3QTLA

Structural basis for dual-inhibition mechanism of a non-classical kazal-type serine protease inhibitor from horseshoe crab in complex with subtilisin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
269
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Subtilisin-like serin protease
publication title Structural basis for dual-inhibition mechanism of a non-classical kazal-type serine protease inhibitor from horseshoe crab in complex with subtilisin.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 83
structure length 269
sequence length 274
chains with identical sequence B, C
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3qtlA00
1R0RE 3GCWA 3DVSX 3L1KA 1SN7A 2ZWPA 1OT5A 4KB5A 3D43A 4Z2AA 2PMWB 2ST1A 1TM7E 1PFGA 4WOBA 2HD4A 4WOCA 1WMDA 5I9SA 1OYOA 1S02A 1ST3A 1BFUA 2E1PA 3WHIA 1LW6E 3A3NA 3CNQS 4H6VA 3TI9A 3F7MA 2WWTA 1YJAA 4RYDA 2WV7A 1GNSA 1BE6A 1SIUA 2V8BA 5FBZA 1Y3DE 3QFHA 4OV6B 1Y3FE 4ZARA 4OMDA 2Z30A 3DVQX 1BH6A 1SIOA 2WUWE 5FAXA 1SUBA 3CO0S 1YJCA 3HJRA 5AMXA 3VV2A 3ZXXA 1TM4E 4CFZA 1JEAA 4ZOQI 1XF1A 1P7VA 4AKTA 1PEKE 3GCXA 3Q5GA 1AK9A 2PKCA 1SUPA 1R64A 1NDQA 4LVNA 1TM1E 1TK2A 1Y4DE 3LPDA 4C3UA 3PTLA 3EE6A 1S01A 3F49S 3DVRX 2SBTA 2IY9A 2Z56A 2ID4A 4K8RB 5CW1A 3DYBA 1SBHA 2DP4E 3AFGA 1C9JA 1NLUA 2PRKA 1KDZA 3VV3A 1SCJA 3T41A 1SBNE 5JXIA 1DUIA 5AVKA 1MPTA 4HX2A 5B1DA 2W2QA 1T1EA 1YJBA 1KDVA 1R6VA 2Z2ZA 1EGQA 4J94A 3TECE 2PQ2A 4LVOA 1KDYA 3LPAA 5JXHA 1NDUA 1A2QA 1TO1E 3BGOS 3WQBA 4AKSA 1Y3CE 3UNXA 2ZWOA 3SQOA 1S2NA 1DBIA 3P5BA 3DW1X 1SCBA 3H42B 1TECE 1GA4A 5AVJA 5JXGA 3D9QX 2TECE 4DWWA 2X8JA 1GA1A 5SICE 3VHQA 2SNIE 2Z58A 1GTL1 4DZTA 1SUAA 3TI7A 1BFKA 1ZVKA 1BJRE 1SPBS 5AQEA 1PJ8A 3Q40A 1SBCA 1PTKA 2GKOA 1SCAA 4JP8A 1YU6A 1V5IA 5JXJA 4MZDA 1TM3E 3DE2X 3AJ9A 2XTJA 1SUDA 3PRKE 4OMCA 3GT3A 4FONA 3QTLA 2P4EA 5K7SA 1AU9A 1ZVJA 5B1EA 1V6CA 3WIUA 1EA7A 4YN3A 4BWGA 5FFNA 3ZXYA 3WIVA 4HVLA 2Z2YA 2Z2XA 2G4VA 3DE3X 4KG7A 3SICE 1IAVA 1P8JA 2PWBA 1HT3A 5JMOA 1TMGE 1T1IA 2Z57A 1GTG1 1Y34E 1SIBE 1Y4AE 2DUJA 1Q5PA 1SH7A 1IC6A 2W2NA 1T1GA 3LXUX 1BE8A 1Y48E 4DJ5X 1AQNA 2SICE 1Y33E 3DE6X 4NMXB 1OYVA 1C9MA 2SECE 1WVMA 1VSBA 3GT4A 1GA6A 1P7WA 1CNMA 3VTAA 3A3PA 4KPGA 2W2MA 4NE7A 3VYVA 1WSDA 3DE1X 1Y3BE 3EDYA 2ID8A 2W2OA 3DE5X 1ST2A 3I37X 3I30X 2XRMA 4CFYA 1AV7A 1SVNA 1SCNE 1GNVA 1C3LA 2DQKA 2QTWB 1WMEA 3I34X 3F7OA 4H6WA 1Y9ZA 2W2PA 3EIFA 2WUVA 4NE9A 2B6NA 1CSEE 5ARBA 1KE1A 2PYZA 1UBNA 2HPZA 1SUEA 3DWEX 3I2YX 2IXTA 1SELA 4GI3A 4H6XA 1TO2E 1AF4A 1SBTA 1WMFA 5ARDA 1MEEA 3LPCA 3QMPA 4CG0A 1C9NA 1SUCA 3DE4X 2X8JB 3VSBA 4I0WB 1AVTA 1GTJ1 4C3VA 1SCDA 4M1ZA 3DDZX 2ZRQA 3AJ8A 1KE2A 3DE0X 2PWAA 3DW3X 5ARCA 1AH2A 3BPSA 1GT91 3BX1A 3A3OA 1GCIA 4B5LA 3OSZA 1SBIA 1Y1KE 1TM5E 1THMA 3DE7X
chains in the Genus database with same CATH superfamily
2WFMA 1LWNA 4DDWA 1B74A 4MX8A 1ADBA 2GJKA 4MINA 5KTNA 1H4VB 1ZH8A 3GOHA 4TSRA 5B57C 3COYA 3SE0A 3QMMA 4Y1RA 3EZ2A 1D6MA 1T9ZA 1NU8A 2GLXA 2B61A 2P3OA 2YJ6A 1U02A 1ZD3A 2QYTA 4N18A 5EXDA 5BNIA 2HWKA 1BX3A 3O31A 4G1CA 4HGNA 5L53A 1FYXA 3L46A 4C0AC 4F4IA 2BCEA 1T8YA 1RAHA 3JALA 1RYMA 4KZKA 1QIJA 3D2LA 1Z34A 2EQ5A 3LY9A 4Q3AA 3NTXA 2UZ1A 3V8RA 2OQIA 3WRXC 3QPVA 4RDCA 1XJCA 1Q7BA 4CU5A 1CZKA 4TN1A 2X13A 4P5EA 4E22A 1V7CA 5J2UB 2QP9X 4EFMA 4LRWA 4MRMA 1GQSA 1WB5A 4MYCA 2OQRA 5LIPA 1SOMA 3QJYA 1U2GC 1YOVA 4R81A 1GG2A 3A8TA 2OBLA 4PHCA 1GV1A 2GZAA 2CWDA 5CB6A 3IIMA 4JFAA 2A6PA 4BJHB 3KBOA 1GL6A 3PYLA 3B5JA 5COAA 5FBLB 2YZKA 3VH1A 1XP5A 3ICOA 5DJ5A 5L7WA 3NALA 1YJAA 1IJKA 1JDBC 5LBUA 2OMKA 2EYUA 1JFRA 4JA0A 4G0VA 1RBMA 3IVRA 1EFAA 1EVIA 3MXTA 2ODEA 2XQKA 4C4TA 2PUJA 4WXEA 3AHHA 2DUWA 2RKWA 4ZC1A 4L5YA 4QO8A 4KLCA 4K9LA 4Z49A 4FGZA 1ODSA 4J8PA 1SOAA 3VR4A 1H0HA 1T2AA 3FMGA 5DM4A 1Y1LA 2GCNA 2WYIA 3L8EA 3KQVA 2VUTA 3UMSA 4M6WB 3WL3A 3WLMA 2R25B 3QLUA 1ULSA 4RCZA 5AUQA 1XDSA 1SIOA 2P8SA 1H2YA 2BBOA 3EMVA 3ST7A 1ADYA 5JD5A 3GFOA 2XGJA 1KH2A 3MTDA 4LWQA 2JJ2D 5AMXA 3VV2A 1OTXA 3ZXXA 5DMHA 2JFHA 3HR8A 3QG5A 3WYDA 3IHWA 4AMYA 3ZHTA 5GGYA 3MCVA 5L3ZA 1XF1A 4H77A 3L6BA 4IXWA 2XSZD 3MT8A 2DPHA 2WYHA 2YFQA 4CM5A 1DWQA 3AIIA 5HUQA 4V0QA 4C30A 1ZVMA 1IK6A 2LV8A 1DJQA 1A9XB 2XMBA 4DIDA 3O0TA 3OKCA 4YCJA 2QK4A 3BWCA 5ALLA 5L3SB 1NMSA 3N2EA 4TGLA 1XLUA 3E2IA 2O2DA 4HFNA 2FOLA 5LSAA 1Y8RA 1DIBA 3LY8A 2Y4OA 2XDQA 1FMLA 3ZV4A 3E7FA 1NP7A 3PUZA 2BSXA 2C83A 3Q9NA 3R3WA 4KAAA 2XWQA 2HSGA 1NBOA 4QATA 5BP7A 3QWFA 1Q20A 2G0NA 2OCGA 1E2LA 1N92A 1YRAA 1DKPA 4H18A 4TL9A 5LWQA 3LPDA 4BECA 3RFXA 2FNAA 2FPOA 3EGDA 1ORWA 4X20B 3ZWXA 2HRZA 5JS1A 3B36A 4YPVA 4D46A 4ENSA 5A3JA 3R5SA 4N48A 4Q66C 1SC9A 3K05A 4MB6A 4R0VA 4OPMA 2VBFA 2B69A 3U3KA 3ZTWA 2Y1DA 2W22A 1O6ZA 4PAWA 2RHLA 3H1PA 2WK1A 2R8OA 1TJ4A 1XPJA 2ZT8A 1EXDA 3CRNA 3NYIA 1RHRA 2VAPA 4FFOA 5D5PA 4ZJYA 4U5XA 1X7YB 4B71A 4UHJA 1QMPA 3ZI7A 2JK1A 2BHSA 2BGRA 3DF9A 1EBBA 5A06A 1RYFA 4B8WA 4MGKR 4DJEC 3VPFA 2DTDA 4LYYA 4LJKA 3MLAA 3A9UA 3F7TA 4KP7A 1QGAA 2PEYA 3W5UA 1N25A 4DUZB 3RU7A 3ED5A 4FEAA 3PEUA 4W7SA 5EC8A 1T5OA 4BQEA 2CVZA 4DPLA 4ZZ0A 3JTEA 4CM7A 4Q34A 1V1RA 2LD4A 3SEFA 2VHZA 4UHEA 3P0HA 2FEMA 2XXJA 2A8YA 3KYBA 4IDAA 3G89A 4W9NC 3PHBE 2PUHA 5LQRA 5I7SA 4G67A 1H9CA 1EESA 3H19A 1DBWA 2DBZA 2BKVA 2RI6A 4D41A 4DDTA 1ZIOA 4UTXA 5KTPA 1H4QA 3M2PA 4MPJA 4BWFB 4HV4A 5AICA 2R60A 4L4ZA 1GO2A 1WR8A 4IZOA 2HCJB 4GZ3A 1V11A 4LGCA 1QHFA 4I1PA 3NBUA 1DEXA 2WNIA 1KYYA 1GPAA 2VZLA 2Q1UA 2CMFA 3QLEA 3L5KA 1WPRA 5AVQA 4G97A 2PJDA 4HYEA 5AK3A 2PUWA 3UJ9A 1JZSA 4NHEA 1PSWA 2H1SA 4H4CA 3DOHA 4PQYA 3V4OA 1RWNA 4DLKA 4PC1A 2YFHA 2PUDA 4I50F 4UQOA 4M36A 1X8LA 1RMQA 3KJHA 2YTZA 2P2SA 3ISJA 1FRNA 1UBUS 3CW2A 2GM4A 4N0PA 2I87A 5KDOA 1NR7A 2QW1A 2A9RA 2Z83A 4EB6A 5HP4A 2EJVA 4J29A 3AY7A 3M9XA 2IU0A 1MUUA 4X65B 3KSMA 1IRIA 5CCEA 2QN6A 3DW1X 5DTIA 3BWVA 1GSIA 1YE8A 2ZJFA 3B6KA 4UEOA 1SXHA 5ALWA 2VDMB 1SCBA 4LXTA 1A1SA 5HM8A 4GXQA 1FPQA 3K96A 3LP5A 3QE3A 4L8FA 4MWZA 5JISA 2G28A 1TECE 2YDYA 1J9GA 2E87A 2FI1A 1VHLA 1JQ5A 2Q6IA 4YCNA 1KHHA 1S2LA 3ADPA 2H5JA 2WWVD 5B36A 3Q0IA 5JAQA 3WGVA 2X5JO 4ZO4A 1E64A 1G64A 4YMIA 1UC5B 4YRIA 3U49A 4RD4A 6ADHA 2H1HA 1M6NA 2HK6A 3TTYA 1MH1A 3PQDA 4FQ5A 4XVHA 1N77A 3VHQA 4RIGA 5C7YA 1PT7A 1A9ZA 4NECA 1IB0A 2W8BA 4WQMA 3W5AA 1YZKA 2IL1A 3H7AA 3MT7A 5ALIA 2P9EA 3N6RA 4MWCA 4KR0A 2IOFA 4PFKA 1HOXA 3D2CA 5DSZA 4CQNA 4N40A 1XFDA 4HXEB 4U7TB 4IIJA 1UAGA 4U7GA 1TUEA 2ATCA 3ZGZA 3T1OA 3AU8A 1XNJA 4B6JA 5I45A 2DU8A 3RSFA 3VH3A 1H23A 3JASA 3U39A 1JAIA 3GRYA 2WF8A 4EW2A 2QMZA 3RODA 1U3FA 2ZYHA 4YQYA 2OBYA 2BM8A 2UZ3A 1A96A 3I9MA 1Z0ZA 3D81A 3ZYZA 2Z3VA 5I9BA 1PTKA 4M7OA 4Y8VA 3WWOA 3N53A 3WNCA 3VU1A 2HIMA 1U1IA 3U62A 1DBRA 1J9EA 2J09A 4XSHA 2R5WA 3C4VA 4KFCA 4PN7A 4IIFA 1NWHA 2FVYA 3AVXA 4MWEA 2G6BA 3SSOA 4Z7QB 2J4FA 4H0NA 2XUAA 5JJIA 2ZJ6A 4DC1A 3I12A 3DO8A 5CT8A 3RS7A 4BBAA 4DQXA 4M88A 1BA2A 1P3DA 4MK4A 3QKUA 5DNDA 1HG1A 4C0HA 3NAGA 5A5FA 4HWOA 3PQ6A 5CBKA 5AFSA 1DPFA 1P77A 2FFRA 2HLNA 2NXWA 3JQ8A 3HCFA 3IIIA 4JJKA 1A5AB 4UUMA 5G4KA 3WBJA 3RS4A 1T0JB 3JQBA 4MROA 5KHLB 2IYEA 1YCGA 2CBZA 5KYUB 3ONNA 1C1XB 3IE2A 1W88A 3NTLA 3P9KA 3QTLA 1UKYA 2SHKA 5IKOA 5H68A 1V6AA 1WXQA 4LYAA 1HG0A 3QITA 1MO3A 3QPUA 3AM1A 2BZ1A 3PF9A 4WVFA 2CJFA 2MSKA 2FPPB 3K0FA 3V8NA 1EA7A 4C4RA 1CQJB 3HN7A 4BXOB 3WLOA 4EA8A 1V3QE 2KQUA 3C1OA 1W0JA 4JLJA 1ULTA 2GETA 3BDIA 1T6ZA 2KE5A 4GH5A 2P3SA 1K7SN 2VPQA 3KTDA 1PGPA 3PPWA 3WB9A 1J8QA 3V97A 5CBPA 3KPVA 3LX6A 1KETA 1LDMA 2GEVA 4EM6A 4ZGBA 2ZBPA 3A1SA 5L3QB 4KG7A 1C4KA 1KGDA 5JI3E 1W5BA 5DEIA 3PUJA 3ZV7A 4YT4A 3ZOKA 2C5BA 1A4UA 3S7ZA 2R3SA 1TJYA 3IVCA 1NFRA 5JAUA 1CUJA 1Y98A 1KJ8A 1EFCA 2PGAA 2F3RA 1Z8FA 3OJFA 4MULA 2PAFA 2XD9A 1B6GA 1T9GR 3C14C 1OI7A 1SKBA 1U0EA 4HFRA 3GIWA 3SAJA 5CXUA 3W6PA 3JR7A 2HMAA 1I0LA 4N0EA 3E5NA 3R5JA 2Z57A 1MAWA 1U31A 3L9WA 2E3JA 2D59A 3Q3EA 3U9LA 2Q0QA 2VSFA 4RXTA 4YONB 1HEUA 2GASA 4G23A 3LYHA 3VR6H 3SKXA 3G0HA 4QPZA 2VQSA 3VJRA 1OIXA 2DUJA 3I6QA 2F00A 1Q5PA 1RAAA 1IC6A 2LDBA 2QTAA 3FFAA 5EPUA 2Q8PA 4RX1A 1FUUA 5L3VA 1Y48E 1ISMA 3CLVA 1ZINA 3IKJA 3KHTA 4PLFA 3UHPA 4B4VA 3D0KA 2QLJA 3CX3A 3H99A 4B6GA 4UU1A 4BE7B 5C37A 5I7WA 5KS2A 1EBUA 1FC0A 3I2IA 2D1FA 2ZJAA 1WV1A 1L4FA 1FY2A 3BFVA 4HAIA 3ACDA 4XJSA 3KB8A 2VNIA 3KK0A 1UZMA 2JPDA 3S1AB 1TPZA 4ZKEA 4CG2A 1SULA 1O5IA 4IHJA 2BH2A 3U4GA 2GLUA 1DTSA 2CXQA 2QYSA 4HDSA 3COSA 3QUBA 3G5UA 3AWDA 1AX9A 2WOJA 2ZAIA 3Q7TA 3C98A 5EWJB 2ZJ4A 4Q1FA 3RFVA 4C3ZA 3MPUA 2G8LA 4PYJA 3WIOA 2VPWA 3OHMA 2I6QA 2QORA 2IZ1A 3LXXA 5B3LA 1ZK3A 4MGYR 4KWIA 4CCYA 4QPCA 3RFTA 3VO8A 3VTAA 5DEOA 1VKJA 3U7IA 3VH4A 3U5ZB 1D9XA 3SD7A 3PVZA 3IT2A 1KO4A 1X38A 4NE7A 4RJTA 2O57A 1AA6A 3BC1A 1EDEA 1WLYA 2QLMA 3QEKA 3AVTA 5KTTA 3LCMA 2QTCA 2GYVA 2VA9A 4YCDA 2UUCB 1DQNA 1E2QA 1GP2A 3WIEA 1P2SA 4ITVA 2JCSA 4JT9A 3P9NA 4ADSG 1QK5A 1VJTA 1WB4A 3FNGA 3PSAA 3K92A 1F60A 1LJ8A 4M7RA 5TY0A 3NVDA 3W9YA 4F5YA 1CTQA 2BKEA 3AW9A 4HAYA 4QOEA 3WL6A 4QDUA 5A4AA 1VRCA 2C97A 2TMGA 2XRFA 3QFCA 1DC7A 1SVNA 2VUHB 2ZYRA 3KDSE 4MPDA 1SCNE 5DCLA 3NGLA 3VM6A 2Q28A 4DADA 1UM9A 1W52X 2IYLD 3V8VA 5L40A 3GEGA 3RV3A 3SZOA 1WUKS 4TWJA 2XZOA 4CBVA 1N6OA 3KOOA 2ZSBA 3PNKA 1UKZA 5BSRA 4MCHA 2R8PA 5KYXB 1F0PA 4DNPA 1T2CA 2BEWA 2B6NA 2IE8A 2JLAA 4U7HA 5K3FB 3RK0A 4P3PA 5ARBA 1G9TA 4DW8A 1HYQA 3QG1A 4MQLA 2DFLA 4JGIA 4Q3DA 5ESDA 2QQ5A 1GZ3A 4D80A 2J9YB 4GGOA 1U4SA 4UD6A 3ZU5A 1HSZA 1QJCA 1U0FA 2BAGA 4LOJA 2Q5LA 4GMGA 5DH9A 3P4XA 3QWAA 2EFCB 3ZDBA 4DILA 4AZ0B 2AOVA 3QKWA 2NXCA 1MABA 4J0FA 3IE1A 4WXRA 5BVGA 1GOTA 1Y7LA 1CRWG 2YHUA 3A6JA 5I8PA 3MZ0A 3AOGA 1B42A 1LPPA 4NNOA 2GHQA 3S2FA 4F93B 2C5AA 3IP8A 3FWZA 2QN1A 3CEHA 4JNKA 2HNKA 5D7BA 4RFSA 3DE4X 1T91A 2ZFUA 3BF8A 2Y99A 2RC5A 4JLWA 3ITEA 2IS2A 2HXSA 4LRXA 2IDZA 3G8AA 4DBLE 3FKQA 2Z4SA 3LVQE 1P75A 2QQEA 2WWIA 3A9TA 1KSHA 4M21A 3Q0TA 3ZY4A 4LWPA 4LAFA 421PA 4M1ZA 4LF9B 3RIEA 5CJPA 1UFKA 4H60A 2XD4A 4Y2RA 3TJZA 2HLDD 1OYWA 1Z28A 4BNDA 3DGFC 4IR7A 4C6TA 4CF3A 3W6OA 1E4OA 3LRTA 2HQSA 3CUWA 4YAOA 4RXMA 4HJXA 1XTZA 1JXOA 3T3PB 3IP3A 2JAUA 2C9YA 3DPIA 4H9GA 4Z8YA 2ZZNA 2XI4A 3O8DA 1L5RA 1FSGA 4DG5A 1GCIA 1Z25A 2H85A 2XUKA 1OI4A 2WKRA 2ZZKA 4FMDF 3D8HA 1G9XA 4R1OA 3RFFA 4PPYA 2RAVA 2HREA 3LCJA 2Y3IA 1JVBA 1OVMA 3F97A 4D5GA 4UOQA 2P0YA 3DV2A 4HRVA 2I8CA 5KINB 5FLYA 4V2IA 4BRUA 2YXNA 3TAUA 1WP4A 4FCTA 1VLHA 1KI6A 4KOAA 1A76A 4PZLA 1GPLA 4MUEA 2HPAA 1EINA 3GCWA 2QIOA 4DJJA 3HM9A 3A0RB 3HDJA 3DLHA 4ABTA 5K0JA 3IBYA 5LZ5A 3T9DA 2DFNA 4TS3A 5FA6A 4W8OA 1DFGA 1CUDA 2BFAA 1EXNA 2XMZA 1X80B 2YVUA 1CQZA 2RGAA 5KBYA 3PNVA 2CUNA 1E3TA 4J3NA 4NDNE 4BNLA 3PNPA 1EUYA 1XX6A 4I6EA 2JGAA 1ENPA 3VHRA 2OEPA 4DANA 3OTWA 1OLUB 3IDOA 3K73O 1RMYA 3O2JA 4G0XA 1DWUA 2QG6A 3RM3A 2E89A 1GGJA 3OVMA 4P0TA 4Q4HB 3HYTA 2D1TA 5KHAA 1DU4A 4V0ME 4HUTA 5ERYA 4LBVA 2N1BA 3D0OA 2YRXA 4HPWA 4TV8B 4UVDA 1L5NA 3HA5A 4BO3A 4DSOA 1IFXA 2ZE5A 1ODFA 2YCLA 1WNFA 3NHJA 3U31A 1M75A 3EC7A 2QM3A 3GUYA 5IVIA 4M1YA 3JR3A 2GHIA 4OH7A 5TMPA 1W36D 4ARBA 3IVGA 5ERGB 3WKDA 1A4RA 4YDRA 1JKMA 1PEDA 3DAGA 1GXSB 4D9KA 3VKHA 2DKNA 2M6SA 2FJUA 3SLRA 1FDOA 5TF0A 3JQEA 2XE7A 3UOGA 4BFVA 2NO4A 4DS3A 3DZKA 1W1WA 4DEVA 3TI9A 4KR3A 1KEPA 4OBBA 1KYVA 2VXBA 3BBPA 4R8RA 2DWUA 3S8YA 3NEJA 1EK5A 3GPDG 3HH8A 3ZTYA 1GGVA 3KO8A 4FUQA 4C6SA 2M6KA 1NZJA 1BN6A 4H1WA 2WZDA 5FUQA 1YQDA 2X0KA 1DB3A 1PIWA 5CDFA 2OXTA 1I0ZA 1QE3A 3UICA 4KE8A 1H8HD 4B2IA 5JQGA 4NDZA 4G0WA 1JAZA 3K0AB 4KREA 3IPCA 4F7DA 4XQEA 1EBFA 3ETLA 2EFHB 3CWCA 3HV0A 4WK4B 5EQDA 3SS7X 3SXUA 1NLYA 2R48A 4NJEA 4AO7A 5H3CA 4RJJA 5ALTA 1ZCFA 4OU5A 4OMDA 3AL2A 5KJEA 4AG5A 1HYGA 3RJ5A 1XZGA 3ESQA 3Q5DA 4XPIA 3IEIA 1IDN1 1R0WA 4R8SA 4RDHA 4YJFA 5EZYB 1L5HA 5CFQA 5LYJF 4V0KA 1QU3A 1NUHA 4RK6A 3PGKA 2FEOA 1Q0TA 4ZTZB 1SUBA 4RD6A 1LI7A 3DT8A 4DB4A 3PEWA 3H5NA 3L0SA 3OZFA 4RL4A 1SC3A 3GCZA 4B3HA 4QAQA 4DV0B 2FDCA 2D1RA 1JEAA 3SZUA 3L4BA 3EGIA 4L7QA 3DB1A 2ZBEA 3GARA 1NP3A 5CIWA 3KBBA 1Q1NA 2WJVA 4CV2A 1FFDA 3AXSA 1ZO8A 4CKCA 1ILWA 1LH0A 3KYIB 3HVRA 1W4CA 3FYDA 3LY5A 4IMIB 3UQYS 1EJ0A 3WFZA 1NN3A 1R6XA 1L7BA 3VO1A 1EWVA 2V9PA 3KJXA 4IIDA 1RRKA 2GN1A 4O0MA 4L51A 2Y0BA 3KM0A 1UZAA 1BEUB 1BWPA 1EHCA 1PYGA 3H2BA 2D06A 1FZQA 1VI6A 1N2ZA 4LWOA 1E20A 4GWGA 3L8FA 4GOKA 4IMJB 3B9PA 1HGXA 1PUIA 2Q3HA 2FPUA 3KV3O 1O03A 5F7OA 2F9LA 2FW9A 3IO5A 5DWDA 4F9EA 2GNPA 1PKEA 1DBSA 4R8LA 1SD1A 1SHKA 3ESZA 3HDTA 4NYIR 2EX4A 2AVNA 2V74B 2YNMA 1NF8A 2EAUA 3EXG1 3H0CA 2A0YA 3KUKA 1IN7A 2C7VA 2IGBA 3MTIA 2P5SA 3P0FA 1GKKA 3BGSA 2FDRA 4RY2A 4MKGA 3ETEA 3H4TA 4FX5A 2HXGA 3GDFA 3KT8A 1TCBA 4IIYA 5K6AA 1NRXA 4C0SA 2GVDC 2HCRA 1BXGA 2BFCB 5GONF 1IN5A 5DGHA 2WWYA 5JD6A 2XMPA 2XDWA 3AVQA 4ZPXA 2X7JA 3PXDA 4J0QA 3RIYA 3U81A 1PDVA 2WZCA 4OKNA 4BDTA 3GJ4A 3KYCA 1C30B 3KXKA 5FT9A 3RVJA 3UJBA 2AJLI 1L9KA 1WU8A 4ZEXA 1P2DA 1RWWA 1UKCA 1WZIA 4N76A 2HMUA 1W25A 1FOEB 5BPFA 5KWSA 4TZ0A 1QFJA 1QRUA 3UG7A 1G20E 2FZ4A 2VP2A 2YXDA 1DTWA 1XEAA 2C00A 3SIWA 2JD2A 2GD2A 1N9ZA 3D6HA 3W3AA 5I7RA 5KTYA 2D7DA 2O3JA 3LC1O 1OROA 2BUBA 2XV1A 3D31A 1AKVA 2CXOA 3IGFA 4MIYA 4ARZB 2X23A 2O8DA 1OUMA 4MH0R 5F78A 3WR5A 2C2BA 2VRNA 4EVSA 1AXGA 1XV5A 5F1PA 3ET4A 3NDJA 4IHKA 2H06A 3PUIA 4OG2A 1LVHA 2IV7A 4G9BA 1TI7A 3UV7A 1ACJA 2EJUA 1E92A 1HSOA 1MO4A 1PJ3A 3PD1A 4O2BA 2VAWA 2N9UA 2J08A 3BCUA 1B8UA 3P2OA 1L7EA 1TAHA 2FEWB 4P3XA 2AGVA 3DKRA 4CIVA 5JZBA 3WLNA 4O3MA 4L0QA 6LDHA 2UYHA 2GRUA 2P7HA 1HYEA 3P8ZA 4NBKA 4ESVA 4Z53A 1UP6A 3SHFA 3EC1A 2NG1A 1SHZA 4AKSA 1SXJB 2QZ9A 2QL9A 4RSRA 3PC3A 3ELUA 4I55B 5CMLA 3BE4A 3QMVA 4UEWA 1EP9A 2ODWA 5CPFA 2WYUA 3RVLA 4FHZA 3T3OA 3O1HB 1XZBA 3DZJA 3VXKA 2WTEA 2X1LA 1CUFA 5D51S 4KIGA 4TQUS 3CLHA 5JJBA 2AI1A 3LBFA 4K9PA 3REFA 2B0CA 2FKAA 1WVGA 3VNUA 1IXSB 1M66A 4FDTA 1XA4A 3J7TA 4KVAA 2WDZA 3M4JA 4CQJA 4I1VA 3QLVA 2AXQA 2ZJOA 5BNFA 4TXNA 4LIPD 3NDPA 5FBQB 2JARA 1KYWA 5B37A 4AWBA 1K75A 1J21A 5JSKA 3ZK8A 1A9SA 3TZLA 1E4VA 2OHHA 2VHQA 3I09A 4NS1A 4CIDA 4AZ3A 4R2JA 4DEXA 1SVWA 1I6WA 4X41A 2V03A 4LNUA 4Q9HA 3IIJA 3EGWA 3K2EA 3TLGA 2N0SA 4LRTB 4ENTA 2QXUA 3RU2A 3JXEA 1TT5B 3HCOA 1BDBA 2XZPA 4ZC8A 4O2AA 3UY4A 5B6JA 2JIDA 1IY8A 4PVDA 3WRYA 2QD1A 3DULA 1UJ2A 2CNWD 4EVIA 2GS9A 3ELBA 4M46A 3LA8A 5BOSB 1HYHA 2C2HA 2CWWA 4WDRA 4FHEA 1F4PA 3H1AA 4NPHA 5IKPA 4H3KB 3C85A 4KO1S 3VA7A 5EFZA 4MDEA 5AM4A 1BFKA 1SKYB 1Q1BA 1WLSA 2A7XA 4FFMA 2CNKA 2C3PA 3X1YA 1BDHA 3TLAA 4TT3A 2XCLA 1D1PA 4QUIA 5AHRA 4Z9AA 3MCWA 3EPLA 5AQEA 1T34A 3IKLA 1WVIA 1WUHS 2A5GA 3TAXA 4URVR 1INLA 4I1YA 1IEXA 1XZEA 3AG5A 5KYGA 2ETVA 1G4HA 2DWCA 3A6DA 4B3RB 4MW5A 3UWKA 2HRRA 2C7RA 3B78A 4H7IA 4PX3A 3BTVA 4WKBA 3OEWA 5LN1A 3FDFA 4RYLA 4B3XA 4L5AA 1W5AA 2ASVA 2I99A 3B5IA 3FFBA 4AIIA 3A27A 5BMVF 3HUUA 1AHHA 2JNWA 2ECKA 2HJSA 1X1SA 4UPDA 2HA6A 1ZS9A 5DGCA 2C7GA 1O94C 2D0IA 2O3QA 1WPXA 3SR3A 5JBQA 2JHPA 2MSWA 3PXCX 4G4IA 3A4YA 3DZDA 1PJQA 3A28A 3MGAA 1NBEA 4GDMA 4NNPA 1WAMA 2BFBA 4WFJA 4HDMB 4G24A 3CZ9A 1MX3A 1LRJA 1WW2A 3FSEA 3FOCA 3LBNA 5IAGA 3KELA 1KMQA 2NSDA 2CNLA 5KNDD 3A6PC 3T35A 1JHZA 2FG5A 2X2EA 4AMBA 5DV9A 1D4FA 2BEJA 2HA0A 1CY8A 4HR7A 1Z2PX 2H9AA 5IZCA 2EF1A 3U37A 5K09A 1W0CA 1F8FA 2GJSA 4QDXA 5KYWB 4REMA 3RI3A 2B1IA 3RIHA 3T7SA 2VS1A 3S4YA 1YKSA 4LDJA 5LR6A 1FSFA 1OTHA 1CZOA 2BTQA 5HCNA 3FJ1A 4JT2A 1N7IA 3BXXA 4HG2A 3BEOA 1MG5A 5EE0A 4AJKA 4C08A 1L1EA 2CXRA 2XNHA 1KZ6A 1MO6A 2JIOA 3KYDA 2BGGA 1Z4NA 4F1WA 3PXBA 1TNDA 4P22A 2Z1NA 2WWHA 3RUAA 4ARVA 3ZCPA 3PA8A 1TU3A 3RUIA 5C1OA 2QL6A 2PSHA 5HPYB 5HFNA 4BHTA 4LOIA 1J0EA 2DUMA 2HA2A 3LGXA 4O5AA 4DIUA 5H3HA 5IXJA 4ZTUB 2VATA 3JTMA 4G1FA 4AJ9A 5JNWA 3HB1A 3SYLA 1G3IA 2ZE7A 4BEWA 5KWEA 5LD2B 3KU1A 2NU8A 1X1RA 3ROXA 3V8PA 4GMFA 4DLYA 1CP3A 1JWBB 1OAOA 2AS0A 2C42A 5CYGA 2HMYB 3EIEA 3JARA 4JITA 1RD4A 4KAJA 4X0EA 4CQLA 1R10A 2EGHA 1W59A 5C0OE 3PS9A 5JMOA 4UDXX 4YMWA 3R7DA 3ME5A 5A0TA 4XQCA 4HDNA 4A0GA 5C80A 2ERCA 4RMJA 2FA9A 3CSUA 3OP1A 1Y34E 3RQSA 2CMDA 3IT3A 1CJKC 3DR5A 4OVKA 1KZ4A 1FMFA 2OC4A 3N7UA 3ZYCA 1FSPA 5TPZA 2G5PA 2FPKA 3TQIA 5C7LO 4TV9B 2BYTA 4H2DA 3L43A 4S3MA 1KJIA 3B2NA 4OHKA 4BX0A 5AK0A 3UHJA 2CHVA 2FFHA 3ONEA 4P7FA 1I32A 5GV8A 3IUMA 3QJ5A 2H0QA 4GI2A 5FNVB 1GL9B 1NW5A 1LXCA 4RK1A 3BL5A 1QVRA 4X97A 5F77A 3U7JA 1G63A 2H9YA 3OF5A 3RUFA 3E1GA 3JD3A 3JQ9A 2IYVA 4UZFA 1I2DA 5J63A 4AMVA 3OOSA 2EFYA 4PICA 1C9MA 3B9BA 3S28A 5L4SA 4EELA 1EK1A 1O5TA 3AHCA 3E3NA 3JWIA 4O6VA 1SXIA 4L73A 4P08A 1HMYA 1N5DA 1GQOA 1X15A 3A6LA 4BS9A 2PMCA 1WU7A 1YVUA 3OCWA 1OBCA 3F1KA 3I01M 1K6JA 3LG2A 3L8GA 2ZJ5A 4F45A 5BYKA 4RVUA 1PWEA 2TMKA 3P20A 4X5OA 2V98A 1FRVA 1ZC3A 2I78A 2VJMB 1N2IA 1N4DA 1SCUA 1TTQB 2PRIA 4JYCA 4LTDA 4QBKA 5CH5A 4A73A 3W6UA 1IAQA 1J2RA 1P0MA 1B4DA 5JWRA 4NCKA 1F1JA 1H6DA 3QA3E 4LQLA 4XCVA 1JQDA 2FH5B 1SXJC 2GJ9A 2Y2UA 3AR8A 4HAXA 1ZEJA 4CM4B 1R66A 1NATA 4L0DA 5PGMA 1HUQA 3PYXA 2DJ5A 2ATEA 1LCIA 1T2FA 5D3MA 3AF2A 1OD6A 3ZLVA 4WRRA 4MGEA 4MKFA 1GR1A 2ZBVA 2HRBA 4X7BA 4MVJA 3S1LA 3EPKA 1FNCA 1RXSA 1YZGA 4IILA 1SQ0A 2Q5FA 4XXHA 3VPCA 4ARAA 3BZWA 1MFPA 5K4HA 3PDIB 6YASA 1Q0ZA 4FDUA 2BFPA 4TYWA 4ZDKA 3A06A 3MMSA 1HM5A 1F7VA 1DDIA 1BRMA 2PRZA 3IMFA 4HGQA 1JIIA 3NTUA 2EKLA 3WFJA 4GX0A 2QL7A 3RSSA 2DE0X 1L5YA 4XLZA 4MUXA 1SPXA 2F1HA 2ONCA 2NGRA 2QMEA 3FJOA 3CJRA 2NO1A 2ZWVA 3HN6A 4PAOA 3VAZA 4D8TA 2R1ZA 1W5FA 5B53A 2ZSFA 5BR4A 1CUSA 2HTFA 1YBAA 4UE2A 1NHGA 2R1VB 3AFHA 1P1CA 1L7VC 1DIOB 5I8ZA 4HLUA 4AY3A 1G8SA 1VPWA 4D9EA 1E89A 3QSGA 1I4LD 5G1OA 1GAEO 3URMA 2A2ZA 1KI9A 1P1RA 3IBCA 3OJOA 5H16A 2PS0A 5IDYA 5LFAA 1H1TA 1BVYF 5LOVF 1AZTA 1WS6A 4O4LF 13PKA 2P69A 1GUZA 2ODBA 2PKYX 2PZEA 3DHYA 4LZAA 5K51A 3D4LA 1MIHA 2P75A 4D6YA 4DVGA 1WOMA 1RP1A 2WKSA 2QJRA 1T8UA 4C14A 1M1YA 3C3MA 2ZYSA 5G4LA 4NZZA 1AMNA 4WL0A 3PWTA 4XOIA 1BKSB 5KVSA 5MN6A 2IPXA 3OPYA 4BJ1A 1CZNA 3LVRE 1HLFA 4U2BA 4WACA 5IKMA 5L6MB 3RKSA 1MOPA 4HX5A 2R2GA 1DAFA 2WZBA 1NFQA 1G0NA 2O3TA 3I05A 3PT5A 4CLEA 5EXSA 3F5DA 1GPDG 3H5TA 3CVWA 3LAWA 2WJ6A 3KJZA 3NRBA 4XRGA 5JJ5A 2CNOA 3IAS6 2C2ZA 2W6QA 2ZATA 2JAPA 3AJ8A 4HWKA 3N2IA 2PWAA 1J0XO 3CVVA 3A26A 5CXQA 3UPUA 5KOJA 1PZGA 4DLRA 5ARCA 4RHXA 4KWTA 1Z35A 3USCS 3ZKWA 3HACA 3T9CA 1L7XA 3GQBB 3OIGA 1T35A 3EPRA 3UK0A 3CCCA 3JQPA 5JCPA 4LF6B 4GX2A 4NONA 4CIAA 3AVWA 1P29A 1PR2A 1CD5A 3QXCA 4H7FA 4J1TA 2FEKA 3OEHA 5DHRA 2PO5A 2N3ZA 1I3CA 1Q7TA 1ZGJA 4TQAA 1Y1KE 1PV1A 3ZH2A 4F85A 4RO0A 4KIWA 1ESMA 1TM5E 5ECWA 4J2HA 1C2TA 2G9UA 4R2LA 1R0RE 1EDBA 4B6PA 4E2XA 1JWLA 1PZMA 4D0LB 3SIPA 1RWQA 3WFIA 1G8AA 4C4SA 4YT5A 1HQDA 1VL5A 1XL0A 1XVTA 4WBSA 1JB1A 1TVKA 1X1DA 2B7CA 5J5CA 2XKAA 5AM0A 1DC5A 5JVDF 1NWCA 3EVCA 3IUPA 4JB8A 3B38A 3AIOA 3D64A 4PIPA 1HDXA 3JYHA 3T3HA 2HR1A 2NAFA 5JNRA 1VLQA 5BR8B 4QHYA 4BU1A 3TLXA 5HMMA 4EHJA 1AA9A 3DGEC 4OP3A 5FHQA 1F2UB 1GARA 2ORVA 4O0LA 4YYEA 4QBIA 5ALJA 3QSYA 4JC8A 3WB1A 4QDJA 2OOKA 2XVYA 5TPWB 1XVVA 1QGDA 4QL3A 3HFJA 5I47A 1QYXA 3F2IA 4MUNA 5LD2C 4OFXA 4R8MA 4MUBA 4Y0VA 3FTNA 3ZDDA 4EJ0A 2B4TO 1JVSA 4Q47A 2WINI 3UJDA 4TQ9A 2FW0A 3QXXA 4LCBA 2G77B 3WWZA 5BSKA 4U5QA 2CL6X 2IYSA 4E7OA 3M6IA 3PNQA 2QWXA 3V4VB 2JGDA 1EM6A 2A30A 2W48A 2XJ4A 1XXLA 4OCZA 5DNWA 2W90A 2M9MA 1Q77A 2GZRA 4Y1GA 2B34A 3I4CA 3DUWA 3HKBA 1I1HA 1II8B 2VPYA 5TQVA 5BSUA 3ULKA 1PQ4A 1KMMA 2VHWA 1VMDA 4AB1A 3IR7A 4YS6A 4CE6A 1D8AA 1JG4A 1HRKA 1YDFA 3AP1A 3H8WA 3NC1C 1SVOA 1WEHA 2DMRA 3BRWD 5E4FA 8LDHA 1GAXA 4FUTA 3R76A 2QZJA 4UUAA 4MARA 1W49A 3DP9A 1MENA 5FUYA 1ORIA 1W4RA 2XAUA 1H6BA 3DNPA 4HY3A 2F3SA 2X14A 3UWOA 4ACAA 4MQFB 3R4VA 4OK6A 4FMPA 4RLHA 1I6MA 2VDPB 2NVBA 3GH3A 5BQ3A 1E4EA 1IIBA 4Q7QA 3RR2A 3ILXA 4F7WA 3QU5A 4LV8B 4PZDA 1Z75A 3HDGA 5JXWA 4V02A 1JB9A 5EMHA 2X4GA 1Y3FE 1ECBA 5AW8A 3TOXA 3X1ZA 2DPMA 4YCCA 4QU9A 4M9CA 4LSWA 4MR7A 3NWOA 2I6SA 3ES9A 4RETA 3ZLBA 3LP6A 3DVAB 4O4HA 3ZJTA 3CA8A 5T4FA 3OU7A 1W2HA 5EKSA 2IUUA 3ZXIA 2H5LA 4V38A 4WZAA 4DAOA 4OOFA 3UZUA 2C8VA 3RIXA 4QJ5A 4FMBB 2JANA 1C0PA 5FUVA 5EWLA 4TWAA 4CM9D 2FTKE 1MB4A 1PT5A 3QF4A 5IYZA 3GUCA 3Q7IA 2A0XA 1P33A 4NP6A 3DM9B 2F48A 1UFRA 2GN0A 1CV2A 2C4HA 3D3EA 1DDOA 3DFIA 4G0OA 4G2TA 4EK9A 1ZM4A 1V2GA 5CB4A 2AJCA 4POAA 1C0KA 3KYJB 3DBIA 4R0NA 1QO9A 4M8KA 1W5TA 4QJBA 4CWAA 3BG5A 3EOZA 5TSDA 2ZB8A 4C88A 4CVNA 4D5EA 5IN4A 1C0EA 2PQ0A 4ZI7B 2PD6A 3KT0A 5JH7A 4DB2A 2XDYA 2AL7A 2FW1A 4GR5A 5EJMA 1XRLA 2MCFA 4TLDA 1JLKA 2BZGA 1VJCA 1MQSA 2OXCA 4FCVA 4R01A 1BG6A 2YH2A 1TK2A 3KAPA 4A8JB 3G13A 2OVBA 5A03A 2DBYA 4XWYA 1Y4DE 4DJTA 3K4PA 5HF6A 2ZRHA 5B55A 1VBNA 2COUA 4ZHQB 2PSFA 2VSOA 4G89A 3WK6A 4OMFG 1WO8A 4QU0A 1ORTA 3D6MA 3MPOA 1DX6A 3NVKI 2FQQA 3RE1A 4OQFA 1SG9A 1KI1A 4ND8A 2DFVA 3JRNA 1Z47A 1G7SA 1EGMB 1FUEA 3PENA 3QYFA 5T64A 2UXCB 5JY6A 2GVNA 1PNOA 4IOJA 5AKHA 1ZK0A 4U7JA 1VHWA 1Y1QA 2A94A 4JIGA 3X1WA 5JSQA 2ZRJA 4YCAA 1XXHB 4EY6A 3FFXA 2P4UA 5JCJD 1JR3D 1NPDA 5K4AA 1KDRA 4HQNA 4DHWA 1PE0A 1L4KA 1Y7IA 2LXNA 4LDPA 3DH0A 3IB3A 2XWBF 4GKKB 2VRCA 1VLMA 3A2MA 3T7AA 3L84A 3OZAA 5LZ7A 4DCTA 4BIIA 5C32A 3GD7A 1IPHA 1IWPB 3GK3A 1DC8A 1K7YA 3FNFA 4NC9A 2UYYA 5AVKA 4D1YA 1YMUA 4YWJA 2OSVA 4R1SA 3T9BA 2OM2A 2W2QA 2RHTA 3E3OA 4MUHA 2AD5A 4ODIA 4UOZA 4URXR 3K70C 3JQ7A 1EI9A 4GW3A 3TRIA 3NLLA 4OM8A 3ZWWA 1JMKC 3UYLA 2GRAA 2W2LA 3NP7A 1DEAA 5SY4A 2HAEA 5PNTA 1UPTA 3KCQA 5LLDA 1FVXA 3ZWNA 5C8YB 4C06A 1XJ5A 1YR7A 1SXGA 3SF8A 1J7KA 3NBFA 4K26A 5DYGA 2OLKA 4EITA 3WIDA 1SWWA 2PHZA 3AR4A 3PQ3A 1W75A 1DBQA 4HQ0A 4L3OA 3STTA 4BFUA 1QC5B 3O8QB 2NMVA 3GX1A 1R9GA 3QQPA 4GR9A 1YFZA 2WVHA 3AZPA 4HEA1 4UMVA 1JJIA 3ANNA 3GN2A 1A9PA 2ZIGA 1R0BA 3HSKA 3OF2A 4ISBA 2JLCA 3VSDA 3CF4G 3ESCA 4UKDA 3IJ5A 2P9ZA 3DD1A 2C8JA 1VIYA 3A6FA 4KQGA 4YBZA 5SY9A 4H7KA 1ESCA 4OD0A 5CDSA 1FJ2A 2DHDA 3OHPA 4ZVUA 2CNDA 1OXTA 4OQNA 2JIMA 3LCUA 3VOSA 1Z4MA 2B1RA 1A2KC 3EA0A 4LJLA 4P7BA 1Z26A 2XQJA 4R9VA 2AX4A 4HDRA 1PU2A 4ZOLB 4ZAXA 4LKOA 1KYTA 1X1QA 4AS1A 3W7AA 2WEKA 2YJ4A 3GRCA 3JATB 4KXMA 1IQPA 4PO3X 3UFXB 3ZD8A 2ZCJA 3BOSA 2WA2A 4JI8B 4YUZA 4L9RA 4MVJP 1QQ6A 4XUEA 5A9SA 3DDOA 3F5QA 4OUDA 2B3DA 3VUFA 1Q44A 3GJ5A 5BXYA 4ZAWA 4LKRA 1TPYA 1FP4B 1RI3A 2OT3B 3QM1A 3K5IA 4I1OA 1E5DA 1M2GA 3HJTA 5JXGA 4I2NA 3AHFA 1LD3A 2NU9A 5HDQA 3JAWB 1R6BX 1UJMA 2IHTA 1HBJA 2X8JA 5TEWA 5I7OA 2F9MA 3QVGB 4JLKA 2L69A 5CT5A 1T3LA 3D3NA 1QOZA 3GLGB 4DA9A 3TX2A 2GKGA 2CB9A 5FBRB 1S7GA 3DCYA 4OI2A 2X4LA 4P1ZA 3AUFA 4EKDA 3H2SA 3VO2A 1BYIA 1XGKA 3VX4A 2WG2A 1GZVA 4EGQA 4KACA 2KI5A 5KNBD 5J23A 4I8DA 1QPGA 3DBRB 1YQUA 1QGZA 121PA 1IZ9A 1CJBA 1ODKA 3EZ6A 5FV4A 2BGIA 4RTRA 4Q1DA 4J07A 3H8VA 4OB8A 3ICWA 1Z7GA 3I9KA 4Q3EA 1RWBA 4PZCA 3RNOA 3OEED 4CM3A 1Z82A 4CV3A 1PFVA 1SPBS 3W1WA 1XTBA 2ACEA 2MSCB 3TZKA 5IC5A 1W581 2XNDD 1N0IA 2XYPA 5CLJA 1LU9A 5L4NA 1KEEA 1T13A 3U44A 4J0IA 1DO0A 4MR8A 4QGBA 5HMLA 4NV0A 5AKLA 3C8UA 3Q40A 4BMSA 4WINA 5G0UA 4LECA 3I23A 5HF5A 1C7FA 4R41A 1QKJA 5TGDA 5CFOA 1XZFA 3THSA 3BT7A 2WKQA 3HFRA 1LSOA 3P2MA 3BAZA 2VH5R 1QZUA 2ZB3A 3UC9A 1RBQA 2OORA 4P33A 2HZBA 3P71T 3DE2X 4NYMQ 4QNMA 5EVJA 2ECQA 1Y5LA 1G7RA 5GINE 1I30A 2QTFA 4BE9A 2XTJA 3WSVA 4WZBA 3OM8A 5LP6C 4V1CA 3I6ZA 5J4VA 1E5XA 3C5CA 3N58A 3N2KB 5TQ0B 1JGTA 3B85A 1OKKA 4B32A 2C5LA 2CFRA 3E9ZA 2JFGA 2ZB7A 3T5DA 4IGAA 3C7TA 4Q3CA 5FQOA 5HVNA 1O6FA 2JGNA 1RE1A 5JNVA 4U0JA 2OHVA 4CL3A 1LI4A 1B2LA 4FONA 1DEKA 2XCSB 1JLRA 3GLHA 1D1SA 3QKSB 3BRQA 4KDCA 1VLZA 4L3VA 4BRSA 3D6VA 1DLJA 3L1HA 3QHAA 1DINA 2YBEA 5LLSA 1PNVA 1NC3A 1GY8A 1T36A 1L7OA 2QPTA 4NOLA 2FN4A 3SQWA 5JT1A 5LQSA 1PJRA 4GOLD 1JHQA 1OF1A 4E30A 3RAFC 3WJAA 3X43A 3PV0A 3QGMA 2LDXA 3C6XA 4B3CA 4MV8A 4YYZA 3I2FA 1YRYE 3QEBZ 1C9EA 1LS1A 2XUGA 3WY9A 4Y9RA 2RKBA 3OKFA 2BI7A 5J1TB 1P9RA 1BHO1 2OFFA 3WWYA 4A8JC 5FOUA 2J46A 1R4AA 4ZANA 1QYIA 1YZ3A 3FB4A 3HVUA 4QXRA 1ZU4A 1OFUA 2QUIA 3OLQA 4O4IB 3KWMA 4D4LA 4JI2B 3SICE 1FYWA 2VI5A 2I03A 3FPBA 1UKAA 4MVJM 1H5UA 1U0NA 2Q2QA 2O8BA 3QVKA 4F8EA 3AC0A 2GQ0A 1PCXA 3B52X 4LG1A 2EF0A 3ZK7A 5CX1A 2O06A 1ZI8A 2ZDGA 2GO1A 4EG4A 4C07A 1EWKA 5J59A 4BNYA 3MJCA 4AJNA 2O8EB 1T1IA 4P5DA 1TT7A 3NVAA 4URWR 3KQMA 1WHSA 2OG1A 16PKA 4HWGA 1M2OA 3JWJA 4RZ2A 4XVRA 5TARA 4EEZA 1F20A 1Q2UA 1SZJG 3PA6A 4F2HA 3M5WA 1VMKA 1NQWA 1YB1A 3E5MA 5EQJB 3TKAA 5AW1A 1TC2A 4HUQB 3LXUX 5KWVA 3R8FA 1XDDA 1M34A 2AUNA 4E11A 2WU4A 2BPOA 3BWXA 4JC4A 5FOWA 4BL5A 5A5EA 4LE0A 1BROA 3U56A 5BOVA 1AQNA 3SFZA 1XRRA 3EOBI 2FPGB 3DE6X 5DZSA 4D0RA 2YS7A 4V0OA 4BMYA 2CDCA 1HDZA 4GPTA 4A3SA 1Z4QA 2X5NA 3WRWA 1R0SA 3AI7A 4CMBA 2Z9CA 3EYWA 3IJPA 4NCIA 1F6BA 4DMLA 5FL3A 3EB9A 3BGDA 1RAGA 2OGTA 5E7JA 1P91A 2GERA 3ZI4A 2I3ZA 2VT3A 3PXAA 4FWBA 4GLJA 4YI3A 4EQ6B 1KKLA 4KRGA 3U6BA 3BMCA 2JLVA 1X7ZA 4WJZA 4ILKA 2ZU6A 4C22A 5BQFA 1K98A 2IHYA 5KVAA 3VDRA 4JSTA 2VYND 1ZOPA 3R0VA 4RD3A 2GCEA 2VPPA 3EIUA 3HCPA 3H5LA 1Z9BA 1FDVA 1CNMA 2R87A 1OI2A 3EQ2A 4QBHA 3A3PA 3O3OB 2HWXA 4WK2B 5G02A 1Z63A 2QUAA 2O7VA 2CW5A 5FYDA 4P9NA 1RABA 2WWFA 1JFVA 4O1MA 4BY9E 1N6LA 1MV8A 3EODA 3KKOA 5DGIA 5AHWA 1LW7A 4MIOA 2VRBA 2YRWA 4DV3B 1J49A 2ZI9A 4JUIA 1EE9A 1E0SA 1A88A 2C54A 2AOWA 2AG8A 4GBJA 2Z5GA 1XCMA 5BQ5A 1L5KA 4IO1A 2VTKA 3VPBA 1W87A 2Q27A 4G4GA 4PHFA 3ZW7A 2XRMA 5AOVA 4IRXA 2JCXA 5CA1A 2BT4A 2C9DA 1IZYA 3BICA 1OPRA 1W85A 3EXAA 2F4VB 3P2JA 3ZDZB 3KZXA 4CFYA 1NVGA 4D3FA 2ES4A 1ZMXA 4KE6A 1UXGA 1CHNA 3GMTA 4OF4A 4TMFA 3VPSA 4FN4A 2WW8A 1D2GA 3GJYA 3RS8A 3HJCA 4F5EA 2R85A 4JR0A 4PR0A 2FX3A 3OQPA 2YFKA 1K5PA 5K8IA 3MMPA 5BQOA 2JLWA 3ND5A 4C05A 2XUFA 3SPXA 4CMAA 4S05A 3TBHA 4RVGA 4TOIA 3PITA 4LJ6A 1H9AA 1CSEE 4QFBA 4R2XA 4CDMA 5A3RA 1KWKA 1RYZA 3KV1A 1U04A 4LVCA 4QXOA 3GVHA 3LW8A 4UCWA 2H6EA 4DA6A 3QNMA 3X1XA 2WUDA 3B1KA 5JS6A 1U3DA 3MD0A 1OLXB 1YA8A 3EWAA 1AN9A 4RK7A 4GI3A 5EEHA 4CNBA 2PN1A 2W9XA 1ZRHA 2A9FA 1AF4A 1LDYA 2QNBA 3FDXA 3CYFA 3MWJA 3I8SA 1WMFA 1P60A 5C5IA 3WYCA 1O3YA 2GCPA 1AXEA 3GPIA 3HNRA 1Y6GA 3BDVA 4ZO6A 1KOGA 3ICCA 4TVBA 3GLTA 4AC9A 2GH1A 3IXMA 4FHGA 1GHTA 1R50A 1DJLA 2I55A 1MZVA 1PUXA 4I0WB 1KI7A 3HQ4O 5B3KA 4XA8A 4CR7A 1SCDA 2XB9A 3FOBA 1HQYE 2G08A 1A9OA 3WQSB 2ZRQA 4B6QA 1DIAA 3L1IA 4G5QA 5H02A 1V7PC 2IHJA 3UIEA 5FFMA 3TZEA 2V4UA 1MH9A 3IPAA 5DBIA 1QPZA 4NBSA 3I8XA 2BBWA 2XCOA 4B6SA 2ZIZA 1JE0A 1PJTA 1PWYE 2YHBA 2WD7A 5LUBA 2Y2VA 3OLCX 2Q9BA 2WWGA 2WHPB 1QO7A 4GR4A 3TUIC 1LX7A 2VTVA 3AKCA 4NAUA 3COVA 2PKWA 2O0LA 2DTXA 2W6CX 5IBPA 1NW9B 3HCBA 1ZMBA 4XM0A 1M83A 3HFSA 1VHJA 3OAAD 4KLZA 2HJGA 1CDDA 1P18A 3FZQA 5CP8A 2XYHA 3TGPA 2V8OA 2ADFA 2YMMA 4JQSA 4UTRA 4LV5B 5CM8B 1FRQA 3QVOA 1Y8RB 1U9IA 2OKGA 1Q6ZA 3KNZA 2XDQB 4GLBA 4WOKA 3VC1A 1G6OA 1BD4A 1QHSA 4B4UA 1PT6A 4RH1A 4W1SA 1YI1A 3EF3A 5EP3A 3RSQA 4CDRA 2BFDA 4DJAA 5BSGA 5BW4A 3RJZA 3DVSX 2R66A 2JJ2A 5K0TA 3M34A 3MJVA 5T4EA 1QP4A 1CIVA 4HLNA 3NBZC 1E4YA 1Z4PX 1ZD8A 2XSZA 3EFEA 4QBTA 4UXJA 1B6TA 4P80A 5DHPA 4MMYB 3ODPA 1I2ZA 1FUKA 4C5BA 4OHOA 4E0BA 5BY2A 2JF0A 2O1WA 2W6ID 3JSXA 1JHDA 2HSDA 2XGGA 4NQRA 4ZAGA 4F2GA 3FOAA 1UBMS 4K88A 2PMBA 5FD8A 2Q7XA 3RWMB 1YDHA 3C1AA 2OHJA 2QTVA 2ZAGA 1PFGA 4N82A 2IV2X 1UXJA 2HD4A 2NVUB 1K8ZB 3OKAA 2FW7A 4IQFA 4XDYA 3T1YB 4TROA 2JFUA 3C3KA 1QHXA 1Y6QA 3GNQA 1U63A 1BKDR 2EX0A 1N6IA 2INGX 2MMGA 3ENNA 3KXIA 3FLMA 2EBFX 3OZ7A 4LW8A 1RAFA 1U2QA 4HGYA 4V3BA 4JQZA 4CIXA 2AR7A 2JAXA 3FWHA 1OYOA 4BRZA 4FGLA 1OGJA 1XQWA 5KSYA 2IQ5A 4OJQA 4EG7A 1L8QA 2CHGA 4OQXA 2VVTA 4DWVA 1OLOA 4CIYA 2CV2A 2Y93A 2QV7A 2KMLA 4Q15A 3WGZA 4DPKA 2C5FA 1KZHA 1GZ4A 1QCCA 2VSXA 4LFBB 3AJDA 3OM0A 1T4CA 1K06A 2G7MC 2GD6A 3FVVA 2C2OA 4RYDA 1XZLA 2PGOA 3JS5A 2A9KA 2WV7A 1DC4A 4URZR 2O0JA 4DCMA 4GYKA 5KWJA 3TZBA 4Y3UA 1GGFA 1QRRA 1YO6A 4KVGA 1Y3DE 2BGLA 3FTPA 1U7OA 1V11B 2A5FA 1NRWA 1P7ZA 3SLKA 5CA0B 2WM8A 1Y7PA 3BK1A 2LP4Y 3QFHA 2VR1A 3R3JA 3I6YA 4OV6B 4R05A 1NXVA 2UYQA 3SX4A 1GU7A 1RZRD 1G8FA 2V7VA 1NKSA 3THOA 4EZIA 4GWKA 2O5RA 1XB2A 1HF3A 1H6CA 2VTEA 3KCNA 3AEKA 1WUIS 3K4HA 1CHDA 4JJ4A 1PWHA 2V5VA 3IQWA 4MKHA 4XI9A 3AONB 2B92A 3TCXB 2XMQA 4CFZA 2XGMA 4AG6A 4P84A 1VI2A 1TFRA 1ZY2A 5AI5A 4MUFA 5A6SA 1VJ1A 3L4SO 2ILVA 3L7MA 1PEKE 2NZ2A 2UVDA 1MPXA 4MYTA 5DBOA 4WH0A 1BTOA 2Q99A 1C7RA 4I9GA 4ZYLA 1V8OA 4F0JA 3KR1A 1DKQA 2ESRA 3NV9A 3K15A 1UJBA 1JEYA 2AFHA 2H31A 3NANA 1SUPA 5DN6A 4AUEA 4AN4A 4J03A 3NT5A 1GPUA 2F1JA 1EFPA 1HNNA 2RFLA 3M9WA 4XD7D 1JR6A 5D1NA 3UPTA 3OZGA 1P9OA 4YECA 4GVPA 1BEZA 1RPNA 4CM1A 4DM4A 1KQOA 1GQQA 3DONA 5A6VA 5B7GA 4K87A 1JLSA 1LV8A 2JD1A 4KN8A 3OX2A 2W8BB 1NQVA 1PD0A 4ITRC 5FRDA 1Q50A 2K2WA 1AKTA 1CY2A 1Q0QA 3IALA 3LKDA 1S1CA 3SXPA 4ZQHA 3ETDA 3ZHSA 1YR8A 5JZMA 2YVAA 2OBFA 4HB3A 3OKPA 3F0TA 1DAIA 1F12A 3WK7A 1VMAA 1UMCA 1OU0A 2R1UA 3Q7EA 4FKZA 3WKAA 5M7EA 1I2CA 4YAGA 4AN1A 1OBVA 1H69A 3JASB 3NONA 4MJLA 3G9ZA 2FG6C 2I2DA 2FV8A 3ENQA 3BZBA 3KKNA 3BBLA 1KS2A 1PG5A 1SHJA 1IH8A 1L1QA 2EBUA 2DR0A 2MU1A 2NX2A 2WIJA 1W47A 1TD9A 3K0CC 1NI4B 1SCJA 3L01A 3TH5A 4PYMA 1IBRA 3FMVA 4LY3A 5JD3A 5J43A 5JRZA 5B6PA 2X9GA 2OQVA 2QPLA 4J0GA 1RI1A 3LYLA 3VZDA 3TYXA 4E5UA 3CEMA 4GGPA 5KUTA 4ZQFA 4NAVA 4Y2SA 1JQ3A 4NQZA 1DBVO 3MGGA 1G59A 3ET5A 2ATVA 2QVLA 2VUSA 3AGQA 1SKMA 3MIIA 2CKDA 3QLUC 5L51A 1P0PA 1U8UA 2GPSA 2HDOA 3RG2A 3JV7A 3VSCA 5I51A 4RTPA 5CT6A 3T5GA 3O4RA 4LGMA 4R1QA 4X1IB 3JQ8B 3HVIA 4RH3A 5G4KB 3HBNA 3L6DA 1IULA 2Q6VA 4IDEA 1NURA 4C4PA 4D3XA 1M1ZA 3HKEA 4DT1B 1KDYA 4ZV9A 2ZBQA 4B6OA 1MVLA 5IJXA 4C4YA 3LBIA 3OFSA 1BD3A 1W88B 5CFRA 3DHNA 3WGNA 5KNCD 1LZLA 4ISCA 2JJQA 3WGYA 3S81A 4S1NA 1P1HA 2XQGA 4I50A 4WMLA 1ESDA 2ODQA 1LB1B 1QHIA 3R6DA 1L5FA 2Q5QA 1UBGA 3PDHA 4D9MA 4ZYUA 2JKYA 5AM3A 3GLVA 3K8QA 3DAFA 3IQXA 2JFNA 4C0WA 2VT6A 5ESWA 2OO3A 3O5AA 1NXXA 2IYFA 2D1SA 3KTOA 3VVCA 1P6QA 1Q0SA 2PVPA 1UIRA 3KB2A 2JCYA 2H52A 1H5QA 1C2YA 3ZCXA 5B4TA 2OG2A 3P97A 3F8WA 3LBAA 4EPVA 2WJZB 4I81A 1T10A 1F1BA 2P41A 1OFGA 1GTMA 5TMBA 1I1QB 1GCUA 2P91A 2Z04A 1GRRA 1VGRA 3GA0A 3LHDA 5AK5A 5AYVA 3UANA 2J5RA 4JLAA 3NHUA 4O4JF 4RSMA 1LPBB 5DTQA 2X3UA 1DUSA 1EZ1A 4B83A 4DLVA 2CXSA 1LQUA 3CCFA 3GNTA 4UE6A 4UOEA 2WSLA 2GA8A 2ZVPX 2GEKA 1QG0A 1IM5A 5T67A 2AKAB 3EVEA 2EATA 4TRMA 1DGQA 1CXZA 2GZ1A 3VJKA 3HBFA 1IHXA 4FINA 2ZRAA 4FYMA 5AP9A 4JWKA 1ZQ1A 5DYIA 2YW9A 1RP7A 3KEMA 2Y1XA 4UFNA 5A04A 4A2QA 2ZBFA 2FSIA 4ZOAA 3U2QA 4KR9A 3V48A 5KOYA 4RNCA 4ZAZA 4DLXA 3WGTA 2OA0A 1QFMA 5JMTA 5KMGA 1LBHA 3GHYA 4IICA 1PAUA 5KJ6A 2YINC 3C3BA 3EGCA 1EVJA 4JVLA 2IHKA 3ITNA 3R1IA 1P17A 1AKNA 5FDFA 1GTSA 1I1OA 2WIBA 2F17A 1I24A 3VR4H 3TQRA 4CN9A 3HYNA 5KSZA 3FUCA 3EDRA 2AR9A 2EDAA 1ESNA 2QD2A 2Z5FA 3F90A 3G3EA 2NXJA 2BFFA 3KDAA 1CUAA 3AKDA 4FEYA 4GZ5A 5CNKA 5F3RA 5J2TA 1X7WA 1QYWA 1JAXA 3PDWA 5SY6A 2X9QA 3BWBA 2Y0PA 1BO6A 2NNWB 2ZI6A 5DN9A 1SBCA 3AHEA 3NGXA 4PANA 4WEOA 2Z98A 8ABPA 2GKOA 3J7AC 3DHVA 2DUUA 3IR6A 4GMDA 2LUOA 4KK3A 3DV9A 1U2DA 4ID3A 1BWRA 3NMUF 2C3MA 5C5CA 4PINA 3WC4A 4CCYB 2V55B 3LUDA 5FV7A 4DYDA 4AO8A 4JA2A 4YAJA 2YWFA 1V45E 5CEJA 4N12A 1NJ1A 2NTVA 2JRLA 1I4EB 1QYRA 4ZDWA 4M38A 1QP0A 3H1GA 3L8ZA 4AT1A 1D5CA 4NFHA 4HNVA 2I67A 4OQZA 2H63A 4FZ3A 4PG8A 5LL6P 4M8IA 3ADDA 4L4YA 1Z73A 2CLSA 4ICIA 4PCVA 1LTHR 1SIWA 1Z0IA 3TLCA 2O9JA 1BQEA 3IOYA 1VBMA 2AOUA 4FOOA 4N7JA 1QRDA 4OJYA 3NNDA 1FDIA 4GPAA 1LGYA 3LC2O 3MS4A 5JNUA 3GRZA 4RK0A 4HDAA 1MO5A 4KQJA 1IZ7A 4QVGA 4DV4B 1AURA 4RTNA 5LBIA 2OK8A 3T34A 4QDZA 2IYTA 5EP2A 3VC7A 3PFHA 1F0NA 3OM1A 2V3WA 3GGGA 1SVSA 1D2CA 1UM9B 4FEGA 3KTFA 5F5LA 1UK8A 1SQFA 3JVVA 4IJUA 1TAQA 1S2MA 1Z08A 3WIUA 5AJHA 3LLSA 3GD5A 3LUKA 2KX7A 1UKEA 4WTOA 1NRJB 3WKBA 5AVUA 3A37A 4R9SA 3I1IA 4MKRA 1ZGGA 3RRYA 4C76A 2ZVDA 1V1JA 1BE1A 2BEWB 2FUKA 2IVZA 2QN2A 3HU1A 4BWGA 4JGGA 3H1FA 2MTBA 5FAKA 4Q9JA 2I6TA 3FHLA 1MHPA 3ZWCA 1J6UA 3KE9A 1VB5A 5DASA 3EXEA 1TYAE 4MPRA 4ZVNA 2HIHA 1U8EA 1MABB 3HP1A 4AW9A 1O6GA 1QM5A 1ZNZA 4MVYA 2WRZA 4Y2PA 2RHBA 4WN9A 5FO0A 1BFDA 1X1AA 2DJIA 2F59A 3ZD9A 1ENZA 4L1KA 4TZKA 4JCCA 1KY4A 4BB9A 2QRHA 2IOYA 3B3AA 4KI0A 2XE6A 3KKLA 4TKLA 3NKVA 3KLNA 3GUZA 3EXFA 1COZA 1U1EA 4RFSB 2CNBA 4RPCA 5KSWB 3CRVA 4KE7A 4Y2UA 2GT1A 3UAVA 5CIYA 4LPSA 2JFWA 1IXRC 3PU6A 3PR1A 1CW2B 3DTVD 2A9PA 4RTLA 2HSEA 4ALJA 1VSQA 3MWGA 1AMUA 5K3AA 2X86A 3GGCA 5IM5A 3BKWA 1RWMA 3GXBA 4YXFA 4GKAA 4BNDB 3GRVA 4W5TA 4C6TB 4JP5A 4RY0A 4TRRA 5BQPA 1QNFA 5EIHA 3OSUA 1N9KA 2XNJA 4MWTA 3K4QA 4YH1A 4E7PA 1W4LA 1XD8A 3L0ZA 4KVFA 4HJRA 3PCRB 3WA6A 1M6YA 1R8YA 2QMUA 2WG1A 3K53A 4IIHA 4MAMA 3ZDFA 4C04A 3SVLA 3F96A 1UK6A 1X7XA 1YCHA 3OURA 2BJHA 5HILA 3Q5EA 3NTRA 1G66A 1X7DA 1YUMA 1OAKA 3BFKA 3N7AA 5HIMA 2NP7A 4OLHA 2AK2A 2E6UX 3GFTA 5DBGA 2ZM5A 4KOEC 2YY7A 3INTA 4OP1A 4BKOA 4YJHA 4XWOA 2WQ6A 3C5WP 3KQLA 3N86A 4S35A 4L0MA 3WVNA 3PIDA 4XARA 4ZYWA 3RC3A 3FY4A 2HLDA 2YQ4A 1KI6B 4K9OA 1Y5IA 3B6JA 5JDIA 3HHPA 3QI2A 3G68A 1G4AE 4QBFA 3FTFA 3RTDA 1HX7A 1MZPA 4U2GA 4OQPA 3U40A 3CR3C 3E27A 3SEQA 2G70A 1WSDA 3CSDA 1THGA 4AS3A 3CXRA 3DR3A 3AY3A 1HFKA 4WUVA 3UAXA 5I01A 1UADA 4WLVA 3L93A 3F8SA 3VZQA 5L7YA 2C5EA 3FR7A 4M1TA 4DWOA 1Y3IA 1E18A 3UMBA 1R7RA 1UDAA 1TYCA 4JUCA 3E9EA 4X6XA 3WLLA 5K0CA 1YR6A 1OASA 2CE7A 4DMFA 3ACCA 3IVAA 1NLZA 2F90A 4OQYA 4ARUA 5AVRA 5LMCA 5AUOB 221PA 4M3NA 4ZVRA 3PLNA 4HQOA 4QOSA 1XTKA 5AOAA 1FMJA 3S2EA 4G8JA 3RS9A 1XROA 1WMBA 1C1DA 2QTWB 4CKBA 4DL9A 1Y7TA 3E22A 4BFYA 5B7QA 3C4QA 2CF5A 1BQ4A 3IB6A 5CG1A 4V1CI 4NCAA 2W70A 2O2JA 3JZAA 4GM4A 5GP1A 1NOJA 2ONKA 1MX9A 2VHXA 3A9CA 1YB2A 1E0DA 2E4WA 3MWEA 4PRLA 1U28C 3KVRA 4ZVOA 1JHVA 2VK8A 3DYIA 3HXLA 4O29A 2D5BA 1P4HA 1T9BA 3CGGA 1XMSA 4I3GA 4QXMA 4EA6A 2R7AA 4XIGS 5A62A 2Q3LA 1E2KA 2O23A 2OO5A 3EAQA 3O6VA 4IV5A 4Q3NA 4UM7A 5HDBB 1OB2A 1NNEA 2DRIA 2XBUA 5UKDA 4PYQA 3A4VA 1P39A 4X84A 4X64B 2D54A 3UA3A 3O26A 3O4IA 5JAZA 4FBMA 4M1SA 3AETB 5GY7A 3K1ZA 5COBA 1CBUA 2Q4TA 4LFCB 3SXUB 1JQBA 4NJEB 1W9MA 4ZVTA 4DMCA 4YJ2F 3UT5B 3ZZTA 4D9IA 4HNTA 3IUNA 3V2GA 3LF1A 1U5BA 4J7UA 4RS4A 1GTJ1 5F2NA 3ZE2B 3WGGA 1NNLA 1L5HB 2BEKA 3C7DB 3R20A 5A05A 4EGAA 3RVPA 5EUMA 4E94A 6REQB 5T6MA 1J25A 5HKKA 4KTTE 2ZJ0A 1GKYA 3PC7A 3U1BA 5L8VA 1QAOA 3DW3X 4ZJZA 2K2QB 4YALA 1H8HA 1Y0BA 4JBIA 1QHNA 2ZI7A 4IHQA 1WB9A 1B1AA 2WIAA 2D2XA 3A3OA 3LX4A 4R9UC 4BV9A 2NTEA 3E82A 4CKCB 1ABFA 2ZDHA 2B5VA 3Q9LA 1EFHA 3FDIA 4AQ7A 2HEIA 3D0QA 2ZKLA 3C8HA 1Q11A 1UJ5A 3QYPA 4Y67A 3ZVRA 1FS6A 5FTKA 4H7EA 5FL7D 2EQBA 4XAQA 3OH8A 5DMXA 1D2RA 4RHUA 2E49A 3FRHA 2BFEA 3H9EO 5JAMA 4QDKA 2JLRA 1UZNA 2V7QD 3PC8A 3K6SA 4MITA 5AVZA 2X42A 1IY9A 4G5FA 1ZN2A 4BNXA 1K92A 3FVWA 3HVJA 2VPXA 4AKIA 2CBXA 3IUYA 4BV2A 2NSJA 1SN7A 2QT1A 1EGHA 2WNHA 2HA4A 2OUIA 2UYOA 3VR6A 1QB7A 2BSQA 3DMHA 3BK7A 4GZLA 3K2IA 1RR6A 1R5BA 2C5SA 1SM4A 3PGLA 3R40A 5CU7A 5BPHA 4TL7A 1AO0A 3O03A 3LQ2A 2CDBA 3Q3HA 5DNAA 4F12A 4BO8A 4JJ6A 1WNTA 4Y1FA 1BDJA 5ICEA 2XUQA 4LEIA 1XZMA 4N3NA 4RORA 1A5BB 1BXGB 1FX1A 2BCJQ 1RCUA 3GRPA 4GYJA 2BM0A 4EARA 1V8ZA 3C3DA 1VCOA 1DG9A 1KH1A 1YS6A 1HDYA 4NABA 3ZGYA 3DP7A 4JC0A 3PNBA 521PA 3LC7O 2P9CA 3KSZO 3KYCB 4REQA 2QM0A 4HQLA 1OC4A 1Z2AA 3V9AA 1TLLA 3IOCA 4MA0A 1MRNA 1FS5A 4MVJE 1WMDA 2X4IA 4GMHA 1KJQA 1IG3A 4LDRA 1L8AA 2FUCA 3GL9A 4G5RA 1E1CA 4JAVC 1T8PA 1O8BA 4RQAA 3R7WB 4EENA 1MO2A 3CZCA 2R1TB 2UU9B 2IDJA 2X6RA 1T0BA 1B15A 3LC0A 4IGKA 4DE5A 3A3NA 4ZEWA 1QR2A 4H6VA 2Y05A 1XEWX 3AP3A 1QGYA 2YX1A 4B74A 4AQYB 3H1TA 1DJPA 2O8DB 1E7SA 3PYMA 2AG5A 2QUBA 4WFIA 1GLVA 3OQNA 1CQXA 4WKPA 1BE6A 4GRDA 3LQ1A 4M53A 3CZPA 4GBMA 4UHDA 3WGHA 5F2OA 5BT8A 2F3UA 1CUEA 3B2EA 1TKAA 4HB2A 2P5YA 2WU3A 4MS1A 3HA3A 5LYJA 2W98A 1FCJA 3T0GA 2VJKA 2W4MA 4B2YA 4ZYXA 2GEDA 3UTCA 2VG8A 4UNNA 1KRWA 4DSNA 2ZI5A 1T8WA 1JX6A 1OXXK 4BPBA 2PT5A 3D8RA 3PPIA 3GLRA 4GBED 2NN3C 4E5SA 3F46A 4PG6A 4GSKA 1SY7A 1M1YE 1DKOA 1ARZA 4EJMA 3QK7A 3I45A 4G84A 3ENZA 3HJRA 3TEJA 1Z0DA 1J56A 4LY9A 4U9UA 3V34A 2QP3A 3T5BA 1AOXA 3KPWA 3R7SA 2JA1A 3PLAE 5JO9A 2ONJA 1P7VA 3GZNA 3MJDA 4JVMA 2O5VA 4F71A 5G0VA 4UW9A 1WDLA 2J3DA 2WWWA 3UOAB 4XX0A 4CEJB 3Q5GA 4PYKA 1K3TA 4OGGA 3B7WA 3C3PA 2GMWA 4AZ3B 4DGSA 4NOJA 3UATA 1A95A 5KWIA 4C0JA 5C7OO 4LNUB 2YFYA 3IRUA 5CXXA 3TLGB 1WSWA 4JHLA 4P53A 2QBYA 2IVFA 4W7HA 4KJZA 4ZALA 1VTKA 5BN4B 3EZ7A 3O75A 3QPWA 4A0SA 3TQHA 4BGIA 3FHJA 1GTVA 4BWVA 4KHPB 4QQKA 1QGED 3WQQA 5E4JA 2PCLA 3COZA 3E9DA 5FWXB 4U2EA 1J00A 4IGFA 1E7RA 1HO3A 1IVYA 4GNRA 2ID4A 4KQWA 2B0JA 5GONA 2C5GA 5IABA 4P4SA 2HCBA 4C4OA 1ZPDA 2A0KA 5IRCD 2ICAA 4RKWA 4LBZA 5GJVC 1XDBA 3A6ZA 4OO3A 4RA9A 1NBHA 3FR8A 5DIFA 4IL5A 2KJQA 1T9DA 1SRRA 2I2XB 5AI6A 2C9OA 1DAPA 3WWDA 1I7NA 1E2GA 2VDWA 3PRJA 3FTDA 1R9MA 2VCEA 2PRKA 4W99A 5LM3A 4K9QA 1PO7A 1KJNA 1OLSB 4KSYA 4Q4AA 1N78A 5JIBA 2EKQA 3A1VA 1R5NA 1NV9A 1U2EA 2CYCA 1E3WA 3UAWA 3ZY2A 5IW8A 3SJBA 2HYIC 2GPAA 4BVHA 4YV7A 1KMIY 1MEOA 3IT1A 1U8AA 2CNWA 4UDOA 2XBMA 2OBBA 2P4SA 3G9XA 1GGNA 3BHIA 3ZEAA 2R2AA 5DI9A 4BB6A 4R16A 4UAVA 3RT1A 3B1VA 3HYCA 4AG3A 2Z6AA 4R5MA 2AMFA 1VL2A 1K2WA 3G23A 3JU3A 4NH0A 3WB0A 2HGZA 2V6GA 4J7XA 1XNQB 3JCZA 1WDMA 1ES9A 4MA5A 3RRZA 4ENVA 4UBMA 5EHXA 2PQ2A 2FPWA 2R8ZA 3V1YA 3I2HA 3TRJA 1JSLA 1Y7HA 4ZVPA 1NVDA 3NATA 3R0JA 4EGJA 3HBJA 5FPKA 2IV3A 3PUKA 4IDCA 1KHTA 3AF5A 4PPFA 4R6XA 4EATA 3ZXSA 4RHCA 1O8CA 3LKBA 4LYDA 4QDTA 3R23A 2BTQB 1VZ3A 4XR4A 3U1TA 2FG7C 4KX3A 5HA5A 4MYDA 2H4ZA 2NYVA 2JVJA 5KQRA 3VOAA 1AGPA 1JHYA 1GKLA 2EQAA 2H1LA 3AG6A 3KYDB 5FYQA 2J6HA 1Y3CE 4G0MA 4FR5A 4M9UA 3ZE8A 4MMXB 2C2MA 4PSVA 5JZSA 4NBLA 3QFRA 4LISA 4BNWA 2GR9A 4MICA 2O0KA 1XTVA 2V45A 3FUTA 1XQ9A 3M5DA 4QXQA 2VK2A 4IXDA 5IBRA 3BS4A 5A4IS 5HXAA 2Z8YM 1JA9A 5KNDA 1JH8A 3B48A 5FOQA 1T3GA 4UJ5A 3AY6A 3DDUA 1BMFD 4B3FX 3MCUA 3PI7A 1NBAA 3HLTA 3TTSA 3A1EA 4MQ5A 2JBAB 1Z7WA 1KP9A 2YOHA 1ZK4A 5ALYA 4D82A 4FVTA 5AOCA 3AEQA 5K6AC 3D3JA 4L4XA 2V6IA 1NYQA 4D9CA 3W1EA 3ZHRA 1HTBA 1PK9A 1XCBA 3Q3GE 2QN3A 4XUGB 3D9QX 3ZE9A 3TQTA 1ZMOA 4IHJF 4L3WA 4UXIA 1RZVA 3D3WB 3AFIA 4PBSA 3MEQA 2NWQA 1GUFA 4ZV7A 3B8HA 3FN4A 4H0FA 3GFFA 2IODA 3VU0A 1NVVQ 1RU3A 2BF4A 3CRMA 1I1NA 1GZUA 2XOEA 3E9CA 2IU3A 3PHJA 1AUVA 1GTL1 3PB3A 1GAWA 1G6KA 2QAIA 1QTRA 2CZQA 2J30A 4LY6A 1I0IA 1ZWKA 2W6PA 1SUAA 3DAPA 3DT6A 1Y8ZA 1RRCA 1BCSB 4EHFA 5I7EA 3PJFA 4NCBA 1BXZA 3KTAA 2WPDD 3QUAA 1B23P 4EI9A 1N36B 1O0SA 1CEYA 1ZH2A 2I7VA 3ZV3A 3T9AA 1MORA 1E8MA 2F9FA 3DOIA 3O9ZA 4S0XA 4TUYF 1HFEL 4XIYA 4C0XA 4EHIA 5ICGA 3HY4A 5C7IO 1M0SA 4F96A 4HD8A 1E9EA 4YV0A 1Z13A 1Z5PA 5B2FA 3IKTA 1SVUA 5AJYA 3WYBA 3D4OA 3KJGA 5BMVA 3PHGA 1R4ZA 2ZS7A 2R7MA 1R1DA 1YBHA 1WQ1R 3CVUA 1PK7A 1HZJA 3L8CA 4JP8A 1SCAA 1H42A 1L5MA 4L08A 4GOXA 3U1VA 5E2AA 5DF1A 3EMBA 2O6HA 4F38A 4JB0A 1SCUB 2HU7A 3NBMA 2CCKA 1GZDA 4JD5A 1NAIA 4L2IA 1MTOA 3VYTB 3SXJA 3WK9A 4EKIA 3KKZA 4HRXA 4ZOCA 3VKGA 4QO7A 3LY7A 1AN0A 3FLBA 1ZH6A 4J0HA 4TMZA 1XYGA 2MINA 5BRNA 1XDZA 1VPDA 4UNIA 2WSSD 3UHOA 3OC6A 1PFYA 3I6MA 3KFLA 1O7JA 2CJWB 5I7HA 1RXYA 1Y8AA 4MIKA 5D3MB 2IDKA 4IWYA 2QLTA 4ETNA 1JSXA 2VXOA 3DFUA 4JU8A 4OQ4A 1NNSA 4TYYA 4X9XA 4XUDA 3SCZA 3QQ5A 3PUYA 3W8RA 2PXAA 3HU3A 3FYCA 4YMSA 4FCCA 1Z6TA 3AI1A 3KXLA 3RYIB 3BTSA 2QN7A 3EEQA 4LXHA 3AKEA 4RVNA 2O8VA 4L5JA 3ASYA 1FNDA 3G2HA 1QS0A 3LOUA 1JQAA 5EI5A 2JAOA 2DHRA 4UM5A 3HGTA 3IUEA 4EYEA 4EO4A 3W4JA 1RM3A 1NW8A 1XJQA 1XE3A 1W34A 1BKYA 4CDGA 5B6IA 4MS4A 3SJZA 3W2TA 3BMQA 2CXUA 2F43A 4DCJA 2WE8A 2HJ9A 2QMQA 3V4ZA 2JS7A 3SNHA 3SC2A 3IQZA 2HL6A 4G56A 4XTCS 1U81A 4F2DA 4ER6A 2YWRA 4Q93A 5CLHA 2NV2B 1PGNA 4QUBA 2EWMA 4M7PA 1XNRB 2A1TR 4KQEA 1D4ZA 2N75A 5BORA 2L17A 3RKUA 5EUBA 3WSWA 3LQRA 2ERYA 3O94A 4EO9A 5DHAA 3FLAA 4NBNA 5EFOA 4FFPA 2RCNA 5HTOA 4PCLA 5K8JB 4GKVA 4UMDA 4CM8B 1F6DA 4JKIA 5CRIA 3ZQUA 1ZJWA 3K6JA 4EY5A 3ZCVA 5KU1A 2HDHA 1VKZA 3OECA 3P9SA 1MBZA 4HWSA 3WNZA 4QXPA 4J91A 1M1XB 4KIUA 4FYKA 4R9NA 2JJ1D 4EJFA 2NT4A 2G25A 4Q12A 1FNSA 1WCXA 1FDWA 4D9GA 4MP6A 2BMEA 3C70A 3V7FA 3ZDEA 2G17A 4FM9A 2EERA 4CKZA 2W2VA 3B20A 1DOAA 3VPGA 2AW3A 5CNMA 2Q46A 2ERXA 2OV3A 3WGOA 3ZKWB 1Y33E 3MF4A 2I8LA 1V5GA 3ZNQA 4AQDA 1ZL2A 4DLTA 5ITZB 5DNCA 3SNKA 1ZM9A 5EWMA 3L1JA 2R4QA 4F9TA 1P9NA 4H7DA 4ENWA 5HR5A 3TOSA 1Q0HA 5LDHA 3WDLA 4B3IA 3HJFA 1TCCA 2D5LA 4K2AA 1ZC4A 3CPHA 4HN4B 4QASA 2OOSA 3DLPX 3TVDA 4EAAA 1MGOA 1GL3A 3QOXA 1WUTA 2OB2A 3WMXA 5E7MA 3V6MA 1GRCA 2PGNA 3KHKA 2BFMA 4ND3A 5IZCC 4RXUA 3TLYA 1WVMA 1VSBA 2QMOA 3V1UA 1VI5A 1GA6A 2Q3BA 3IEPA 4J3JA 4M9ZA 3G2IA 3TLJA 4EX6A 4K3UA 5LQMA 2ZRMA 4OJKA 4C7VA 1AB6A 3RSGA 1LF5A 5CNIA 3WBFA 4PN3A 5FEUA 1EUDB 3GC6A 5ANRB 4QYIA 2BTEA 3LK7A 4TTTS 1L4NA 2OFOA 2DQ4A 1HORA 3MUEA 4KPUA 1XVUA 5EJIA 3WX0A 4B43A 2CMHA 2H7VA 2ZBDA 3AUXA 2GFHA 3EW7A 3FX2A 4GP7A 1Q7CA 1X1BA 2FXVA 4WKCA 1HL7A 1RTKA 3V1TC 3BWDD 5A4MS 1ZU5A 1EX7A 4BB5A 3AFOA 1NSYA 4G0ZA 4HSGA 4NESA 4C4XA 1TUGA 4WOPA 5B3AA 3RBXA 1UP7A 2Y8EA 4Y6PA 5C52B 5K6RA 1SU4A 1R4NB 2ZCUA 4C0QC 3PEYA 1QBGA 3SGLA 1U7HA 1A5ZA 4REOA 2ZI3A 1TM2A 2R47A 3Q3JB 1Y89A 5F52A 3WV4A 2YRFA 5JQGF 1A9YA 1QRSA 3INGA 4KWCA 3UMJA 3Q2IA 1G42A 1T24A 1Z0SA 3DL0A 5BO5A 1M33A 2XWPA 1RYDA 3ZNOA 3WG9A 2FFJA 4XWWA 2POCA 3GLHE 4CKWB 2H2WA 1J0DA 3L06A 1PJBA 3M6UA 1S2IA 1IRXA 2FUNB 1TJPB 2ODTX 3H2GA 3JQ6A 3TXAA 3HKBB 3BCHA 2F8LA 4O4LA 1DI0A 1M0WA 4HDOB 4QEKA 4S1PA 4BKMA 2IH5A 1HZZA 2ACKA 3CZ4A 1HMPA 1VL8A 2C7PA 3I5UA 4HPXB 4DR6B 4U6QA 3TJRA 5AUNB 1CFZA 1OFTA 1JMYA 4IY1A 5EQTA 8ATCA 4NPAA 1MA0A 2FGJA 3KT6A 3T7EA 5AVVA 2I2WA 3FF1A 4A91A 1DRWA 2YASA 5DLYA 4D96A 2ISSD 1MV5A 1OPXA 2WICA 4Q1CA 3RHSA 4J7CA 4FYYA 1P1BA 1U3UA 3IMCA 3LJKA 4FMCB 4R68A 2NXNA 1JKJA 4TTSA 3FW1A 2P9TA 5AK4A 3CONA 3S2YA 4B73A 3VC2A 4C1BA 1BXRA 3ONWA 2ORED 4IIGA 3W5DA 3JQFC 4MR7B 1JIVA 1Q15A 3SX2A 4O4HB 5EAIA 3FGOA 3IA2A 1YIDA 4WZAB 2DERA 2VF5X 1M8PA 3N87A 1L1RA 3UJHA 2CXXA 3BRWA 2IYPA