA 4XUGB 5A1TA 2C07A 4PZLA 3UK1A 4LF8B 3PQDA 3USZA 4DQVA 3MIIA 3BULA 4MS3A 3BA1A 3D8RA 3UWOA 4OHMA 3CUWA 5JO0A 2IFTA 4YGYA 2WD7A 1IYZA 4UJ5A 1T13A 5CYPA 3GRKA 3Q3HA 1SUFA 1SAYA 1B0PA 2HA3A 3EEIA 4JP3A 3IPCA 4AMUA 4OUDB 2Y1KA 1G41A 3CISA 4P80A 3QNWA 3AOGA 3GJSA 4F4CA 3C3PA 1AO3A 5ESWA 3FYHA 5CCDA 3NVAA 1R7RA 1XZPA 3IAAA 5BRAA 1SQGA 4JQYA 4OX9Y 3I72A 4U02A 1RCUA 1P8AA 3KWFA 1PK8A 3OQIB 4O0LA 1U94A 2WF6A 3KWJA 4RELA 2ZT8A 3ADBA 1SULA 1JPJA 2HDHA 2WSMA 3PIIA 1D7AA 4GI2A 5E38A 3S29A 1NIJA 4BQQA 5AUOB 2W2OA 1QRAA 2H11A 4OI2A 2IOFA 4N39A 5T67A 2Z8YA 3O94A 4P81A 4I66A 2ZRIA 5AVSA 2A1TR 2QYTA 2ZJYA 2QIPA 2PWAA 2O0KA 2YV5A 2HNBA 3RVNA 2MR5A 1RLIA 2R4UA 2XUQA 1IEXA 2ZATA 1M34E 1TA0A 2Y0EA 3G0GA 2YHIA 4FT2A 4ZT4A 3E4DA 1MPXA 1UADA 3DTVB 1KF0A 1SKQA 5B6PA 3RVDA 1C3LA 5JAPA 2VEOA 5G40A 3STWA 2J6IA 3SC6A 3UWKA 4FFWA 1KZGB 5JD5A 5AKLA 1YB6A 1XAGA 2HFJA 5I7WA 4ZYXA 4Z4EA 4GMGA 4G4JA 2HF2A 3B8EA 4UM8B 5I4KA 3GLHA 3JALA 1MCZA 1BTOA 2MTBA 5T4HA 4GYJA 4JJ6A 4K2AA 3GBVA 3OUTA 1D2CA 1D8TA 1QCZA 2OAGA 4NLLA 3PXUA 4Q9AA 1QMPA 1S96A 5EEHA 1TTQB 1A50B 1AK2A 4H7IA 4NHEA 4BLTA 1I1HA 4FS8A 3LHSA 4FYYA 4LRUA 4WADA 4E3WA 4QJBA 3NH6A 4TQ9A 1N7HA 3WNQA 1DX9A 5MGNA 3D2LA 3W7AA 5DNUA 5CLLA 2HXSA 4BRUA 3KJNA 5JMOA 4UUAA 1X2BA 721PA 1CULC 4I5FA 1KZ6A 2X40A 3G2NA 4RYLA 1JZQA 4JI3B 1B76A 5JC8A 4A0QA 2B7BA 3W6PA 1NUAA 3T06B 4FFDA 2IY8A 4JN6B 3BE6A 1T9ZA 3CF4A 1F6DA 2PX4A 2VYVD 4IGIA 1N6OA 1T6ZA 2NZXA 1V37A 2OV1A 2P69A 4IDQA 4O1IA 4E2ZA 4F84A 1DKPA 2EGGA 3H8WA 3TNDA 1FFDA 3U2QA 4FGSA 4B4VA 4CEIA 2X3UA 2YXPX 1E3EA 4YJGB 5EIWA 2WVGA 3P1JA 4B3DA 2RHHA 5C8ZA 5EERA 1OBHA 1IDOA 1XYVA 1ZA1A 4LXXA 4KQ6A 2EW2A 2Q4EA 3L40A 4MGZR 3RU2A 4OG2A 4C6SA 4YRMA 3PNMA 1A7AA 4KPUA 1T35A 1ST2A 1ZRSA 2P30A 3H1FA 4A23A 4P0QB 2OZEA 3LBFA 4PLGA 1YDHA 4NCBA 3DE4X 3W5IA 5DXAA 2D1RA 5C7LO 4X1YA 4J4BA 4HWKA 3ZU6A 2WTMA 3R5XA 1PFKA 3N2IA 2CL6X 2I4TA 3RK0A 1XAHA 2GHQA 2IDMA 3G8BA 3ID6C 5TGDA 3E1GA 5EIAA 4MVJD 3BJEA 1RBQA 1NBMD 4EW6A 2NO1A 3ZHRA 2XTZA 3L8ZA 3ROPA 2QQFA 2X9QA 2ZJ3A 4Q93A 3ZY2A 2I7XA 2ISSD 2PFSA 4EJ0A 2I9PA 4UE3S 4BBAA 1LSSA 1B1AA 2YVKA 5B7QA 2A3RA 4DTCA 1RWOA 3IQHX 1XI2A 5KNBA 2AOTA 3T5AA 2MWMA 3A1NA 3U0BA 3C3YA 3ZUGA 4U9UA 4I55B 2ZUTA 1YS1X 4N9QA 3ROTA 4JR0A 3K2QA 3X1ZA 4LX0A 3DLHA 1LQTA 4RSMA 1N3YA 2B8TA 1P1KA 3PC3A 4UHDA 2YYZA 1N2CE 2J31A 5EE9A 3NX4A 1PV1A 2GEUA 4A15A 1T2CA 1EINA 3BXOA 3LP6A 5IAEA 1HYGA 4FYVA 2W43A 3ZE6A 4EUKA 1LDMA 2WTEA 2A1IA 3N2KB 3I0MA 1H6DA 4WCFB 3EVGA 1E2GA 1E7SA 1ZD1A 4KWEA 4UVDA 2GEKA 4BCCA 4I1PA 5A4KA 1WZUA 4FFBB 4TV8F 3AH8A 1OZFA 1S3GA 5EXDA 1K06A 3S4YA 1S01A 6AT1A 3PC8C 3PFFA 4MVJG 4LJRA 2ODPA 1RYMA 2XCRB 1NDUA 2BHLA 5DGXA 3I5AA 1D2AA 3IE0A 1SHUX 2VHWA 1K7CA 1E2FA 4KTTE 4V1CB 3OX1A 3W5AA 4J16C 2PWBA 3OKPA 2N1MA 1QFYA 4BVHA 5AVWA 2ZWAA 1QSGA 4OF4A 1YUNA 3E7WA 4HX9A 3T7KA 2EFGA 3R3VA 2RAUA 4P3YA 3D7LA 3GI1A 2O5CA 1U3UA 3UV6A 1MZPA 1ICEA 1W73A 2OV8A 2GD0A 4B87A 5MFPA 3EUAA 3C16C 2XE6A 4A03A 3IAHA 1M2JA 1RPAA 3ZXIA 2NQTA 4TWIA 4DBVO 1AMUA 1BHO1 4CF4A 1KQOA 3FHLA 1A72A 1C7JA 4MWCA 4DDTA 2G9VA 3MSCA 1AC5A 3NM5A 4WXEA 3AYZB 5K1ZA 5JH7A 1P3JA 2YNMA 3C5VA 5FBWB 4GX5A 4U7HA 5GMOA 3PFHA 3GN2A 3D8UA 3ANTA 4LTMA 4NBNA 1O77A 3K0BA 5ALYA 2ZJ4A 3TTSA 1V1RA 2D62A 2P90A 4XUDA 4YECA 3DMPA 3ORSA 4H1UA 4UNRA 3PHGA 2VHZA 2C54A 3KVYA 6CHYA 2J3DA 4RETA 1GITA 5KU7A 1M2FA 3GNTA 4IQ8A 4S24A 1KA9H 5NLLA 4WFQA 4LK2A 3CLTD 1N5JA 2WWGA 3D3JA 4RLFA 2VHTA 3D6JA 3QEKA 3ZG6A 4PS0A 3K0FA 1WMSA 3Q12A 1T0PA 3DVLA 3REOA 3WNDA 3NJRA 4OXXA 2ID7A 4X97A 1T8WA 3BJZA 2HQ1A 3ESYA 5L3ZA 4B1FA 5AKEA 1G19A 4IGEA 4PF1A 1QUEA 2J1LA 5HF6A 5JNWA 2FPLA 3K0CC 5DHQA 2DEUA 4JLDA 1MB0A 1NI4A 5CM9C 2L19A 3PG5A 4GLOA 3QEMB 3TX2A 5HKBA 1VL8A 1M2EA 3SC3A 1VSQA 1LV8A 1RAGA 3JVEA 1RVDA 2BI8A 1SBYA 2WU0A 4IW3B 3H05A 2VT7A 4BVLA 1SC1A 4RHFA 2XE4A 4IV5A 4O59O 2DC1A 2H06A 2JIPA 5HF9A 1RT9A 3BX1A 4FYWA 3QLTA 4EY7A 1LS1A 3KIPA 5HF5A 4C4ZA 1YBMA 4ZAGA 3R7WA 5G0UA 4XCXA 3BH7A 1Y98A 5HZKA 1LTHR 4BJHB 2PA3A 3P2JA 1BH6A 1ARZA 2QNRA 5DM70 4XUCA 1OBOA 1ZGGA 2QK4A 3QEOA 5FUXA 5KYXB 5EINA 1LBIA 4Y8VA 3A9UA 4P34A 4MI3A 2Y1GA 4S1WA 3H42B 3KP1A 5EI5A 3TLGB 2J9ZB 3AR3A 3INGA 3LYHA 1ZU5A 4KVZA 3CLTC 5AM0A 2WY2D 3TQHA 1LRKA 2JIOA 4ZOAA 1OBVA 1I10A 4GYYA 4IG4A 4R1SA 2GZAA 4G85A 2XTNA 4YN3A 2A88A 1L2TA 4LVUA 4EG4A 2UZ4A 1ZRHA 3DMFA 3F5QA 3UCEA 3ZGYA 4QNMA 1E62A 1IM8A 1XAIA 4YAOA 1VXRA 3A70A 1Y8AA 1ATZA 2JBAB 1IQRA 4JVSB 1JTEA 1P5HA 2O7RA 2Y93A 3NAZA 4OK5A 3TOVA 4BQFA 3M34A 3OH8A 4UHEA 3UHOA 3VPCA 1V39A 3H2YA 4DCUA 1Y3IA 5LZ5A 2O8EB 4M53A 4B34A 1EVIA 4CV0A 3QPAA 1X77A 3L8YA 3PL1A 3DOCA 1NI5A 3PK0A 5DRYA 3WDMA 2CHVA 1EP9A 1H2EA 3QYJA 3P2YA 4EG6A 1LD3A 2LE0A 2UYCA 3HJAA 1YNOA 4BO8A 4RY2A 2ENUA 5DTMA 5KYYB 2ZBEA 1W96A 1EK5A 2YJ6A 3CNHA 3K32A 2RHGB 1I6MA 2H54A 1KMHB 2RMKA 2QPLA 3IE1A 5JSYA 4QTYA 2QLNA 4IZOA 4JU8A 4JUCA 5LP6A 1S2IA 1HT3A 2HO5A 2JI8A 2VRWA 4ND1A 5D5HA 3TIXB 3VDNB 1GO2A 4GZMA 1IU9A 4EEXA 1WRBA 5JOQA 4J43A 4P0PB 2AE2A 4HAYA 4PNHA 1ZWKA 4UHBA 2PH5A 5CT9A 1Y6FA 3DW1X 5FO1A 2C7OA 1ZMTA 1NFQA 4ZO7A 1CY2A 1II0A 4KAJA 3ROKA 1EDOA 2CHFA 4LDJA 3GJZA 1E2MA 2HXYA 5IUNC 4HN2A 3GUCA 2IQ5A 5JRDS 2I71A 1UXOA 4JOBA 3SR3A 3T1YB 4R1MA 1M0EA 1YVRA 2AFVA 5JYDA 3KJHA 3GRAA 3LUCA 1CJVC 4OI1A 1M10A 2DKNA 2VCHA 1V1JA 2A33A 1VBFA 1V45E 3TOSA 1FFYA 3CT4A 4PZDA 5ARCA 2PT9A 3L84A 3LOQA 2QUAA 3AUFA 2H7XA 3IBYA 4DLSA 3KSBC 2CLKB 1I3CA 2CMFA 3F1KA 3WGVA 2WHPB 4HGNA 2R7NA 4LDQA 4AY4A 4YRNA 4CLOA 3T5PA 2CT8A 3AKEA 1SKBA 4AN4A 3D5QA 3E70C 4HI0E 3PITA 2AE1A 5INTA 1QHFA 3T7DA 1QP8A 2WNSA 3JAKA 1L5QA 2ZRAA 3L7YA 3R41A 5KI6A 2OHXA 4CI0B 5F78A 3BTVA 2HDWA 3DT6A 3HDGA 4ARBA 5TGTA 4P3XA 4REQA 1NQTA 1IHUA 3W5JA 2DZDA 3SS7X 5IXJA 1YCDA 3N05A 5KWVA 1XMVA 1OW3B 3QKSB 1PLJA 3DBLA 9MHTA 2FXIA 1EGVB 1L7VC 3CF0A 1X1SA 2D4HA 4IS2A 4KYTA 4YJ3F 4UUPA 5DNDA 5IT5A 3P20A 3C8UA 1VLJA 1CPYA 1H5UA 1CHDA 2JI6A 2F6RA 2LCFA 5G4KB 4ZZ2A 3HCBA 2B78A 1NJ8A 1Y5RA 4KFTA 4F8EA 3M6VA 4H6WA 3BF8A 4Y2UA 2BAGA 2VL7A 4BU0A 5BQXA 3NOQA 4GKJB 3SS9X 1JH8A 2OUKA 4DDVA 3UOAB 1VHDA 3QYFA 5ALUA 2VAVA 1ZK1A 1XMQB 1M67A 2XRMA 1FYDA 4IWXA 4MP3A 3UB3A 3AOEA 1USKA 1Z5UA 2PY6A 1WHTB 4FN4A 1K6XA 4JBLA 2OFOA 4IILA 1A76A 2IKSA 3NOOA 3UMCA 3GRRA 3IB3A 1CLUA 4LN1A 3PYXA 1CK4A 3G2IA 2B7LA 3VOAA 3HDJA 4E13A 1DTWB 2RGCA 4ZOLB 3IUSA 3N8GA 4FHEA 4BVEA 2JHPA 4EVRA 4X24A 2QUIA 2GD1O 1XU4A 2AR7A 1TPYA 3DONA 1PEAA 3AU8A 4FBLA 3VTFA 3LC0A 4L4YA 1KJNA 1YCGA 2D0DA 1J20A 2FXVA 3SEAA 4EWLA 3SHTA 4DEXA 4YHHB 3OE7D 2GA9A 2JCYA 1IRXA 1P80A 3DE1X 3MN1A 3N74A 3HJTA 3OQ1A 4DAOA 4GXQA 3IPLA 4O0MA 4EI9A 4AY2A 5BW8A 4TKLA 1UCFA 3B89A 1HT0A 1PJZA 1Z3CA 2XQVA 3KQPA 4JL5A 1CIVA 4RE5A 2VKTA 4KQKA 5E2AA 4K6GA 3R9XA 2G1KA 2ZYWX 3OQVA 1PT7A 5CD9A 3ROFA 3F6BX 3EIEA 3LNTA 4OP3A 3ODPA 1U0LA 4IEEA 1YRWA 2Z6UA 5K05A 2ZTUA 3C3JA 1W6RA 3CRNA 1UJ5A 2ZTSA 2ILTA 2X5NA 3K2BA 3PKJA 1RQLA 3CKMA 3QE4A 2FN8A 4EO9A 1J99A 2PWPA 1N33B 3HGMA 1HF3A 3Q7SA 1EVJA 1I7PA 2FQXA 4HAUA 3CNOA 4PQEA 4UDYX 4F9EA 4OIMA 4BFXA 1H1DA 3A1CA 4LHYA 2AJDA 3O92A 1BWSA 2Q1SA 5CX1B 3BIFA 2V45A 2W2LA 4RDHA 2QT1A 3ZEAA 3VISA 4DQKA 2UVPB 1R5OA 2PHZA 3BSFA 3UJ6A 4MHTA 2MDTA 3W6UA 1U9YA 5HZGA 1OZ0A 2FJ0A 3STVA 3RSZA 3MJRA 4YPOA 1Z2NX 5A6VA 4NF2A 5G3YA 3Q6NA 5AI8A 5AK5A 2ZB2A 3TJRA 3OBBA 4OJKA 3V4SA 3OSZA 3BQNB 5B1DA 1I2CA 4CMKA 2C4TA 1E9DA 4E21A 4M7OA 1EEXB 2IBMA 3ESZA 4P92A 1W9MA 3O9VA 4XARA 4BX0A 3B9RA 2JZCA 4FYIA 4OAPA 4JP8A 4XB2A 4CQMA 3DHVA 1US8B 3F3KA 2Q4DA 2IW3A 2CC2A 1JR2A 4LQ4A 1KMNA 1NJSA 4OKSA 4LPKA 1G9TA 3REQB 4BDSA 5SYAA 1P1RA 1XDBA 3PL5A 3SX2A 5KTOA 1X7ZA 1Z5WA 1LDNA 2VK8A 2WOOA 1ZOSA 2Z98A 3EGCA 1R0ZA 1T9CA 2G9RA 1NP3A 2QUHA 3O3MB 5LOVB 1ULTA 1L8AA 1P2GA 2XY4A 2BF7A 1HTWA 4LCEA 5AKXA 3GJTA 1F12A 4ENSA 1ATIA 1I2AA 1MIOA 2JFFA 2I7DA 1ZBQA 2BT4A 1YRLA 4IL5A 3ASVA 5HEKA 3BN3A 1JUDA 2ZR7A 5LZ7A 3IVRA 2XUJA 1FDVA 3IIJA 4Q24A 5DW3A 1ID8A 1S2OA 4A9AA 4DXHA 2A5LA 1ZESA 4RV5A 5KYTA 3LBAA 2VATA 4UTRA 1RKXA 1U04A 4XGRA 2C4MA 3GLKA 3NHRA 3QG1A 1P0IA 1H42A 4KEAA 4ZCSA 1N2HA 3MYYA 3OIUA 4Z3KA 3EY9A 5KTTA 1G38A 1H3FA 1NUUA 4WECA 3GEHA 2X8WA 3KQWA 1RHJA 3MCZA 4JC4A 2FE1A 5DM0A 3ZZUA 1Y1PA 4FQ7A 3MBOA 1JIKA 9ABPA 3RC8A 3D0KA 3FMOB 5KQRA 3UG6A 4DQ0A 5CB6A 1MO5A 5NULA 3FZYA 3C2QA 1G3IA 4QNRA 4ZC8A 2C84A 3A27A 4YQEA 5L4NA 3NGMA 3I5XA 3AONB 1EXDA 3HXKA 3IJEB 1ZH8A 4RH3A 1I6WA 2O2XA 3DV9A 2TECE 2ZBPA 2JI7A 3WNCA 1M5TA 5I4CA 1YR2A 2AFHA 3F7TA 3LAWA 4J7UA 4RK5A 4KOEC 5HX7A 1BOOA 1NPDA 4PO9A 5AUPB 1XRSB 3MUFA 4BEWA 1DEXA 5FR1A 1LPAB 1JPVA 1OFIA 3LUJA 4IUDS 2IWRA 1R2QA 1YB4A 1K5PA 3RT1A 4IEFB 4MAMA 3TZQA 4C6TA 1B0UA 2UZ1B 1RKQA 4NYIQ 3ZX4A 3NBAA 3L8HA 1JJFA 1DKUA 1NULA 2AYYA 2WJJA 4LJAA 4OBEA 3ZQKA 4TYPA 5A0VA 1G8HA 1Q0LA 3WLSA 2XKBA 3T3NA 5DWQA 4C5CA 1X8LA 1EAMA 1GQQA 2HTFA 1KDZA 1NVUQ 1L7DA 2FP4A 1G3QA 5BYKA 2D5CA 2HGSA 3RFXA 2J3EA 3PDCA 5ARDA 1XUOA 2FYTA 2DERA 3DBVO 4DEYA 3TDNA 3I8XA 5AK6A 1A7UA 1AQYA 5IKOA 3QJYA 3VDRA 5HRAA 5IANA 4HEQA 2D00A 4U2DA 4MWGA 5E2IA 1EHIA 3UJBA 1ZBDA 1VKJA 1ZAKA 2H9AA 1KI1A 1HQCA 3DJYA 3D6TB 3PGKA 1WMEA 3L8DA 2C3YA 4HQNA 4X1IA 3ET4A 1XPOA 3O3OB 4XX0B 5L3QA 2VHYA 521PA 1ECFA 1ZIPA 2VNJA 4RSHA 4H3HB 1TU0A 3KE9A 5AI0A 4ZYTA 2HSWA 2HMUA 3SX4A 2LWIA 2H2FA 4EHKA 1F0NA 4LWQA 1XZNA 1V8OA 1X92A 3SSAA 4EI7A 1R0XA 3AL2A 4IGFA 2IIPA 2XNHA 4CN8A 1FRNA 4JYBA 3A10A 3DAYA 1IY2A 1AS0A 1L1QA 4NQZA 4Z49A 5JZBA 5EKUA 1BWPA 2M2IA 2O0JA 1MPTA 3UOWA 1TF5A 3QOXA 2SCUA 3NWJA 4PGFA 1IHPA 3LT2A 2WDPA 3KAJA 5EFZA 1JL3A 4AX4A 4L0MA 5HF8A 5KDDA 4PZAA 2OBXA 2XQKA 4HXYA 4YCJA 4U5QA 4G5YA 4D6YA 3T3MB 2F1OA 3V32A 1P17A 1DC8A 3E7FA 1GA4A 1RRGA 1V0JA 2A0FA 3HJNA 3OKCA 4PXAA 2VSYA 4R05A 4DA7A 4UDNA 3DZKA 2ZB4A 3N87A 1ZUIA 3ZKWB 3WL5A 3H5RA 3ZTWA 1EFVA 2VA9A 4NS4A 2AL7A 4CLXA 3A25A 3CE6A 2GB4A 2D5BA 2IZ1A 1G8SA 4KHZA 3RU3A 4AFNA 3DCIA 1GSOA 4PCAA 5LYJB 1C8VB 3D6FA 3OC6A 1B7GO 1RQNA 1YBVA 3AEZA 3NWEA 3OQOA 2C9YA 4J4HA 1C0IA 2RGWA 1ZM4A 4LJKA 1QKIA 3JASB 3NYRA 4EHLA 1TF7A 3C43A 3A4LA 2ZSJA 1N92A 4FVTA 3TOCA 3G88A 1K63A 3ENWA 3EWNA 4BJ6A 4DREA 3NHKA 3HDVA 5KQLA 1ZK2A 4RW0A 3QA3E 4O3MA 3WFZA 4ZMSA 1UJCA 5CCXA 3B1ZA 2JW5A 4YP7A 4W5OA 2J0EA 2E55A 2YWDA 1D2NA 1L4KA 1J21A 4MJ3A 2ZTHA 1WOMA 1V5GA 2AG5A 3VR3A 2XHZA 3ORRA 1KP2A 1ACJA 3RTBA 2AJ8A 3W1WA 2EHJA 3NHJA 4IG9A 4AG6A 1MX3A 3V7YA 3WLMA 3O73A 2GEDA 2IELA 4G3XA 1EM6A 1JA9A 1RHRA 5JXJA 3RUDA 4QYWA 3JWEA 1ORWA 4FX2A 2R6CA 4V3CA 3S8EA 2VI5A 4G1FA 2ONJA 4D46A 1CUVA 1IZ7A 1U5AA 1GU0A 1YA4A 3A1EA 2FR8A 3AW8A 4DLUA 2W2QA 3DZIA 3FY4A 2PD3A 1Q19A 1H05A 1XXHB 2P2YA 1ENOA 4KYVA 4ZAFA 3LZCA 2V6MA 1U8AA 5CA0A 1T2VA 4L3VA 5DI3B 3I9NA 4XVRA 5HA5A 1XQYA 4ZPXA 5J58A 5MN4A 2O8FB 1DAMA 1NJ6A 2PLFA 4ZEWA 2CXNA 3SJ7A 2O8DA 1QUFA 5AVTA 5HK8A 1SUSA 3H9GA 3ZVKA 3WLKX 3HO6A 3VXKA 1HQKA 1CYDA 1VLHA 2QORA 5HKKD 1IBMB 4LGMA 1Y7IA 5F4BA 4RTSA 4CF5A 4MPPA 4OFXA 2W6IA 1IB6A 2QRUA 4EVSA 1GPWB 3EPRA 4PHHA 2I6SA 2YS6A 1MRZA 2CJFA 1JWBB 2D4AA 2I2CA 2VDJA 3GVXA 5AJHA 5HCNA 4COOA 2ZLBA 5IZ4A 1NU6A 3R77A 4UDOA 3PWKA 1K89A 4I0WB 3WK9A 1Y6ZA 2ZJBA 5GGXA 3UGJA 3AHHA 1Y8RA 3Q2KA 1TUBB 3WGJA 5AOVA 4EOGA 2BFMA 5M3BA 3O9MA 3TSCA 4FMBB 2MR6A 2W0MA 3O6VA 3H8SA 1DSSG 2P9YA 4CM9A 1GPUA 4PQFA 1VJTA 4L7QA 3E82A 2O05A 2XQFA 3NASA 1CEYA 1ZM2A 1N8KA 4YS6A 5A5FA 4JFAA 5L45A 1XJ0A 3CE9A 3L0BA 1ZD8A 3BRWD 4RA6A 4DJ5X 1VC2A 2REBA 2BCEA 1PE0A 1Y5LA 1NOJA 3BTSA 2BGTA 2WHXA 3G68A 1DIBA 5HSGA 2E82A 1USIA 1OPXA 4EUNA 2VXOA 2HTEA 4P7BA 5JS6A 3KB6A 3A6KA 1CS0B 1GT6A 3UV3A 4I6JA 3EXHA 4JELA 3ZLBA 3H2KA 1D09A 1Z22A 1W2GA 1KL7A 2VBFA 1ZUNB 2JDIA 2WT9A 4L8LA 3R8XA 2E4UA 3ZCPA 1QR6A 1VB3A 4NECA 4WXYB 1NQVA 4FHGA 2X23A 2PIDA 2WHQA 3CR8A 1XB2A 3EIOA 5CH8A 1E20A 4CV1A 4NAUA 4AUEA 4DQUA 1E2HA 5KTRA 2OPHA 3MJSA 2ZW9A 4QZVA 2O14A 3EXFB 3GAFA 1E2EA 3NDJA 4F4FA 2BE7A 1WXQA 2H4XA 2JGDB 3BUSA 1X7XB 3EDYA 2PSFA 3SJZA 3OO1A 3UK7A 1OGYA 5TGZA 5BVGB 2F4NA 3R0QA 1WUKS 3K0EA 1E4VA 2LCQA 1ZP6A 3EULA 3CEPB 3KZ1E 3WG9A 3ZQJA 3QSGA 1UPBA 3A4NA 1PWHA 4AWBA 3OEHD 3VC1A 4ZOBA 2IXTA 1J5XA 4H7EA 1IUKA 2I87A 4EY8A 4HPJB 1PQUA 1XTJA 4G81A 4KIWA 1WD5A 1DDIA 1ZJ5A 2BFAA 5AHWA 4Z9XA 1XR3A 2XVYA 3DHNA 3FI9A 2D5LA 5AI6A 3W78A 1A9XB 3IYLW 3AESB 5JSZA 4G8CA 4BLOA 4M9ZA 2G1UA 3HXOA 1BQEA 2ZJZA 3R9IA 2WD8A 2GAJA 3EJWA 2NPIA 4MW9A 2Z04A 4AZ0A 2C3UA 5CT4A 5CDGA 1X1BA 3MJFA 2JVJA 2PH7A 3NHYA 3KT8A 4IXMA 3D3NA 1TYZA 4KODA 1KJZA 4WACA 1JZSA 4GMHA 2FW9A 1XCGB 4K88A 3U3ZA 1VLVA 1NVMB 3DFKA 3HJBA 3O7MA 3TTVA 4CKWB 1QGUB 1YBFA 3TE7A 2G1PA 3KL2A 1MXHA 2GBFA 4MQMA 2O19A 3TQRA 2YVLA 2O7SA 3RADC 4ZIRB 2HMYB 1DC5A 1JSRA 4BLPA 2Y1XA 3DH0A 1M2VB 3S3TA 2SKDA 3CZMA 1B8OA 2Z0MA 3EDCA 1P1BA 1TT7A 3AJAA 4R7TA 3JD3A 5IFKA 2PMEA 1DOAA 5K8IA 2YRXA 2FSUA 1AURA 3GMIA 4QPJC 1RXVA 1HLPA 3E3NA 4G89A 1KU0A 2MINA 2VXBA 5DBOA 2O3TA 2ZRQA 1H22A 1LJUA 2HRQA 5DLYA 1XZHA 1AKRA 1E1NA 4FB5A 5ES4B 3QKWA 4ZTUB 3SYKA 3JVUA 4FMDF 4FZJA 2QLJA 1KVTA 1NYLA 1P7VA 1Y6QA 2P75A 2XGOA 2YQZA 3KK0A 3LQRA 1MX9A 1VHJA 2P41A 4RIHA 2XMRA 3TIVA 3WK5A 1OX6A 3K9NA 4U7GA 1TMGE 3ROGA 1E8MA 1N6NA 3C15C 1PT8A 2PU7A 3I42A 2WYUA 3T7TA 4C1NA 3D7KA 2NVUA 1O08A 1NY5A 1XJWA 4M7WA 2OV4A 1NF8A 3ZDZB 1J06A 4REOA 4BFYA 5GVSA 4MZXA 1PFYA 1JQJC 4CFSA 5IDWA 1ABEA 4FEEA 1QYVA 3SHQA 1Z7WA 2Y27A 2QE6A 1Y81A 3TQOA 5E9AA 3MPUA 3NH9A 4ZO8A 5JFOA 5IXYA 4NIMA 5AW9A 2H7VA 4GL4A 2XGSA 3F6YA 3HKBB 4HZUA 2H7YA 5TEVA 2I33A 3GYGA 2H1FA 4H4DA 4ARZA 4MWTA 4Y1FA 2JAQA 4Q1BA 1T9GR 3ND9A 5CU7A 2F62A 5C5CA 3OT4A 3WNZA 3IIKA 3VRHA 5JQWA 4A2WA 1WVGA 1DAKA 2MSCB 3CBQA 1C9EA 1UEIA 3FYSA 2EBUA 1RZRD 3BBLA 4GI5A 1T5TA 4K1LA 1IEVA 3O5AA 3W3AA 2EEZA 2BHTA 2XCOA 4AG5A 1J00A 4M6WA 4RXTA 5JASA 1G8FA 2GN2A 1X70A 1X0XA 2V1XA 3P2IA 4OEHA 1OY1A 3WZ2A 1SXJC 2J5XA 3IIMA 3P94A 4GI3A 3VC3A 4PU0A 4XM0A 1T5HX 5FB3A 4AZTA 5JCXA 3AX6A 3GO4A 1E6LA 3O8BA 2YKGA 5LC1A 3B6MA 4LCBA 2ISCA 5IT4A 1J97A 2HMWA 2IIBA 2QEQA 2RDMA 4RVOA 4I1VA 4EX6A 4YPVA 5JBIA 5KX5A 3HCCA 3O8QA 3WJ1A 2EU8A 3DNFA 3AF4A 4ZCRA 4YI5A 1RC0A 2GRJA 2FPWA 4V2UA 5ELLA 5HW0A 2ZB3A 4BB9A 1Q91A 4BEJA 4X45A 1H9CA 3D54D 2C7GA 3W4KA 1PVDA 3NHWA 1JLRA 2J0VA 3BKWA 4FDMA 4HAZA 4P86A 1BSVA 3LTNC 1G55A 1K7FB 1Q7GA 3D8SA 3CURA 3H18A 3PFGA 2CSUA 4KYIB 5D51S 3GJXC 5BWCA 1OB2A 2HRBA 1C9JA 5DW0A 2Q6KA 3R7NA 2LNDA 3RQSA 2I67A 1VE5A 3EVEA 4AY3A 2WTUA 1VYHA 2TMKA 3Q8KA 2WZCA 3R44A 1KMCA 3GJ6A 4QTZA 1QVAA 4NYIR 1OLUB 3QVUA 2XCUA 4BFTA 3GJYA 4MKFA 2V0GA 4B3FX 3LF1A 2CNNA 2IYRA 1DUSA 1W5TA 3HADA 2XZLA 3EGEA 2OEPA 1XELA 3KV3O 5KJEA 2E18A 1JILA 2HU2A 3BWXA 3BD6A 1GEEA 5JNRA 4FOOA 3CXRA 4AT1A 1IVSA 3LWDA 3ZY4A 4ZQCB 1E1QA 3TOXA 3VR6D 3HCAA 1JFFB 1RXEA 5IH7A 3KLBA 4MSUA 3L6UA 5DCYA 2P4QA 3P9CA 2FQQA 3PKZA 2HA7A 1U7ZA 2B4YA 2R8OA 2HU8A 1RAIA 3AI1A 3HN6A 1HDRA 1CY6A 5DNEA 1TJNA 2JI9A 2DWUA 1HL7A 1R8SA 2ZRJA 3TB6A 4NFYA 4NYMQ 3H6HA 4M0KA 2Q1YA 1HRKA 1DAEA 3B12A 3Q7QA 1XOIA 3TUJC 3M7IA 5FLEX 3L82B 4YY3B 5A3QA 3GP8A 2X8JB 4WN9B 2FSVA 5DBFA 3ZWBA 1ZMRA 5E1DA 1J49A 4ARAA 1NM5A 1KI2A 2C2BA 1EE2A 2PVCA 2WU3A 1DO2A 4EG5A 4NU8X 4ZVMA 4YMVA 1Z6QA 3G2OA 4OHCA 4C2AA 3KQLA 4ER5A 3DHWC 4JV5B 1JMVA 3W34A 2NTVA 2J85A 2OHIA 3Q10A 2Y4OA 2XDWA 4LQCA 3H04A 3I8SA 1S2MA 1ZOIA 3BGOS 2X2OA 1BCSB 2RCNA 3ZE9A 4UFPA 3OECA 2PMBA 4GVXA 5F21A 3O03A 2XMPA 5D6OA 3O1JC 3KTOA 3DKVA 2PSSA 3HM2A 2QL5A 4QDKA 5B1IA 5B30A 5CVTA 3HV2A 4XM2A 4BMNA 1PSDA 2PLNA 3JRXA 3OUZA 1OILA 3PC7A 4LWOA 4H0FA 4F97A 3ZBQA 3IJ5A 2OPBA 1ZCFA 1BD4A 3NB0A 3GFRA 4XVQA 1PJTA 1TZJA 3C8ZA 2WNIA 4HDSA 4FSHA 3N5KA 1FFGA 1KH2A 2FZLA 3S2EA 2F67A 2KPOA 3G0DA 2VQ6A 1VL1A 2G7MC 4IBOA 4RORA 1VL5A 2VDKB 1QG2A 4P4UA 1T8YA 3M5DA 1VB5A 3SJCA 5JAZA 1D1TA 4JIGA 3KYJB 1IPEA 3MCWA 2X8AA 4KB5A 4PLHA 2C5AA 3C8HA 4BRSA 4EELA 5H80A 4EHDA 2C94A 3KUKA 2HSGA 3FOAA 5JUWA 1Q50A 1JV2B 2P0YA 4QGBA 1BYUA 4TN5A 4E4TA 1C1DB 4P7GA 2WG0A 4M0CA 3IBFA 1EDEA 3U1TA 3PI6A 5DCLA 1BHJA 1PL8A 2ON6A 2R4QA 3A4IA 2FZ4A 3CS3A 3GJ3A 3KYDA 2HN9A 3NALA 3PTZA 1EIWA 1FQWA 3VVLA 1RKBA 1GHTA 3GLFB 2OILA 5AHXA 4Q47A 1DKLA 3S99A 1W6UA 2IEAA 1AK1A 2IVFA 5FO0A 4CCWA 1T8RA 2HQOA 2QS9A 2V6IA 3HJHA 3PDHA 2OZVA 1HBJA 3OURA 2H1HA 3W2FA 2FG5A 1IXSB 2R7KA 3NAMA 4HYTA 2EKBA 5AW0A 4PAWA 2UVQA 5B6IA 1X1DA 4HEA6 1JT2A 2WJWA 2R6DA 3KAPA 5IW8A 1EM8A 2JH9A 5EE1A 4E09A 4I9FA 4FFLA 4FFNA 4LDAA 4BFZA 1IY1A 2V97A 4TL6A 2XE8A 3EGDA 5CURA 3TUIC 4BNWA 5IBCA 1N1DA 3SXUA 1KZ7B 1CR6A 1CY7A 1OWPA 3T1HB 1PNTA 5K0ZA 2NPFA 3V7UA 3HNPA 2O48X 3ECSA 4NH4A 2W4IA 4N1AA 5K20A 4RTKA 1Q57A 4A8HA 2P2DA 3NWBA 5BUSA 1BE8A 1DX6A 4JLSA 3GLIA 3HB7A 2OFPA 3QM1A 4WKOA 2HBQA 2YY7A 1DBPA 3X0DA 2ZSUA 1I7LA 3A6GA 3QKTA 5D3QA 1K0FA 3UB4A 4JT9A 2NUTA 3GNSA 3UWPA 4IOKA 2IVZA 3LKZA 1Y4SA 4X61A 4B7ZA 4BAUA 1NZFA 3HUEA 4XLTA 1NLZA 1ESNA 3JQAD 2O59A 3EQ2A 4WGGA 3GFVA 4U5XA 2VNKA 1P6UA 2W98A 3Q7PA 3AUUA 2HDOA 3AXTA 5BNIA 4GVPA 2AG8A 2WF7A 3VVCA 3WKEA 3G0HA 3FGNA 3OIWA 4EPXA 4J0IA 1XTKA 3KFVA 4K9NA 2W2KB 3P4UA 4ESOA 1EU1A 2BKUA 3DB2A 3M6FA 5ALFA 2Z6AA 3OM9A 3OHMA 2OM2A 3FUTA 1GUBA 3NAGA 5FOWA 3PR2B 4C4RA 1LX7A 3EE6A 5EJ8A 3KWLA 4C9BA 1LDYA 2ZPAA 3ZXUB 4B3IA 3EZGA 3C6MA 2ZIWB 5LNK6 1GFWA 3C6BA 3MBIA 3Q8XB 1G64A 3HA7A 4HVTA 2GAAA 1L7RA 4LW8A 1WSAA 2PZJA 4PINA 4KPFC 4O2AA 1DDGA 2EP8A 3CCBA 4IYJA 2E89A 1AT1A 1YQTA 2OTCA 3H2JA 4KE6A 4W7HA 3JRWA 2FOLA 4ZVRA 2CXXA 3RABA 2P9TA 3ZHUA 3ZW8A 1S1MA 1A9PA 4CNQA 5LQMA 4K2HA 4E5SA 2EEPA 2H0RA 2ZDHA 3EQ9A 4CV3A 4QC2A 4NFHA 3W2GA 1MVNA 3QXGA 4X6LA 5C81A 1O8CA 3AM3A 1XFAA 1IOVA 1OI7A 2ZVJA 5HE9A 1ZR4A 1GKIA 2ZCJA 5GJBA 5FL7D 5JH7F 1P60A 3GD7A 1D4FA 4P36A 3IR7A 2IY9A 3LOUA 4QTXA 3AL0C 4B17A 1OXSC 3KU1A 4NZOA 3O8RA 3RVRA 5AKHA 4OLFA 2ZQZA 4FTWA 2RHRA 5LP1A 2NV6A 4OI4A 3QLUC 1ZK4A 1J2TA 3O8CA 1BYIA 1C81A 1EZ4A 1J09A 1R74A 1YL5A 3WTBA 2ZAMA 4X20B 2VH1A 3SP1A 4CDNA 4D4HA 1KEUA 2JLYA 1W94A 1AB6A 1Q5PA 1XZBA 2POCA 1TMKA 4J0HA 2ACKA 3TOZA 2BEKA 1ZMBA 2PGIA 5H82A 4RJKA 4P0TA 5T4BA 1U0GA 3FYUA 2X42A 4CU5A 1OKKA 4CMAA 4OUKX 3HABA 3CNQS 4YCMA 4MKHA 3F5SA 3WZMA 1GG9A 5FUYA 5K2MA 2CY0A 1MBZA 3FKSA 4WK4B 2IZ7A 3MAAC 2WM9B 3ZW9A 2PRIA 1JKMA 3K96A 1IJBA 3GEPA 4B3TB 4N48A 2XNSA 2F55A 2AEMA 2BW0A 3ORYA 4BMDA 5D8DA 3VFDA 4FINA 3EF3A 2CNWA 5KC8A 2P65A 1VI6A 4GSLA 3V1KA 1R6UA 1XWWA 1BDIA 3GIWA 5JBNA 1HDOA 4C2TA 4ZV9A 2HSEA 2NSLA 3DDHA 2D3TA 5DVZA 4L8FA 4B33A 1RP1A 2JGAA 4TXNA 4BECA 3KALA 1U3WA 4O2BF 1WTCA 1CUJA 4E12A 1H66A 4CMCA 2V8OA 4H1HA 5HHTA 1Z63A 1MDFA 1NV9A 4MKRA 1J1ZA 3J81k 3KSRA 1E8NA 1YZFA 3UJAA 4RA9A 2W4QA 3VQTA 4X65B 5B3AA 5B3JA 5CIYA 3ETLA 1U98A 1UBTS 2HGZA 3AY0A 4AXXA 1SU8A 5ITVA 4WNAB 1AUVA 3EWAA 4X66B 1R0CA 4P4SB 3TWOA 1U1CA 1W0KD 3A4VA 3VC2A 4DCPA 4BLWA 3KOYA 4DAEA 2GESA 1JYSA 4HLUC 3L49A 3BKXA 4NV3A 3DCNA 1LW7A 4WLFA 1MX1A 2B35A 4JJ8A 1N1EA 2G17A 5E0OA 3TF5A 3VDQA 1MNQA 3BCHA 1ELOA 4D9HA 2ZE8A 3TD9A 2V7BA 2E6UX 4MYCA 2QN8A 3NDRA 1LY1A 3SLKA 4CKEB 1B6GA 2X0EA 3LWNA 3BJIC 1NQWA 2WKWA 1CUSA 5K8CA 4LRYA 2XOEA 1MQ8B 1R1DA 3OVMA 4LOHA 3TXAA 1ORIA 4MUKA 1KFJB 2XUHA 1XMSA 5TPWA 2J0QA 1KFBB 1SXQA 1JEOA 4KXXA 4UNNA 3BMOB 4GH5A 4B5KA 4HDMA 1F14A 3V6MA 3L6OO 2QNBA 2XKKA 4Q9LA 2DULA 4X44A 1SCKA 1DU4A 4R8VA 1IG3A 4WIAA 2PL1A 3FB4A 2OCPA 3F9IA 2HAEA 1TJ4A 1EFTA 1YE5A 2PGLA 3JQ7B 3OOSA 2WJVA 4KI0A 4BGIA 3DM5A 5M34A 3CJRA 4OLJA 2HYIC 4MPRA 4D9CA 2NIPA 2B3DA 1BXGB 4KXLA 2DUNA 4GZ6A 5E7IA 1Y6RA 2Q9BA 2QDXA 3FNQA 3CH7A 4RTJA 5EAIA 1Z82A 1VMKA 1L4LA 3GYBA 5LP6F 3Q15C 3ER9A 2UZAA 2VDMB 4QXPA 1FDOA 3L4BA 1GLVA 2O7QA 1WKVA 2QROA 2QQEA 1T4CB 1N2OA 1P4AA 3H0CA 3RTCA 2ZRFA 4A6EA 4NXMB 1LVHA 3VJRA 3PX7A 1VBKA 3GZTB 2HJHA 5JAIA 3GLUA 5LZ8A 2I4RA 4LE0A 1TM3E 2HI0A 1DQPA 2PSHA 1Y1LA 3M4JA 3EEFA 1AKEA 1KAHA 5U9CA 2QRPA 3CGWA 4CEJA 2WINI 1GLGA 2D8AA 2Q2OA 2A78A 3MCTA 3VX3A 4L4ZA 2B6NA 3WYCA 2W2TA 1I4TD 2VXYA 4AY5A 3BL8A 4L6IA 5BORA 4HJXA 5CG2A 4A1FA 1R0RE 1SCIA 2ARKA 5IABA 3V4LA 1ZISA 4PYQA 2NYVA 3R7FA 1OHHA 3BFPA 1PLKA 1KARA 3N2KA 1B0ZA 1XNRB 2CJYA 3EZLA 1KVSA 1EWTA 1T5OA 1K5DA 3F1LA 3P97A 4JI1B 2JLXA 1HRDA 4YDHB 1G2IA 1E7YA 4OO3A 3H5AA 4C3ZA 1XA4A 2ORVA 4KJZA 1WCIA 1JAZA 2AWOA 4GEGA 5HZMA 1MIHA 4Y1RB 2BMWA 2QAIA 2Z2IA 4F86A 2BEVA 5JXWA 3WRWA 2DB3A 1TYBE 1JMYA 4YAJA 5TQVA 1C9DB 3UMRA 3T4EA 4ZV4A 3V1TC 2Q5FA 3BYZA 4CW7A 2DPMA 1FTQA 3EWIA 4QTUB 2O4CA 1H2YA 1NNUA 3C7TA 3ZY5A 3ER8A 2BGKA 4RVFA 2GUGA 1FXWF 4NAVA 2YDXA 4M1ZA 2ET6A 3K7EA 3R0ZA 4LRXA 2Z9CA 5AVVA 1I1OA 1OX5A 2QJTA 3BWBA 3WIOA 5IZCA 1BW9A 1TJYA 4KLAA 1VA5A 4K03A 4LGYA 5JW6A 3E2IA 3SZGA 2GAFA 2MIIA 2IUTA 4HD8A 3MAJA 3DBRB 2GUWA 1SFRA 2RAFA 3TIGA 4LISA 4QBGB 1I3KA 4P3NA 4G36A 4Y2VA 3TAXA 5HJEA 1R64A 4NJOA 2I3BA 5JRJA 1FDTA 4H3KB 3PDWA 4NCHA 1DFHA 4DFDA 4AAYA 2QE7D 4NYMR 2J4CA 3EFBA 4DBLC 1DG9A 4OHRA 4V0KA 1NVWQ 1OXUA 3B3AA 3A11A 3FPAA 4FLFA 1JHZA 1XMIA 2NO5A 5CLJA 4QVIA 2BFBB 3QVOA 1XSEA 1EGAA 1GPAA 3U9TA 4KC0A 1ODKA 2BRUA 4F5EA 1CP3A 1HGXA 2V54A 4ICIA 5CFLA 1OR8A 3LPNA 4TMXA 1Y6GA 5T41A 1EXVA 1JHMA 1Z4IA 3IHKA 4WAUA 1CEEA 1NW7A 3ZHZA 2FDCA 2H2HA 4IIFA 4Z3OA 4E22A 3GPDG 2FSPA 3GF4A 4QNNA 3AIIA 2KQUA 5E1OA 2CK3A 4JBGA 3LE8A 1M8PA 2PDAA 3SC2A 2HPHA 3EG9A 5B7GA 3H4MA 4H7PA 3C6KA 1J5EB 1NVGA 3JQ8A 3OF5A 3AP3A 4RMJA 4ZALA 1QH8B 1XK6A 1ZOOA 4HYQA 4LXTA 1J8MF 3PGXA 4DMCA 1DEAA 4TYWA 2VT6A 2ZDGA 1T24A 2PVSA 5TY0A 4E6PA 1EH5A 2AUNA 4JJ7A 3LUHA 3PQ5A 2F43A 3V1LA 2RI1A 5IBQA 4PYJA 5FTKA 2FEWB 3CY6A 4NMMA 3WKCA 4TKVA 5C1PA 3DE3X 1YC5A 4AJOA 3ZD9A 4LECA 4LEIA 3FD8A 5IG2A 1KU6A 1KYVA 1IHDA 1HSZA 2J32A 5JANA 3U31A 1I51A 2M32A 2EJWA 3SQOA 1FFCA 5IKXA 1GZDA 4UULA 4CM3A 2JFHA 3KZXA 1SK8A 4ZP1A 5A06A 1S3SA 2X3YA 1QH0A 2BBOA 4MUAA 2H92A 1XA0A 1Z6PA 2HLNA 4Q7JB 4RXMA 2VQEB 3VGPA 1SPBS 1R6XA 1WDWB 4FIDA 4BMYA 2VTEA 3G1TA 1X7YB 2J3LA 3WMEA 2QTZA 4CMEC 3LLUA 4TKUB 4TV8B 4EITA 5I45A 5FYDA 5KWEA 2FN3A 3W2IA 2GKGA 3MTIA 4HLDA 1GV1A 1MO6A 1V8PA 1LRJA 4H60A 2R1UA 1Y4ZA 3DLAA 4J1SA 3NXSA 1C0EA 3PWSA 1C41A 5HUHA 1IL0A 1P19A 1VSUA 2UYYA 2YZMA 2ZK7A 3GN1A 1E5XA 3HHPA 3INTA 4DRZA 5EP3A 3PP8A 3FCEA 4D9MA 5TS2A 1GGKA 4DA8A 4B75A 2WIGA 1XCLA 3AERB 1QGYA 3P9XA 4F3NA 2VEDA 4Y6OA 4C6HA 2Z3WA 5JATA 4HDRA 2DX7A 3DPUA 1OFVA 5B53A 5JLAA 3RVSA 3RYFA 1U4SA 3NANA 4C3OB 3L0ZA 4HQKA 1N2BA 3W0LB 1I4EB 1S5PA 2PX3A 2AQHA 1U3VA 1QNFA 1A4IA 5KYYA 4OXNA 2K5UA 2CLSA 3ONWA 2XBMA 1SKYB 2EG9A 4BNYA 4DQXA 2VJCA 3REFA 3TJZA 4B5LA 3SM9A 3GEMA 1I2BA 2JLRA 2PBFA 4KQHA 1RM5A 1Y3FE 1UAYA 3CKLA 3KPYA 2JGRA 3I2IA 4FYKA 2WIKA 1S7GA 3KJEA 1WXHA 4PYOA 4W1RA 1VBNA 1GADO 3FRHA 1HFEL 1OPRA 4GRIA 2DPHA 3WLAA 4YV7A 1FPMA 1FX1A 3KUDA 1NNEA 3GRZA 3C6QA 5JT1A 2GCGA 4QE3A 2C2KA 3O3CA 2QUKA 5IT0A 3GP5A 1ZM3A 5K8VA 4KO3S 2OD7A 3IH5A 3CF6R 2OR3A 1GPNA 2V55B 1ZH2A 1IOLA 1VLZA 3H5WA 4GWLA 4TZKA 1E0SA 4W7IA 1NBME 2QRGA 3BFJA 3QFCA 3E15A 4PYIA 5CW1A 4I5GA 3EXEB 5I5EA 1G2OA 1QIGA 4K5QA 1USVA 1GPBA 1YGPA 3D4PA 5FBQB 4G0UA 3WXBA 1A97A 3I5YA 1KP9A 4CM4B 3AHJA 5DYYA 1T25A 3NGLA 5DN6D 1NVFA 4XWWA 2ZRPA 4PLTA 4OLHA 4MOWA 2OYRA 4MKZA 1SBZA 4P5EA 1G5RA 4IXWA 1GGMA 2A1UB 1CWUA 4JXKA 4DC0A 3GLFE 5FKJA 3K9FC 4YLYA 5BWLA 4HV4A 2JK0A 5ANRB 5ALDA 5K51A 2VOEA 2WIDA 3HDHA 4WDRA 4XSVA 2H9IA 3DAHA 3VHXA 3VPXA 4DMLA 2J33A 1JT9A 5HZHA 5KJCA 3WLLA 4WLOA 4JITA 2UUPA 4RZSA 3GLVA 5JCJA 4EBBA 3SYNA 4MR9B 1RZ3A 2XNCA 3VPBA 3NTQA 1PYOA 1R88A 4E07A 3ETHA 4WA7A 2FVYA 4U2KA 3SHFA 3MWFA 1RXIA 1XQ6A 4ML3A 5LBIA 2AC4A 3ABOB 2PAFA 2DWCA 2F8MA 1E0AA 2DGDA 4MUBA 2HH9A 2VT2A 3FJ1A 4HLCA 3N2GA 4RU1A 4YA6A 4EGCB 1Z6AA 3ITDA 4R16A 3P9NA 1JR3D 4RABA 4G67A 2QL6A 1LJ8A 1XKTA 1Y3CE 3OOJA 1YI1A 2RHJA 4UJ3A 2OSBA 4Y0NA 1USUA 2BEUB 2P9BA 3N8KA 5D7BA 3ZWVA 1N7IA 3L0YA 5ITSA 1CRPA 3C4VA 3PIDA 1U8EA 1ZJ4A 2ODEA 1MW9X 3H3FA 3NT4A 3E18A 3EYAA 3ZGOA 4A0GA 1Y8CA 1CVRA 3LYAA 4ANFA 4EMSA 3MVEA 1OYYA 3FDJA 5DRTA 1UBHS 3PIRA 4LNHA 3DLIA 1Z26A 2QMEA 1X86B 3GVCA 2PKXA 4UMFA 1XP8A 3RC2A 3UB2A 4X5OA 4Y1EA 3WYFA 1D6MA 1C30A 2B8NA 2SKEA 4O4LB 2XYPA 4Z1MD 5JISA 1PGQA 2OOSA 2YNMC 4CQLB 1K3FA 3ZV7A 2A5GA 2XZOA 3AM5A 1RBZA 3OLVA 3WLHA 4RHCA 4DVGA 2CNBA 3VR2A 1FQJA 1XZQA 4I9HA 3NUGA 3W79A 1V11A 1VP3A 4MQLA 1PN3A 1E1RA 2CUZA 1Q0PA 2DPGA 3GGDA 3OEWA 5CA1B 3FPCA 2HUNA 4I1SA 1MABA 1QB8A 2N9UA 2VIIA 3B51X 4HTFA 4OCZA 4RDIA 4C0BA 4E2FA 4XWKA 3E81A 5CTJA 5ERXA 2AR0A 1YR7A 1A9ZA 4RM3A 2OMKA 3ZLJA 4JP5A 3GNLA 1M1XB 4YRFA 3WRXC 4WT7A 4BP9A 3FRJA 1XLWA 1E5DA 2F3UA 3IOYA 3E61A 4B2PA 1P9RA 2IYZA 3Q3EA 4CMIB 2NZ2A 4P9NA 2F59A 1EKXA 4J9UE 4ESHA 3GJ7A 2VDNB 1VMAA 2RGYA 1JHRA 1GTL1 1LH0A 1ZIXA 2FI1A 1ADCA 5F7JA 1T0IA 3HDTA 1W85A 1U8XX 1NY6A 2YV4A 3MJEA 2OXIA 2CXTA 3KQKA 4FPXA 2DPXA 4ZGBA 5A4FS 2AW3A 3IDZA 2C9DA 1L5VA 2E7ZA 3A3PA 2VA8A 1TTHA 5J2TA 4C3VA 3O4RA 2WVJA 4G86A 4HMQA 4JEMA 2XH8A 1WUHS 4QO7A 3NR2A 1NF2A 3WMRA 5IARA 1O57A 3AIMA 3REQA 5BNTA 1G0NA 2XWBF 3BJRA 1T1JA 2EKPA 1LVUA 2ZZNA 3IP9A 1PGOA 1SCUB 4B44A 1SOUA 2AF4C 5AP9A 2GPWA 3L41A 3PNQA 4TTPA 4BJ3A 2H63A 4CHGA 1V2GA 2OHOA 5LQUA 1HDCA 1X3LA 4B3HA 2C99A 4MJXA 2ADMA 3FN4A 3SNHA 3DQZA 2FETA 1TZBA 3D6UA 1VHWA 4KDCA 2XJ4A 4GHWA 2IYPA 2ZIAA 1N0HA 3WK4A 4HWRA 1KWGA 4WBNF 2RH5A 2BSQA 1FNSA 2XXAB 1XVVA 1Q11A 1OE0A 2ANBA 2W90A 3M89A 4KUHA 4MV7A 2XYGA 4WKBA 3MWDA 5EPOA 4L8VA 3UMGA 2H5JA 5EC8A 2PUEA 1NQ5A 3KSUA 4ZREA 3EIQA 5KJ6A 3AUKA 2FOIA 3OKFA 2CWDA 1CQXA 5FBRB 4YALA 2NWQA 1XZCA 3OQBA 2OHGA 3GCZA 3GFSA 4ZTBA 1RAFA 5CFOA 4IXDA 1T5LA 3QVVA 3HPQA 3TD2A 3GROA 5TIIA 3FUXA 3FIJA 1Q3TA 2EYQA 1XTBA 4MRRA 4HGRA 3W5UA 4DXDA 3SJBA 2NO9A 2YWEA 4IFEA 2D7CA 2YW2A 1OYWA 1ECLA 4OQEA 4B45A 3R3ZA 2FH5B 1GFZA 4AVYA 3I1IA 4CTNA 1W1UA 1T6NA 3M3PA 4KLCA 4X7RA 4R7GA 1TOAA 5DN9A 5LP6C 3TVYA 4B85A 2KS6A 4OA8A 3PPWA 3PHLA 1FMLA 3PWTA 4TGLA 1E1MA 4ZODA 4EG1A 3VAAA 2XRZA 2FMTA 4DQLA 1F20A 3GMTA 4G5QA 1ECJA 3CRZA 1GNVA 1YQDA 1GL7A 2C88A 4OGWA 4DG9A 4XLLA 2YS7A 3GFPA 2FW7A 4CL3A 1L7OA 3KX2A 3O8DA 1BE0A 1GRNA 1QO9A 4MINA 4X00A 5AM2A 1YDMA 4P84A 4DS3A 5BN5A 4F92B 5J59A 4RK0A 3ZCUA 3GHHA 5EJ4A 3GLGB 2JGKA 4PLPA 2V7VA 3I12A 3ZY3A 1SD1A 1HMYA 4KHPB 3LD9A 5JLJA 2Q50A 2B0JA 3HZRA 2IKQA 2B5WA 4HQFA 4O8CA 4XJSA 3CH4B 4AECA 1D4OA 1J8QA 3KCNA 4GW3A 4M86A 3QSYA 3VI4B 2C2ZA 1Y4UA 3EZXA 5C3UA 3ILXA 2AN9A 4ZRNA 3LPAA 2EATA 2C2OA 1DARA 2WMDA 5EHZA 4Q4CA 3ZDEA 3MLEA 4R8LA 1FP1D 2QLFA 4GE0A 4H15A 2D6FA 4DCJA 1QOZA 5JO9A 4ZQFA 3VYUB 2YY5A 1S8NA 4WY8A 3PNLA 3O90A 1WV0A 5EZ6B 1RAEA 4IKEA 1SMKA 5U4QA 4DLLA 1PK7A 4EG7A 1X7WB 1GU7A 1R5JA 4HWPA 4MCIA 4UNSA 3SVZA 3U9LA 2HZ7A 3DQPA 3LT4A 1IHOA 5JC1A 4V0ME 1KK1A 3KKKA 4C4PA 4F11A 1BXKA 1V6AA 3BOSA 4JZKA 4LJ7A 2YICA 3PUKA 4LPSA 4MGYR 4NCJA 4QEKA 3UCFA 4CN9A 4L74A 4OV6B 1WA5A 3ZGNA 4L16A 2Y4NA 3WYBA 5AJYA 4AJLA 5DYGA 3M5PA 4DNOA 2NUAB 3SFZA 4OBWA 3HZZA 3V8RA 4C07A 4HAWA 2LIVA 1SXJB 4WD3A 5FOVA 3QV2A 4PSAA 1MB3A 4BDTA 4BWGA 3GWGA 4PV7A 5H5JA 1Y4AE 3L79A 3V00A 4E31A 5KREA 1V16A 1FFAA 1ONPA 5IVPA 5LJLA 2E1PA 5F64A 1PR9A 4ITRC 2XI4A 4HDKB 1KZ9A 1GTMA 2A30A 4RGYA 4CMGA 4ZI2A 2W2LD 2OG2A 3LI2A 3OLXA 5A9RA 1EX7A 5KSWB 2R86A 1L4HA 3EA4A 5E95A 3DBHA 3MD9A 2QTCA 4ZO4A 4HUTA 3X1XA 4WZAB 3DSRA 2XDAA 2Q8NA 2VFAA 1QIHA 1SQ0A 2YXLA 2WKQA 3UOGA 1PFVA 1QV6A 2CHUA 3ANSA 2GOYA 4B6PA 1FNNA 1WX1A 3KO8A 2Q2WA 5JZVA 1NDQA 3IKLA 4FHZA 4J1NA 4M38A 6YASA 2XT9A 4AY6A 4FHFA 2ZAOA 1K66A 3V4VB 3KZKA 3GP3A 3ZK9A 1VYVA 3IV7A 3C7KA 1FC0A 2QRQA 2XNJA 2Z1MA 3Q9UA 4ZCQA 4TLMB 4TYMA 1X80A 3GLQA 5EP4A 3BDIA 5TXGA 4B43A 1ZEMA 2VYNA 1ADBA 3G5TA 4XJTA 3DD5A 5GAJA 5JPCA 2XMGA 4JOQA 3I2YX 4WBSA 4D74A 3GG9A 3NTVA 2PANA 3O2JA 1TCCA 1UPAA 4KUGA 3THYA 1ZXXA 2C77A 1FMFA 2FPGB 3LECA 3PV0A 4ED9A 5FWXA 3CX8A 1TIBA 3PDUA 3D3QA 1LC3A 2CL5A 3AEUB 3RV4A 4L5IA 5DU2A 6REQA 2C3PA 2ZB8A 3BB1A 2QL7A 3HCNA 2EQBA 2F90A 3R4CA 4J2HA 5FQOA 5HM8A 5EP1A 4EL0A 2I6TA 1LK7A 4G5OA 1FA9A 3HO1A 4FYMA 4OSEA 2J0SA 1JQLB 4YREA 2X7JA 3RCBA 3UUWA 3G8DA 1E9BA 1HV8A 5BO5A 1CQIA 4LSGA 1CDDA 5DNWA 1P3DA 3EGXB 4H6VA 1DFGA 2ZQYA 1H8EA 2ZR9A 3L4SO 2R7AA 3ICPA 2IUEA 1DBQA 4I3HA 1RWWA 4YWHA 3SYLA 4BO4A 1CG6A 4MUEA 3CMCO 4DMMA 1OXTA 3OJCA 1VA4A 2YJGA 2P5UA 3LS2A 3UH0A 4A1OA 1Z7EA 3I9OA 3BPSA 1W5BA 1C50A 3SZUA 4OB7A 1Z2AA 3W5SA 2XA9A 4C03A 1GJRA 1E3IA 2Z58A 1J2JA 3UV7A 3ZDFA 2GSWA 4U0JA 3AY6A 5AHKA 4S0ZA 1H3NA 1WUJS 1UIMA 1WO8A 3U49A 3EOAI 3AFIA 4ZVQA 4IVPA 2VNHA 1JEYB 5FWYB 4G0QA 5BQOA 2WQ7A 2A94A 2FRDA 4UVHA 4LWPA 5T3YA 1Y33E 2FSFA 4XW2A 1I7DA 3QP9A 2YN0A 1Y8QA 3K5PA 3FNFA 1FX0B 3QMMA 3ZTYA 2DH6A 4GI7A 4GR4A 3PX2A 1TZKA 4M87A 1B6SA 4M99A 4PC7A 5KX5F 3EUWA 2V98A 1KO5A 4M9QA 4JC5A 1BU8A 1JEQB 1USWA 2PUVA 4EZEA 2JANA 1HFKA 3VJKA 4EB6A 1NI3A 4CKCA 1R8JA 4IKPA 1JG2A 4S05A 3LGXA 4I6GA 2G1JA 3UNXA 3LL4A 3INRA 2OL4A 3ETCA 3DW3X 1ZAYA 2QAGA 3UATA 2AD5A 4QUJA 3SOZA 3VV3A 4BTEA 4AN0A 1H4QA 1Z2CA 2XTJA 5KINB 2FPPB 3JZDA 5E3JA 4J6FA 5CT8A 2I54A 4UEJA 2YJ4A 4K9KA 5FYQA 1TVKA 1A4UA 1YR3A 4FFPA 5E6RA 5CVDA 1EUYA 5IVDA 4GIBA 1I0IA 1UPUA 2YRFA 1PUIA 4M0MA 1JHDA 2WFLB 1IN7A 1G3RA 4PZZA 4UPDA 1V26A 1EBUA 5A6SA 4AMZA 4V02A 3C8DA 3WK8A 2G9ZA 1N9KA 4LYGA 1Z25A 3WYNA 3ZQUA 1UWVA 1I33A 2O3JA 3EEOA 4Z0NA 3QVKA 3RASA 4BNMA 1V7CA 4H31A 5JE8A 2YOGA 4FNMA 3OP1A 4MEBA 3ZJ5A 4Z2AA 5B64A 1AVTA 3R7DA 1Y48E 4BWYA 1CE8A 3NVDA 4NCAA 1KH1A 1FB5A 1NXTA 2O6LA 4HNTA 1JR6A 2RC6A 3LUDA 2PQ0A 3CH5A 1XF1A 3SIWA 1HNWB 3H1AA 4PQGA 1QHIA 1YQQA 3DNPA 3PD0A 3ELYA 2GYUA 1ULSA 1FSGA 3KZCA 4HKTA 4GR9A 5D86A 4JX8A 2M98A 1SKYE 1PV2A 1H8HA 1MAUA 1ZRMA 5IKPA 2WPNA 5E4JA 2GN1A 3BK7A 1P7YA 3AZQA 2WJPA 4QOEA 3AQ4A 4DA6A 1VIMA 4N6NA 5TPZA 2GHRA 4AJIA 3HWX1 4AJEA 4D9BA 1NJFA 4LJ5A 1WZEA 1ETUA 1SKUA 2Q0SA 3DZDA 3GFOA 4KO2S 4RF5A 3ZS9A 4KBGA 4UU1A 4C0LA 5K8TA 2AWNA 2DUWA 2YJ5A 5GGYA 5IAGA 5ALIA 1WF3A 2D1FA 2CB9A 2PRJA 2W0SA 3OJXA 2FUG6 4GOND 5CFMA 1LK5A 1A5SB 1QLWA 1E9CA 1U8ZA 2YXNA 5LA6A 3UA3A 5F9FA 4D3FA 1VG0B 2YUIA 3MWEB 1SCNE 4EHAA 4YAKA 1QQBA 4CIWA 2QV0A 3WGLA 3TECE 3WDKA 1PDVA 3I1JA 3UFBA 4A73A 5LWQA 2BF4A 2CE2X 4R2LA 2X0KA 3AEKA 4B82A 5IRCD 6NULA 3N8DA 4FHDA 3SF8B 2XVZA 4UUQA 2M6KA 5DGCA 2NG1A 3FBGA 4XM1A 1OD6A 3GFQA 5AJZA 1HDZA 4B09A 3T95A 1W88B 1H0SA 2C98A 4BX8A 1T1RA 3P0IA 3OX4A 2RAVA 1RPJA 3D3WB 3O75A 4EVIA 1GTSA 4PW0A 2D2VA 1OROA 1X3SA 5I7FA 1KAOA 2ERCA 1F8FA 1T0BA 1WJGA 1ZGCA 1OGIA 1UUFA 3DVSX 3L6CA 5H4GA 4YCLA 3L0PA 4A92A 3KU4A 5EZQA 2C04A 1Z2PX 1AH2A 1FYWA 3ZW7A 4RHTA 5TJHA 4S3MA 2J9XB 5EE0A 5ESXA 3UQZA 4M4SA 3V8PA 3CHYA 3JWJA 2R25B 3UAVA 3FOZA 1L5HB 3CMMA 1U63A 4FJ1A 5IYZA 5B37A 4DMFA 1QVZA 2QRLA 4G0OA 5IUJC 1JKJB 2W6JD 1FSPA 5AK0A 2A9QA 1HTTA 1W2HA 4B31A 5DNCA 3RM3A 3I61A 1JDPA 3SJUA 5TV2A 1L0BA 1WEHA 2VHVA 4D8YA 3ED5A 1DBWA 2RIRA 1DRVA 1Q2UA 2KX7A 5H59A 1VKZA 3MJDA 4JQCA 3LA8A 2FZKA 3TD6A 4IUCS 1YH3A 3DVRX 3OTHA 5LYYA 4Q16A 4JIMA 4C7OA 5C8YB 4OFWA 1JHQA 1YMUA 2O07A 4B3JA 5AXAA 5REQA 2PGDA 1DX4A 5EYPB 2QTVB 3IKJA 1BMFA 3RG8A 5K8JB 1G8JA 1SA0B 1UKCA 3SF0A 1E9AA 4MI9A 4RD0A 1E6UA 4KSYA 1T1IA 3K1AB 5I5GA 5C5DA 4DV1B 5ELMA 3ICQB 2HPZA 2EFEB 1RWQA 5IULC 2QBYB 4MPTA 3RSSA 4OSOA 5JSQA 5DBEX 3VOSA 1NVDA 3X1DA 4XEUA 2LKDA 1NLMA 4RKEA 5LDDC 3U4QB 2OG1A 4V2IA 5AJWA 2B4KA 3B1KA 3NRBA 4HH3C 2HJWA 1C1HA 5CK4A 4YAGA 5J4YA 4CKBA 5FJJA 3KT0A 1V7PC 3S27A 2WF9A 4J94A 4YIHA 1CUHA 1CY4A 1EXWA 3M6IA 5U4XA 5BOSA 3DOEA 3KR9A 1UJBA 3U4MA 4ATNA 1IQUA 2B8WA 4ZYVA 2VAPA 3GH3A 5LWHA 3C5WP 4LMBA 1BA2A 4WL0A 2XMBA 5FDFA 1OAOA 3BMCA 4OQXA 1XDSA 3I6QA 3QBTA 4ZQEA 4ZRMA 4Z7NB 4YMUA 3EHDA 5BMVF 4CR7A 2XKJE 4PYNA 3ELBA 3L7JA 3Q0IA 3DZCA 4UBOA 3WMFA 2O1WA 3HBLA 3N6XA 3DKIA 4OREX 5B3LA 3AEXA 3NYIA 4JP2A 1KO4A 4ISCA 4LQDA 4X3PA 5EVJA 4UBNA 2JGMA 1AZSC 3I45A 5DOVA 3T34A 2TRSB 3WWOA 2XB4A 4FWBA 3ZIAD 2K2QB 3LX8A 1U90A 3V3KA 3ZI0A 5DHAA 4GPAA 2OYCA 4JXZA 4NFLA 4OMCA 1RYNA 4DDUA 3FUCA 3CRRA 4DJFC 4EMTA 4ZXPA 3EZ6A 3LC2O 1QWOA 4RQTA 3U9SA 3H75A 4B9AA 3D4BA 3LP5A 3R0JA 1P2VA 1OIVA 4OHPA 3I9JA 3H1TA 1HXHA 2PRSA 3MM4A 1KNXA 3NHFA 4GP7A 4HFJA 4Q3OA 4RE6A 3RAEC 4DLVA 2VNSA 3V8EA 4HDNA 4UHFA 3LFHA 2I8LA 4WNCA 4ALIA 3F5DA 3F78A 3PGJA 3SWWA 5BV1A 5TQ0B 3J81A 1U7OA 4RDCA 5H3HA 2DHQA 2AMJA 1Q1QA 3C4QA 1A8HA 3JAWA 1LNQA 1NRWA 1DKNA 4GI1A 4J7AA 4NATA 5I9BA 2BFCA 5BN4B 3RGGA 3SR4A 2ECPA 3C8MA 4JHLA 4R68A 5AI9A 1HKHA 2HHCA 2PG3A 5KKAA 3PGLA 1KE2A 3V4ZA 1T3TA 1M2OA 2OWEA 2X7XA 1Q0QA 2ZS9A 2YBDA 4YQFA 9ATCA 1W52X 4MRSA 2ALJA 1JQ5A 2VTDA 2V1UA 1I1NA 2Z95A 1XEXA 3VR6H 2I4IA 4CL8A 5BSHA 1X7GA 4OB8A 3ZWWA 1EG7A 1NBEA 4GMFA 3RUEA 4ALJA 1J8FA 1TECE 4BAZA 1FNCA 1KQNA 3LT1A 2CKDA 4PC1A 3ZGXA 3DS8A 2K2WA 3CU5A 4FM9A 1XN1A 1CY8A 1KY2A 1IXZA 1NR1A 2W2XA 1GQFA 3DWIA 4FYHA 1HZJA 3TL3A 5BUQA 4EPTA 3TG8A 3WKAA 1ZMXA 3IKMB 4I8DA 3PQCA 3GPIA 4BO2A 2WTBA 3OZ7A 5ED0A 1IRIA 2O2ZA 2WM8A 4Z99A 2P2GA 5AO9A 3UMSA 4BFWA 5CM2Z 4YMWA 5LN1A 4XZ3A 3THWA 3ZOZA 1ZN7A 3D6HA 3G9ZA 4Q1DA 2CLIB 3E5NA 2OV6A 3DO5A 1OT5A 3U1VA 1RCTE 2J4FA 2VYVA 2COKA 2R8XA 2QRNA 1G2PA 4FOTA 4RY9A 4A16A 4C89A 4RPGA 1IOZA 1SD5A 4K6MA 1G66A 2Z6QA 2P8SA 4QXQA 2OE2A 4G2NA 3AF1A 3PTLA 4KE7A 3JD0A 3GH1A 4W4TA 3SI7A 3EDRA 1FBTA 4UKDA 2BGWA 2RFLA 2XBUA 4MLPA 3OPYB 3ST7A 1YONA 5BR4A 1CNMA 1YJBA 5I7OA 1BX1A 1UBOS 1VQ1A 3FWYA 5BYBA 5KB3A 2FF7A 5IBRA 1RYYA 1SHLA 2LZ0A 5JJIA 1MJNA 3STHA 4Z53A 1AE1A 3PC8A 2XYVA 3B85A 4QBHA 5BXYA 2X2EA 1EUDA 5AKKA 1TLFA 1PWXA 3MTEA 2Q9UA 2V9ZA 4MVJA 1CY0A 3FZQA 3X1JA 1NBMA 2Y9MB 2VLIA 4J16A 5BSFA 3N7AA 1M1NB 2QTMA 2H4YA 1LBHA 2ZAGA 2GJSA 5KNCD 2WLSA 4R8MA 1EFRD 2P5TB 3CSSA 4YJHB 3NPAA 1A2OA 5LDHA 1YO6A 2XMQA 3CPEA 4JBWA 3PJFA 2XUPA 3V42A 3ZHOA 3R23A 5FWYA 1N2SA 2PXHA 1WXEA 1JA0A 2WNHA 5B4UA 1QIFA 1R6VA 2OVBA 2ZBDA 1O3YA 3GCDA 1I3NA 2K87A 3LUFA 2BGGA 3V9PA 1C4XA 1UBRS 1BNCA 1OJLA 2EP5A 2YVAA 4LOIA 4MR7B 4ZRDA 4AJHA 4AW9A 5JD6A 2GH1A 5PNTA 1RRCA 4DIDA 4F06A 4GLBA 5JVDB 4ZJYA 2JIMA 1E1CA 1R0BA 3GT0A 4JGIA 1XQXA 3HKDB 2JKZA 4OAQA 5C37A 3SE7A 2OQIA 3W3AD 4KH1A 4U2GA 1UBNA 2ACVA 4M98A 3LSYA 3LWBA 1D03A 2NNWB 3NUQA 3EXIB 3IP3A 4XPIA 1FK8A 1R3UA 3SXJA 5ETJA 3TSAA 3COWA 4MS3B 2F48A 5CFQA 3PDJA 1ZOLA 4BQSA 1NMZA 3QYAA 2WD7B 2EKQA 4PX9A 2H08A 1GFIA 1VPVA 1SXJE 2G80A 3LUPA 3E53A 3FF4A 4TYNA 2CJXA 1IUOA 1CRLA 4XWTA 3EBOA 2QTTA 4ZKDA 4QULA 3FWHA 2A7QA 4BZWA 3BD8A 2HC9A 1TAQA 1D6JA 1QCDA 1N0VC 4B9EA 4Q82A 1Z74A 2O2EA 1AS2A 2RGDA 5FLKA 1YHNA 1B1CA 1HSOA 2FEXA 3K73O 2J3KA 3MC1A 3RT9A 1J8VA 1I30A 2EGUA 1AGXA 1CVIA 1OBFO 2ZSHA 4JCOA 4NV0A 3TRHA 1WDMA 3G0IA 1AOXA 2WJ3A 1FVXA 1JRLA 3KZOA 5KOHA 4OAOA 4QM6A 1MT3A 3T6KA 4ENUA 2PX0A 3HP1A 4P35A 1DXQA 4MH0R 4EJSC 1KOGA 4HXEB