3TL2A

Crystal structure of bacillus anthracis str. ames malate dehydrogenase in closed conformation.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
312
structure length
312
Chain Sequence
MTIKRKKVSVIGAGFTGATTAFLLAQKELADVVLVDIPQLENPTKGKALDMLEASPVQGFDANIIGTSDYADTADSDVVVITAGIARKPGMSRDDLVATNSKIMKSITRDIAKHSPNAIIVVLTNPVDAMTYSVFKEAGFPKERVIGQSGVLDTARFRTFIAQELNLSVKDITGFVLGGHGDDMVPLVRYSYAGGIPLETLIPKERLEAIVERTRKGGGEIVGLLGNGSAYYAPAASLVEMTEAILKDQRRVLPAIAYLEGEYGYSDLYLGVPVILGGNGIEKIIELELLADEKEALDRSVESVRNVMKVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Malate dehydrogenase
publication title Crystal structure of Bacillus anthracis str. Ames malate dehydrogenase in closed conformation.
rcsb
source organism Bacillus anthracis
total genus 112
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tl2A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3tl2A02
5JCXA 3BYZA 4E4YA 3E5RA 3KEOA 1YONA 1DFHA 2FZWA 4ZICA 2J6IA 3PQFA 3DAGA 3QWIA 5JAIA 1IHXA 3OIDA 4R16A 5JSFA 3G0OA 1IY8A 1H6CA 2WM3A 3ZCXA 1EUDA 5FF9A 5IDWA 5H82A 2PD6A 3PWZA 3CIFA 4RJTA 1M66A 3AUTA 5GZ6A 1V6AA 3GOHA 3ULKA 3VDRA 1KS9A 1KC1A 1XWFA 3ZV5A 1DJQA 3T4EA 1ENYA 1SOWA 2J3JA 3D4OA 1E5LA 4B4VA 1PR3A 2HJSA 3BMCB 1GEGA 4B7XA 3GGOA 2W2KA 4BO2A 3GGGA 3KB6A 4DQUA 3QW2A 3UUWA 3HFSA 4J2OA 3WXBA 5HTOA 1SNYA 4D45A 3V2UA 1PJCA 3RI3A 1UDAA 2CZCA 4OL9A 3IP1A 3LF1A 1RM3A 1UP4A 2QHXA 1LX6A 4J1SA 3GPIA 3H9QA 4DC0A 4BO1A 4BNIA 1QXSA 2E82A 2FPGA 3OJOA 1RYDA 1E1KA 2F00A 1A72A 4RORA 3WTBA 4BNVA 5JE8A 4CV1A 4XQ9A 4CV0A 1Y7TA 2FHSA 2WE7A 3WIEA 4H15A 5K6AA 3KHUA 3PHHA 1EBUA 4CM1A 3C7DB 4LISA 2EV9A 3GEGA 3K6JA 4CQMB 3A4VA 3RU7A 1UDCA 2V6BA 2VYVD 3E48A 2IYPA 3DHYA 1AN9A 2P91A 2A4KA 3RUCA 5CEFA 5TQVA 1IL0A 4Q3EA 1P3DA 4BKUA 5KJCA 4WLEA 4IQ0A 5MGBA 3C7AA 3K5PA 4C7JA 4XDZA 1NVTA 1UH5A 2VWGA 3NJ4A 2X0RA 2VQ3A 1K0UA 1VL6A 3UF0A 1ZSYA 2OBNA 3RUIA 4M8SA 2X5OA 4BL5A 2P2SA 1DC6A 2H63A 3ZWPA 5JFOA 3GT0A 4FOOA 4GX1A 3DBVO 5F5NA 1AHHA 4XYEA 4FFRA 3PYMA 4W6ZA 1WW8A 2OL4A 2O50A 4BGEA 3JYQA 3K8ZA 3WX0A 1SMKA 1BGVA 5KWEA 5DBFA 1UJMA 2BELA 1E1LA 4W4TA 3HZZA 4GKVA 3DFUA 2G82A 4J6FA 3JQAD 2NVUB 2YYYA 1OC2A 2GLXA 4XJTA 5F21A 4XKJA 1DIHA 1JKFA 2OHXA 3JQ9A 4J7CA 4MVJE 5DT9A 4WCDA 3AK4A 5ILGA 1BSVA 4AJEA 2EIHA 5A3JA 1QYXA 4Y67A 3PIIA 4L75A 4P38A 3WICA 1R4NA 5JBIA 4GBJA 4PLFA 2FR1A 4XA8A 1BDMA 4NK5A 2WEKA 2Z1MA 3FNEA 2JHFA 4P4LA 3L9XA 5L4LA 3L07A 2PLAA 2DBVO 1DFIA 3TZQA 2NVWA 4U8GA 2VRCD 4TQGA 1HZJA 3A28A 1UZLA 2GN4A 2OMEA 1ZSNA 3FWNA 1LDYA 3GK3A 4JJGA 5CDYA 3U49A 3U3XA 5U9CA 2HRZA 3PHGA 3RU9A 5KVVA 5B12A 2NACA 3OA0A 1IPEA 2DUUA 3IKVA 1FDUA 4MIOA 1N1GA 1TT7A 3QHAA 4U5QA 4E2ZA 3QY9A 3DBLA 4UUNA 1C0PA 3ONDA 3WS7A 5JYDA 3PQDA 4S1VA 1I10A 4IGFA 4UULA 4LCEA 4XD2A 3TZKA 3ZWVA 1ZMOA 3DZJA 2W90A 1TT5A 4H3VA 1N8KA 1RJWA 1CWUA 1YS4A 3M6IA 2Q4EA 5KNLA 1YB1A 5A9TA 1JAXA 5DF1A 3WB9A 1N9GA 1ZVMA 3EK2A 5TJHA 2DBZA 2HO5A 2ZTVA 3A14A 4RVUA 1XQ1A 1P74A 4FJ0A 3LK7A 5H81A 1HYHA 4IZHA 4GGPA 2JD1A 2EJVA 4P22A 3TF5A 1HSZA 4YEDA 4CODB 3GDOA 4LN1A 3KYDA 4M49A 1HDGO 1FDVA 4CM8B 1SCUA 4J7XA 2B35A 2NQTA 2RBEA 1MX3A 3OIFA 5DBIA 1XYGA 4BNFA 4BNXA 3HJAA 4A7PA 5KIAA 4J1NA 2QRJA 2QW8A 2WYUA 1V3UA 1E1NA 4IJUA 4MKXA 2ZB7A 3ONFA 2EXXA 3DBHB 5KVQA 4CM6A 3CUKA 3ADOA 1PWXA 4UUMA 4L9RA 1X15A 3IOYA 3WQRA 3QWHA 1P1JA 3ZNNA 4BIIA 4B3JA 1SEVA 5MDHA 3CE6A 2JCVA 5IDXA 3AOEC 1MFPA 3JD3A 3ZZNA 1PGNA 3H9GA 1GQYA 1E3SA 1X13A 3MTJA 3OJEA 1ONNA 1DHRA 3VKVA 2PD4A 2W8ZA 5HS6A 1K6IA 3PWSA 2ZATA 3AUUA 2QIOA 4PLVA 1JA9A 2ZCVA 4TKMA 3WGQA 2AE1A 2GN9A 5ER6A 4UVIA 2PZJA 3IQDB 3LT4A 2EGGA 1X0XA 1YL5A 2OGUA 2X4GA 1HYEA 1LLDA 2Q2WA 1TEHA 1YOVA 2C2YA 1KVQA 1GCUA 3HQ4O 4UUPA 3E18A 1HE4A 3WDSA 1GAEO 4ALJA 2WD7B 4BVAA 2LDXA 2AHRA 5L51A 4J7UA 3WSVA 2IZ0A 2H5LA 4ONEA 5T8KC 3M2PA 4HFJA 4K28A 3RSHA 5AOVA 4EEXA 1KBZA 2CF6A 4XEHA 2X58A 1LRKA 2CDCA 1F17A 2YQ5A 4I08A 5BSEA 1SBYA 1CF2O 1LNQA 5L3ZA 4XIYA 1ISHA 4M87A 3JD1A 4RLSA 3EVNA 4LRSB 2ZTMA 1GQQA 4RPHA 3VZPA 4B3IA 1Y5MA 1HRDA 2X5JO 1RPNA 2PGLA 2D1YA 4YXFA 3GQVA 5LCXA 1EVJA 4E5PA 3O8QA 2G1UA 3GVCA 4Y8VA 1T26A 3P2YA 1R0LA 5TS3A 4EUFA 1NHWA 1EQUA 1GU7A 4D3FA 3ST7A 3L6OO 5IZ4A 4I8XA 4DGSA 3AY3A 4PG8A 4RF3A 1E92A 5IDQA 4WGGA 3TL2A 5CDSA 4IDFA 1TVEA 3GDFA 1P1KA 2IXAA 5COAA 2HMTA 2JAPA 3H7AA 1O89A 4DVJA 1FK8A 1SC6A 4BKPA 4EBFA 1DIBA 1ZH8A 1ID1A 4Z0TA 3GR6A 3DXFA 3RROA 4A27A 2GYYA 5A1TA 1H6BA 3VZSA 4A5OA 1Y9EA 5TX7A 1Z74A 2A35A 3X2EA 1E3EA 5BT9A 4JP2A 2IODA 2WWRA 3GZNB 4PLCA 1T1RA 3L4BA 1OFGA 1KEWA 3FCOA 1HL3A 1M2WA 4ROSA 8LDHA 2C0CA 1B3RA 1NPDA 1Z6ZA 2B4RO 4YT4A 3HE3A 3WIDA 1YBAA 5A9SA 4ND5A 4WLFA 4LVUA 2JCXA 3GNSA 2X0JA 3L0DA 4RZHA 4WCFB 3BA1A 1OAAA 1GPJA 4WNCA 2D4AA 5KJEA 3JQ6A 4R41A 5DZSA 3VOSA 1VL0A 2Y1GA 2YDYA 1Z7BA 4B8WA 1GZ4A 3ZHZA 2GGSA 3GAFA 2DFDA 1YRLA 3IJPA 2B5WA 4JNKA 5JAMA 2PR2A 3DO5A 5JYEA 1EK6A 4D46A 3BHIA 2BMAA 3JQBA 3WQQA 3NUGA 3R6DA 1IHYA 4ALMA 5CEJA 5CPFA 4CMAA 1CDOA 2Y68A 1DXYA 1NX6A 3DAFA 4EDFA 1LA2A 1LBEA 4YJFA 1VJ1A 3EAGA 3O9ZA 4DIBA 4I5EA 2E37A 4L0QA 4PZEA 3WGTA 1UDBA 3GZ4A 1DRWA 1NYTA 1MB4A 3I9MA 4LRTB 1LSUA 1DAPA 3WTCA 2HRBA 4YYZA 3G1TA 3TQHA 4R51A 2P5YA 5JO9A 1NQ5A 2YHIB 3MTGA 3STHA 3OEWA 3ANLA 3G49A 4YB8A 4LCJA 2O4CA 3HWRA 2DLDA 3H65A 2IYOA 3MOIA 3NTRA 4ZQGA 4R9RA 3S2EA 1ZXLA 2Q1TA 5U4QA 1I5RA 1WDMA 4DRYA 3PP8A 3VDQA 4ZVVA 4NU5A 9LDBA 1R0SA 3FTNA 4OXNA 4GVLA 1DC4A 2EG9A 4A73A 4II3A 2GF2A 3RUHA 5C7IO 3E5MA 4XR9A 4BKQA 1E7SA 4A2CA 1A9YA 3ZV4A 1JLLA 3VPSA 1Z45A 4OXKA 5LC1A 2R2GA 4W7IA 2AEJA 4XRRA 4R68A 1BTOA 2WE8A 5A4DA 1LU9A 1KVTA 3CXRA 3D5TA 2X8LA 5G0SA 4GH5A 1S7CA 4QECA 4ZJUA 4DLAA 3FSRA 2WDZA 1WPQA 3EMKA 5JDCA 4ND1A 1E3WB 1EDZA 1G0NA 3OICA 3NV9A 4TSKA 4N18A 2BI8A 4WECA 2VYND 1ENZA 2Q2QA 4B4OA 4BO9A 1DEHA 3GHYA 4HUJA 2BH9A 2GDZA 1DLIA 5T6BA 4DYDA 4AJLA 5DNAA 4BO6A 4DYVA 2H6EA 2BD0A 4Q3AA 3RKUA 5L7WA 4EYEA 2Y0EA 2YJZA 3F3SA 1Y81A 3IS3A 2NVBA 2R00A 3DZIA 3F1LA 4I9HA 4TWRA 4TRRA 4PG7A 4L4XA 4P8RA 4Q3CA 3QA9A 2HAEA 2VWHA 1MGOA 3QVOA 4CMKA 4RF5A 1R15A 1I01A 3SC6A 4G5HA 5COQA 3SXPA 1ZK2A 4PG5A 1U3VA 2W2LA 4L8VA 4NH4A 1XLTA 2B4TO 3NTQA 3H5AA 3VVCA 3KO8A 3UKOA 1D3AA 1DHTA 3PHIA 3ON5A 2HMUA 3HB4X 4NDNE 4JBIA 4NJMB 5TT1A 1H6DA 1E3JA 5I7EA 3JQ8A 1BWSA 4LGVA 5GY7A 1TXGA 3S55A 4D0RA 1OI7A 4CMEA 4MVJP 1VL8A 1ORRA 4XYMA 1XQ6A 3MJ4A 4R01A 4A10A 4AJKA 3BTOA 3PJEA 2W4QA 4R1TA 4EI2A 3KYBA 1MXFA 1QLHA 2NU9A 2Q1SA 3JD4A 1OOEA 2RHCA 2WSBA 5I7SA 4DLLA 5F1OA 2DKNA 3KLPX 3ROKA 3HB5X 4GX0A 3NT5A 2BLLA 1J4AA 1O8CA 4RDIA 3RVDA 1HF3A 1ADGA 1WAMA 2VT3A 4TZTA 3WG9A 1ZEJA 1ZJYA 1ISJA 3TFQA 3GH3A 1A4IA 4KUGA 3N74A 4OQZA 4FN4A 3WBFA 1XCBA 4CQMD 1PGOA 2QZ9A 3K2EA 4GWKA 1ZW1A 4AJIA 4LSMA 4QTZA 1ZK4A 4XQEA 3GGPA 1XR3A 1J49A 1C3VA 3MJTA 1XELA 1IYZA 2H1SA 4P4NA 1TB4A 5JCJA 2YV3A 3VAZA 4R54A 5JDIC 3KETA 2FPPA 4DMMA 1R37A 4YJGB 4E6PA 3FHLA 4AJNA 2Y0CA 3TSCA 4BOYA 4RZIA 1GYPA 3OF2A 2ZCUA 3LSYA 1RKXA 1K2WA 2J3KA 4MKZA 1YH3A 1WZIA 1KVRA 3PDUA 1GL3A 1H9BA 1U5AA 3F4LA 4UUOA 1ONPA 3JQGB 1E7RA 2YFHA 2OXIA 1LC3A 1SPXA 4B79A 1O9BA 4E0BA 5BQFA 2Y05A 2Z1NA 1YL6A 1I3LA 1U2GA 3HN2A 3JQ7B 2WMDA 4ID9A 1SB8A 3F4BA 1VI2A 5C7OO 3LZ6A 4BGVA 3U4HA 3H4VA 1J6UA 1HDRA 4LK3A 1NBOA 2ZB3A 3LLVA 4OM8A 1P1HA 3TOZA 5DCUA 1Y1PA 3JQDA 1DBVO 1NR7A 4PLTA 1Q7GA 1B14A 1EK5A 4CM4B 3T4XA 4XR4A 4DL9A 1TLTA 2PGDA 3PQEA 2YW9A 4WCFC 3JQEA 3TL3A 3ZU3A 3G1UA 1GV0A 3K96A 2DBQA 3NYWA 5TLSA 2HKIA 4FFNA 5G4KB 5I8WA 1ZZEA 1ZXBA 2HMWA 4UREA 4A0SA 1HSOA 2O7QA 5DP2A 4H16A 2HK8A 3F6YA 3UCFA 2J5QA 3S1LA 3JYNA 1E7QA 5C5IA 3WYBA 1NFRA 4JN6B 3ZHYA 1BG6A 4ZRNA 5J23A 4YAIA 4XYLA 3UVEA 1SAYA 5TIIA 3WSWA 5BSGA 2VNAA 2X0NA 2AEFA 1HKUA 4IIVA 1JVBA 4F3YA 4J1QA 4QXMA 2NM0A 2DFVA 2O48X 3LYLA 3RC1A 1YVEI 2P4HX 4XYGA 4D7AA 1H6AA 1N7GA 3BMOA 4FB5A 5HWSA 3ZW9A 4N5LA 3GFGA 1NHGA 3U4DA 3DMTC 3NDIA 4PLWA 2VYVA 1FMCA 1KIFA 3RJ9A 4MP3A 2ET6A 1YQGA 3GLQA 2POQX 3KYCB 3HDHA 3I6IA 1Z75A 3HDJA 3E9MA 3DTTA 3V1UA 2CSUA 4WOKA 5A5EA 2EKLA 4Y6RA 1PJSA 3V1YA 4EUHA 2I67A 3QVSA 1NFFA 2BF7A 1V0JA 4PVDA 3OJFA 4O63O 2PNFA 2AEMA 4RVGA 5L7YA 4FQ8A 2EWMA 2HU2A 4CMIA 2SCUA 5JS6A 1ISMA 1NFQA 1JU9A 3NAQA 4KOAA 1DIRA 2Y1EA 4MP8A 3W4JA 3E6AA 1EUZA 1QYWA 4BMNA 3JQAA 3DZFA 3ADPA 2V6MA 2EHDA 4CMJA 2RH4A 1GEEA 3L9WA 2FMUA 5I7VA 3DZGA 2CF5A 3B1FA 1MA0A 4Y98A 2DT5A 1I0ZA 3JQ9C 3OIGA 3HG7A 3QVXA 2JHGA 1MFZA 5KVSA 4N5NA 4DC1A 2ZIZA 3N58A 2DAPA 4U6QA 5JAZA 3O4RA 1U28A 3FPCA 3RC7A 1NQOA 4BMSA 4F45A 2PD3A 2WTBA 1H0KA 3W8EA 1B2LA 4HNHA 4BS9A 3PYLA 4OGWA 2EGHA 4CLRB 2JL1A 3OJLA 4J16A 5CP8A 1N7HA 3M2TA 3OBBA 4FR5A 4IPTA 4YA6A 2NNLD 2JFHA 1BHSA 3W6UA 2VRCA 5JO0A 2BI7A 1VE9A 4N7RA 2QRLA 2JFGA 2EW2A 1P1RA 1B26A 2I99A 2FOIA 4JBGA 4BKRA 4KUEA 5A05A 3C1TA 3WGOA 4BNGA 1PQUA 4ZHSA 1NAIA 1UZMA 2O2SA 4U0JA 2GASA 2PY6A 4FGWA 4XDYA 1KY4A 2AG8A 3D4PA 1HDYA 4TKLA 3C7CB 3ANNA 4IJWA 3IAHA 4QO8A 5T67A 3I52A 3F5SA 4BNKA 5KOIA 3U09A 1DAOA 1V3TA 3TN7A 3MOGA 5IN5A 1BXGB 2XXBA 7MDHA 3PJDA 1ZO8A 2ZQYA 1NNUA 4J43A 2GN8A 4WK6A 1P1IA 3JCZA 3CSDA 3IKTA 3WJ7A 1UP6A 3SC4A 4NMHA 3ZGYA 2Y99A 3RCBA 2I3GA 2OZPA 3D3WA 3ZWOA 2O3UA 3ROPA 4FDAA 1W6UA 1VC2A 3TDKA 4MVJD 1I3NA 1ZJZA 4G81A 4UVGA 4ZD6A 4F6CA 1PIWA 4Y9DA 1GZ6A 4CLEA 3MJEA 3G79A 1EVZA 1P1FA 1NPTO 4CL8A 1D4FA 1XSEA 2ZYDA 4E2XA 5JLAA 1N5DA 1RM0A 2FZEA 3EW7A 4CMGA 4LMRA 1ML3A 1VM6A 3INRA 4BNTA 3CZMA 1M76A 2Y67A 2WYWA 3IC5A 5LDGA 1T1SA 4CR7A 2IEBA 4MPDA 3AI2A 2P68A 4EW6A 5KKCA 1C0KA 2FPIA 3I9OA 4GKBA 1KEVA 3L6EA 5TSDA 3DMYA 3PFWO 3DDNA 1P0CA 3E9QA 3PPIA 4PCVA 3NRCA 2BFPA 3DOJA 1QV6A 3Q0EA 3TJRA 3ZDFA 3QWAA 4NJOA 1MG0A 2AQ8A 1O0SA 4IIUA 4CMHA 4DPLA 2PV7A 3H9JA 5TT0A 3FD8A 3DQPA 3E03A 4FIZA 4CUKA 4IINA 1JWBB 2EW8A 2C29D 1SZJG 4XZ3A 3GMDA 4DIOA 4A03A 3RJ5A 3V2GA 1S6YA 3OQ1A 4IDGA 4DA9A 3GY0A 2X23A 4IDAA 2C82A 3CKYA 3PK0A 3VKUA 4MJLA 1W73A 4P4GA 5B37A 2O3QA 4KZPA 1PS9A 4BNJA 3DOCA 1KOLA 1UUFA 1LDBA 1TA4A 1D8AA 4ALIA 1SOVA 1RYEA 2A92A 4RVFA 4WPGA 3GFBA 4J2HA 3PVZA 2PKQP 3GC6A 2HK7A 2Q1UA 2VHXA 3SX2A 1B16A 3DR3A 5EIOA 4YVFA 3PZBA 1V35A 1XHLA 2NU6A 4CLOB 3GUCA 5DCYA 4E12A 1T4DA 1P0FA 3OEYA 3OM9A 1NWCA 4OXYA 4KDEA 4JGBA 4MKRA 4PFJA 3MJCA 2P9CA 5KKAA 4KTTE 1WNTA 4XCVA 1AXGA 1J0XO 5FEUA 1H9AA 2F1KA 1B15A 4GWGA 4AJ2A 4YRDA 4YRAA 3DBRA 4KQXA 5L7TA 2GERA 1F12A 1JQBA 1LEHA 2VHYA 3MWEB 4CQLA 4WE3A 5BNFA 1FJHA 3HSKA 3TPCA 4Y6PA 2TMGA 2G5CA 4XX0A 4Z3KA 5A06A 2EP5A 4BQPA 4PZCA 4MOWA 3MZ0A 5TRTA 1B8UA 5ICSA 1QMGA 4IDBA 4CM9D 4CV3A 2DBRA 3GN2A 4DQVA 3HFGA 2VZ9A 3WGIA 3WQSB 4J49A 3ZHXA 5ES3A 2XPCA 5U1PA 1LLCA 1HE2A 2YV2A 1FDTA 2TMDA 3ZV3A 5KJ6A 1C1XB 3AM4A 4NHEA 4DMLA 1LQTA 5T5QA 3UCXA 4DBZA 1E3LA 2P4QA 2Q46A 3FRJA 1U7HA 3CMCO 3FWZA 4OH1A 1U4SA 3EY4A 1BXZA 3BMNA 1Y8QB 4XGNA 1U4OA 2AQKA 3GA0A 5BNTA 1NXQA 4K26A 1VSUA 3D3EA 1LXCA 4OOFA 2B69A 1I2CA 3DL2A 3LQFA 4CPDA 3RFVA 1HE3A 4PRKA 1LSJA 3ZWNA 5ICMA 3R1IA 2VHZA 1HYGA 3C3XA 2C7VA 4U6SA 1X7DA 3WYEA 1YWGO 3LDHA 4N54A 2FR0A 3PJFA 4FGSA 1U3TA 3HHPA 2H9IA 1HDXA 3LU1A 4IZIA 1ISGA 4NG5A 5T57A 1MUUA 2IDZA 2X5KO 4HFRA 4PG6A 4IDDA 2EKQA 4FJ2A 2GSDA 1NQAO 1EEHA 3A06A 3BMQA 3JQBC 3NDJA 2UYYA 2VTEA 4YAGA 4YDRA 1R16A 2CD9A 4M89A 4U7WA 3ZH2A 1E6EA 2RAFA 1Y8RA 5A9RA 3BTUA 2X1HA 1KVSA 4Q39A 4LSWA 5TJ9A 4LW8A 1EZ4A 1WVGA 1UR5A 3DOOA 4JIGA 3GUYA 1U8FO 3PDJA 1K89A 4BNLA 1R4MA 1DJNA 1C1DA 4HNGA 4BUCA 3KOUA 4RCVA 1A7KA 2B37A 4J9VA 4IJKA 2J3IA 3AUAA 4ZU3A 2HMVA 1LDGA 3PEFA 5DP1A 2DTDA 3RUEA 4PN3A 5G0WA 4MIYA 1MXHA 3TWOA 4YJHA 5EESA 1U2DA 5G4LA 2J5RA 5ENVA 1JWAB 5IZCA 2I76A 2O7SA 5A02A 1KERA 2GZ1A 2AG5A 2GZ2A 2JKVA 2X9NA 3ETEA 3H5RA 3Q11A 5CHEA 3VVBA 2CUKA 5GZ1A 4F46A 4EZBA 4MVJH 4E13A 1XU7A 5GZ3A 2I5PO 1W8DA 3B1JA 1A9ZA 3FI9A 3QSGA 4HADA 2C5AA 1P31A 1J5PA 2VYNA 5EMHA 5JDCC 1K6JA 3ZNQA 5L45A 3U5TA 4W9NC 1WDLA 1K6XA 3B20A 2NQ8A 2NV6A 1GQ2A 2V7PA 2HUNA 3I6QA 4WEQA 4YAKA 3BXXA 3GPDG 1G0OA 2JFFA 1K3TA 2DQ4A 2Q1WA 2ZTLA 5CAEA 1R0KA 1DRUA 3GN1A 2W2KB 1UP7A 1I33A 4ILKA 3GAZA 3GEMA 4TRNA 3F5QA 4IDCA 3GG9A 3NGXA 3QE3A 1FXSA 3VH2A 4A26A 1X1TA 4R3WA 4Z6KA 3KLMX 5JMWA 3AM3A 5G0VA 3PHJA 3L4SO 2C54A 2UVDA 4Z9XA 9LDTA 4QX6A 4NNJA 4JLWA 4KQWA 1MG5A 1F8FA 5JC8A 5HA5A 3BMCA 2BGMA 2UUOA 3JYPA 5A03A 4ND3A 5JW6A 3H2ZA 2EEZA 4GSLA 4HWKA 1H94A 3A1NA 3IUSA 4XGIA 1KEPA 1F8GA 1H93A 2PZLA 1GFSA 2CFCA 3KUXA 3H3FA 5G2OA 3AFMA 4CMEC 3IL2A 2O3RA 1U5CA 3SLGA 4YAEA 2OUIA 2CDAA 1LSOA 1JW9B 4YQZA 1I2BA 3AY7A 5DOZA 3PTZA 2OP0A 1CYDA 5FWNA 3JSAA 1DB3A 5AYVA 4GSKA 3ZWAA 1DLJA 1VKOA 4YQYA 1JKIA 3ZN2A 2E48A 4URFA 1A71A 2Z95A 1OMOA 2B83A 3RD5A 3K92A 1ZFNA 4RO0A 2ZKLA 4CQMA 5L4NA 2I66A 5C7LO 3BHJA 3JQFC 2Q99A 2NTJA 4XB2A 3INGA 5THQA 4L73A 2B0JA 2GNAA 3U62A 5DBGA 4CR8A 3ABIA 3AU9A 5TF4A 2YUTA 3RBZA 2JD0A 3PGXA 4IM7A 1YQDA 1YB5A 1ISIA 4JXKA 2GN6A 4BNHA 3RC9A 3W8DA 1GTMA 1YBVA 2DC1A 3NT4A 1M75A 4CLHA 3CMMA 3X2FA 1BDBA 3D4NA 1JVSA 3HN7A 3V1TC 4QEDA 2NTNA 1PZEA 5EQDA 5L9AA 4OHUA 3ZWBA 5ENDA 3P5SA 4PIVA 4RPGA 1R4NB 3WNQA 2WJPA 1GYRA 1PJQA 5EN4A 1V3VA 1DPGA 3UAGA 5CEEA 1Q0QA 2NVUA 1HWYA 3EGOA 4NBTA 4BO7A 1YQXA 4I5GA 2PA3A 4DUPA 1ZK0A 5GMOA 4DPMA 2JCYA 1GADO 1BXKA 1CRWG 4YWJA 1GCOA 1QR6A 2VWPA 5L40A 4OAQA 3W6ZA 3KSDO 1P77A 1G6KA 4J9UE 3COSA 5I9MA 4E5YA 5FI3A 4NQZA 1IOLA 3JYLA 4RV9A 1PJBA 4BHTA 3OH8A 5AXDA 4QQRA 4RF2A 2D0IA 3KEQA 4Y6SA 3WR5A 4R1NA 3LVFO 2J5KA 3QVWA 4AVYA 1Q7BA 3K31A 2YZ7A 3DBLB 4K6FA 1O6ZA 3FTPA 3U4IA 5KCZA 2VHVA 2C5EA 4B7CA 5G0TA 1F0YA 4CJXA 2C2XA 2DM6A 3FBTA 5HM8A 3I4CA 3D7LA 4DPKA 3W4KA 2X6TA 5EINA 3NTOA 1TT5B 4NIMA 1XDWA 3H9EO 1I3KA 1MP0A 1Q2XA 5A5FA 1E7YA 2JD2A 3JYOA 3ASVA 3WGZA 1LC0A 1SB9A 1O94A 4RL6A 3WWZA 1N9GB 4MO2A 3RKRA 3DBRB 1OZAA 4QSMA 4RVDA 2UAGA 4CMBA 3UN1A 4YJDA 4GL4A 5COBA 1U1IA 3BZUA 1PQPA 5TNXA 4RPKA 4BNYA 4Z0HO 3NX4A 4B8ZA 3KYDB 3ZNPA 4RDHA 1HTBA 3JD0A 2BRUA 1O95A 2I9PA 1PWZA 2PH3A 1A7AA 3SVTA 2Z5LA 4J4BA 3CINA 4XQGA 2FWMX 2UV8A 4QUKA 4BGIA 1DDOA 4TRMA 3IP3A 4WASA 3WGYA 1BVRA 3GVPA 2C7GA 4J90A 3GNQA 3JQCA 3I4FA 1DIGA 3RFXA 1VKNA 4FS3A 2ZQZA 4YT8A 2CDBA 1ZUD1 2VHWA 1N92A 3CPSA 4RQUA 4CMCA 4AJJA 1LJ8A 3KSZO 1UXGA 1SO8A 3I5MA 3I83A 3DBHA 5G0UA 2NWQA 3UW3A 3V5NA 2AE2A 2R6JA 3WBBA 3ROQA 4EITA 3A9WA 2VTDA 5DULA 4JQCA 1DIAA 1UXJA 4I5FA 3UFXA 1YOVB 1WWKA 3S8MA 3PIDA 1ZEMA 1NQTA 4OYRA 4NBUA 3R3SA 4HV4A 4CLXA 2QQ5A 3OETA 4AG3A 5F1KA 1QLJA 4W7HA 2ZJ0A 3ZU5A 1GDHA 4FC7A 1H2HA 4JJFA 5TGDA 4GMGA 4EGFA 5AXAA 4KWHA 2PH5A 1GPDG 1Y6JA 1DSSG 5CDGA 4NZ9A 4ZQBA 4BO5A 4BV8A 1MV8A 3M1LA 1AHIA 2Y0DA 2WD7A 3EC7A 3QWBA 4KUHA 4E30A 4OQYA 1PL6A 2A94A 5F5LA 2EP7A 3O8QB 4BNWA 1Z7EA 4GVXA 1KEUA 4CL3A 4OKNA 1NP3A 4E31A 4K1LA 1UAYA 1T25A 4K6CA 4E21A 5JDIA 1D1SA 5EJ2A 3WMWA 4CUJA 4E33A 3E1KA 3D5QA 3F47A 3VH1A 3U4CA 4AJ4A 2ZJ1A 4CM3A 4AFNA 1UAGA 4NI5A 1YJQA 1ZKMA 4BQRA 1B8VA 5K6AC 1HDCA 3TZCA 2ZB8A 2D3TA 3GRPA 1EFKA 4WJZA 1EVIA 2PGJA 1ARZA 3F46A 3PHLA 4DWVA 3ICCA 4NFSA 1GUFA 2BHLA 3EVTA 3Q2KA 1X7GA 4B4UA 5JXWA 1T2EA 6ADHA 3AI3A 1QG6A 2Q3EA 1ZNQO 4M55A 5A9SB 2ZB4A 4NU6A 1HXHA 3WJAA 1GY8A 5DDIP 2O3SA 4MVJA 1E77A 4PG4A 1EUCA 1M6HA 1X0VA 4R5MA 1HDOA 1AXEA 1D1TA 3C85A 3OP4A 4FFPA 3VTZA 4FBGA 2FSVA 1E7WA 1E3IA 3KVOA 3GZNA 3IMFA 1UXKA 2V6GA 3CEAA 3ONEA 3QQPA 1PZHA 4ZQHA 1FDSA 5FYDA 2VRBA 3OHSX 1ADCA 2O4UX 2XXJA 3RUFA 4WCFA 3DFZA 4HP8A 1QRRA 5IJZA 1O5IA 3FPLA 1EQ2A 4BV9A 1QKIA 4GLOA 4YJFB 2WD8A 2Y1DA 3OECA 4D43A 3VPFA 3WFIA 4Z3DA 1HLDA 3LC2O 2FRDA 4PRLA 3JTMA 1SEPA 1VJTA 1PTJA 3DB2A 1I36A 4MINA 4IQGA 4PLYA 1ULUA 1Y9AA 5BNIA 1RWBA 3DTYA 4O6VA 2YQ4A 4LMPA 5EL0A 3UICA 4ALNA 2X9VA 4YCAA 3BIOA 4R1UA 4U0KA 1NTOA 3PYXA 1N1EA 2X0IA 3WGHA 3VH4A 1HLPA 4ZQFA 3ZV6A 2GR9A 2ZYAA 3K73O 4TVOA 1XKQA 2QYTA 3E9NA 4IXWA 4ND2A 2GD1O 5IN4A 3F1KA 2G0TA 4QO7A 4PGFA 3QRWA 1YBMA 4J4HA 1QV7A 1YKFA 4IXTA 3JV7A 2YHIA 2IZZA 4G65A 4Q3DA 5IAAA 5LDHA 1R6DA 3OSUA 1F14A 5ADHA 4MVJG 4WLUA 1T2CA 3WNVA 5K0ZA 3QVTA 3I9KA 3CH6A 3R3JA 3WOHA 2OOSA 3DMTA 1AGNA 4R3NA 2G76A 1L7EA 5B1YA 3S2GA 5IXSA 1CIVA 2VNSA 3ENKA 4DLBA 5F3RA 1PZGA 1C14A 3IUPA 3AY6A 1ZIDA 3KM0A 4LVCA 3RFTA 3RUAA 4MDHA 4D79A 2CVOA 5ILOA 1HT0A 1U7TA 2HMSA 3WLFA 2EERA 4C7KA 1CEQA 2JJYA 1PJLA 4NBVA 4TVBA 5IF3A 4JROA 2P9GA 2EF1A 3GMSA 1BMDA 3GVIA 4TRJA 2QG4A 4GQAA 4RPJA 4IQ8A 1Z73A 3PGJA 1E3WA 1DC5A 1U3WA 4J4TA 4NFHA 1E1MA 1L7DA 2D59A 1I2ZA 6LDHA 4CM9A 5KJFA 2RH8A 4KP7A 4BKOA 2O3TA 3AUSA 5EERA 1ISFA 3TNLA 3FR7A 5A3VA 4FCCA 1PR9A 1ZK3A 5I9NA 4HFNA 1QP8A 2CVZA 1M6WA 4JCOA 3JQ8B 3PWKA 1NASA 3C1OA 3P7MA 4PLZA 3LF2A 5B4TA 4S3MA 4GPD1 3U0BA 1DC3A 2YDXA 4GMFA 4TMFA 4KDFA 2NSDA 2ZTUA 4KTVE 4OO3A 4WLNA 2FP4A 4UVHA 2RCYA 1NAHA 4E32A 5A04A 1EFLA 2QZZA 1HDZA 1LRJA 3DAPA 2B4QA 1ONOA 2HSDA 4HX5A 3WMXA 2UDPA 5CDUA 3GHHA 5C3MA 4IS2A 2X22A 4YT2A 1T2FA 3T7CA 4GX5A 4WLVA 1GZ3A 4NJMA 5HRUA 1E7MA 4DQXA 1L1FA 3PLRA 1ZBQA 1MC5A 2V6FA 4WNIA 2ZYGA 3PJGA 1I3MA 2I3AA 2X7HA 3ROMA 2AW5A 4KWIA 2CNBA 3GVXA 3O38A 1BW9A 3ZWWA 3VZRA 1PJ3A 4RLHA 3WYCA 3Q9NA 1VSVA 3I9NA 4B7UA 4E5MA 3V2HA 2Y66A 4EEZA 3AOGA 3B6ZA 1X14A 2EJWA 3IIEA 1YDEA 4FW8A 2NUAA 1YJ8A 1W4ZA 1NPYA 2EKPA 5JNLA 4E2WA 1R66A 1ZK1A 2OBYA 3W8FA 3ZU2A 3MJSA 4XRGA 3ZWYA 1E0DA 3MJVA 2AA3A 2DPGA 1IB6A 2XOXA 2AQHA 3NT2A 3W4IA 1BVUA 1QORA 1T24A 3FN4A 4R4JA 1E6UA 1EDOA 4DBVO 4ZGWA 1FDWA 3RBXA 1XG5A 2OORA 4YJGA 3K9QO 2VT2A 4O0LA 3AM5A 1PGPA 1WDKA 3H3JA 1A4UA 4AJ1A 2DTEA 3MCVA 4M54A 2GUGA 4EJ0A 2DU8A 4CR6A 5I8ZA 5BSHA 4FC6A 1PEDA 2FY8A 5AXCA 4FFMA 1XU9A 4YBZA 5HS4A 5IG2A 3JQGA 4CM7A 3FF4A 1IULA 1V9LA 1YXMA 1YGYA 2CVQA 2Y93A 3K30A 3L4BC 3RASA 4YACA 5IZCC 1LQUA 3G3EA 4UEKA 4XYBA 4E3ZA 3RUDA 2B36A 3E82A 2NTVA 1XIVA 1IZ9A 4IBOA 3I1JA 4MVJF 3JQ7A 5F1PA 3AI1A 4FSHA 4B3HA 1JKJA 4BNMA 4BO0A 4OSPA 4BO3A 1PJ2A 3OQ6A 5BR7A 3Q2IA 1ENPA 1M67A 3H2SA 2CY0A 1WMAA 3C24A 1WLYA 4DIFA 3HUDA 1PL8A 1Q0LA 1HZZA 4R9SA 1VPDA 4ND4A 3IDSA 4ITUA 2BFOA 1LUAA 4I5DA 1P45A 4CM4A 4ALKA 5AXBA 4IS3A 1KETA 3H9UA 4EUEA 3ENNA 5L53A 3ETDA 1W0CA 3JD2A 1CQJA 2XF8A 5G4KA 2V65A 4NBWA 4Z9YA 2E4AA 3ANMA 2GO1A 5IDYA 3H6KA 2P9EA 1NR1A 3LC7O 2HDHA 4R1SA 3VTFA 1ZSVA 4GI2A 1NWHA 3ZNOA 3FNFA 4XGKA 4G2NA 4YRBA 1GR0A 3ZWMA 3ORFA 2DTXA 3TFOA 1XGKA 3PFFA 4IMRA 4OMUA 1WZEA 1YO6A 1N2SA 3Q1LA 3MEQA 3E8XA 4WKGA 1B3BA 2X86A 2IE0A 3UCEA 4NPCA 1H5QA 3BMOB 1I24A 1VLLA 3I9JA 3LLSA 3BTSA 1EE2A 2NADA 3P19A 1E5QA 3UHAA 2O23A 4IGEA 2FN7A 1AE1A 5I9LA 1PL7A 1JTVA 4QT0A 1LSSA 1LDEA 3AWDA 4JX8A 4BNNA 3DZBA 3OFSA 1LLQA 4IUYA 3HADA 2O3JA 3EYWA 3O26A 4UVEA 4L76A 3GNTA 2YFQA 4UEJA 4J1TA 3LT0A 2BGLA 1WP4A 3AOEA 1I8TA 5JY1A 5BSFA 3QWFA 3KBOA 3SBOA 4H7PA 4BNUA 1KYQA 1EBFA 3FNGA 3NGLA 3B1KA 4CMIB 4PLHA 2IRWA 1K5HA 4L4SA 2YY7A 3ZW8A 2FR8A 2HLPA 4HY3A 2I65A 3D64A 3KYCA 1PGQA 1ULSA 2LDBA 3H5NA 3I23A 2IXBA 3GF4A 2J8ZA 3SEFA 3JQAB 3G17A 3S2FA 4RGBA 3HDQA 1RM4A 3CTMA 1IZ0A 1XA0A 5B4VA 3OMLA 3AU8A 1U9JA 2AXQA 1PZFA 4B4WA 4Q3BA 3PZRA 3C1AA 4I9UA 3H8VA 1PGJA 1Q7CA 1CJCA 2R00C 2VZ8A 4ZRMA 3NEPX 4WOJA 2PFGA 1CERA 4II2A 4BO4A 4O5OA 5T8KA 3DHEA 2ILTA 3Q9UA 4NFYA 5FFFA 1HE5A 1QYDA 1ZMTA 3PRJA 4XIJA 2D2IA 3IJRA 3DC2A 4Z9FA 3GEDA 3DHNA 2AMFA 3KSUA 5JPIA 1YDWA 1LDMA 3L6DA 5ITVA 2Y1CA 2BFAA 3BTVA 3Q3CA 3LT1A 2D5AA 1F06A 4XQCA 3NKLA 3FR8A 3O03A 3WGGA 3WFJA 4YR9A 5CPBA 2W98A 1PX0A 4HXYA 1HEUA 2PWZA 4MIEA 5IXYA 1YL7A 3OJ0A 3RQSA 1DRVA 2C20A 2IEDA 4CLRA 1KVUA 3P2OA 1C0LA 1IUKA 4IDEA 3UH1A 4OJNA 1BRMA 1GUZA 2CMDA 5CDTA 3NJ8A 4JJIA 4D0SA 3L77A 1GD1O 2QX7A 4E2YA 3EHEA 3PI7A 3UXYA 3I3OA 4W82A 4PVCA 3ZHBA 5DOVA 4IY1A 5CG1A 2BKAA 3VZQA 8ADHA 1NVMB 2J3HA 3QIVA 3WLEA 4PZDA 1ZCJA 1UXHA 3D3WB 3QV1A 4YTEA 1PJTA 1PQWA 1Q1NA 1A5ZA 3W1VA 3KV3O 1BXGA 1MLDA 4FPXA 1I30A 2QYSA 4M1QA 5KTKA 3KRTA 1T2AA 2HCTA 4I1IA 4GAEA 2HQ1A 3VPHA 1ADBA 2QRKA 1LLUA 5DCWA 3OQBA 5KJ1A 4GGOA 4QFCA 4J3FA 4CV2A 5EPOA 3D0OA 2JAHA 2I6TA 4CLDA 4RPLA 4Q3NA 4W9NA 3KTDA 3T7EA 2G17A 1I32A 4MVJI 3ZU4A 3S2IA 2YV1A 4OIMA 1EE9A 4PLGA 1Z82A 1R12A 4O59O 4HFMA 2C07A 5KVCA 1Q0HA 4AJPA 3I9LA 1A27A 3HDYA 4CM5A 1PS8A 5THKA 2PKQO 3PLNA 3VC7A 4K9DA 4EJ6A 5EQFA 3TZ6A 1YE3A 1GYQA 1XEAA 4D42A 5IFLA 2E6UX 2VUTA 4IJVA 4MP6A 5HBRA 1ADFA 2BGKA 2DPHA 4QFDA 4XB1A 3VH3A 5JC1A 2RHRA 2VCYA 3RIHA 1P44A 3ICPA 3RC2A 5L4SA 4DREA 5C37A 1QSGA 4TZKA 5L95A 4YT5A 4FD3A 3V8BA 4UAGA 1UXIA 2GRAA 1U8XX 1WMBA 2PK3A 4L74A 1OBFO 1CETA 4DXHA 4J0FA 3UGKA 4UEOA 1CQIA 3AJRA 4F6LA 3BHMA 2HJRA 3AW9A 1BW9B 4WLOA 4ZA2A 1T4BA 1PSDA 4XJSA 2VN8A 4JP3A 2OO5A 2Q50A 3QLJA 4I9NA 3OA2A 1NVGA 2Q45A 2VUUA 2BFMA 3UOGA 4OSOA 3ZI0A 3R0IA 1JAYA 1DOHA 1KY5A 2D5CA 1OC4A 4FOSA 3ZWCA 2Q2VA 4CLOA 2VOJA 2Q49A 2HK9A 4NR0A 5AQ1A 4OKIA 4CQLB 4R69A 4NK4A 3JQFA 3MWDB 4X54A 4ZN6A 2E49A 2D8AA 4YAJA 1T2DA 3DWFA 1TI7A 4HBGA 4INAA 4AL4A 1B7GO 4RVSA 3AFNA 1UZNA 5FI5A 1AUPA 4KMSA 4YPOA 4J0EA 3ITKA 5B4UA 4CUZA 3ASUA 5DN9A 3LT2A 3N7UA 4BO8A 2DVMA 5H83A 4CM8A 3KXDA 2PTGA 4OOEA 2B5VA 3RWBA 1EMDA 4WUVA 1P33A 3QJ5A 4WEOA 1GV1A 2AQIA 4R5HA 4Z0PA 7ADHA 3BMNB 3Q6IA 3VHRA 3F9IA 2W2LD 2X9GA 3K2BA 2ZK7A 4E5NA 4GLLA 3C8MA 4ALLA 1PJ4A 1IE3A 1Y5RA 1LI4A 5JAQA 1C1XA 4JK3A 4GX2A 2YHUA 1JDJA 1IPFA 3FBGA 4O1MA 3INTA 4XWYA 4BNZA 1V8BA 4NBRA 4AJHA 5JY6A 3CZRA 3SJUA 4BGUA 5CG2A 4HKTA 4Q9NA 4D41A 4EJMA 1GUYA 1Y8QA 4J91A 5TC4A 3D1LA 3KZVA 3GRKA 1D7OA 1PS0A 4N5MA 4DTIA 3U9LA 2OP1A 3TZHA 1U3UA 3BMQB 3M1AA 1B8PA 3PXXA 4BMVA 2O2YA 5ITWA 3DZKA 4BB6A 2C59A 1JN0A 3SLKA 3DEYX 2NU7A 2VWQA 4D3DA 5ER9A 2VOEA 2Y1OA 1LRLA 3B70A 3VPXA 1RM5A 2FSSA 2NLOA 3DONA 2VUSA 2VZ0A 4RQTA 1Y8RB 3EZLA 2GZ3A 4AJOA 3FNHA 2PZKA 2WYVA 3DZHA 5JMPA 5T64A 3GDGA 4RVHA 1DFGA 1ENOA 4M86A 3VPGA 5AVOA 1DO8A 5CFZA 1C0IA 4IMPA 5I7FA 2IZ1A 2Y1FA 1R4MB 5JCJD 1C1DB 1NM5A 3EZYA 4TROA 2GPTA 3BAZA 4C4OA 3ITDA 4D3SA 2PZMA 1FF9A 2PKRA 3WWYA 4ESOA 5K9ZA 1VJ0A 3GG2A 3TRIA 1B0AA 4JBHA 4ZQEA 4PLPA 1E6WA 1PU2A 2UUPA 2Q4BA 3EDMA 1G1AA 4FFOA 1VRWA 4FJ1A 1KC3A 2NU8A 4YJHB 4E5KA 3RAJA 1H2BA 2P5UA 1X7HA 1P9LA 4L4RA 4D44A 3GVHA 4FFLA 3SJ7A 3TOXA 3NDRA 2OFPA 3LC1O 4W99A 2RIRA 2DUWA 4RF4A 3RBVA 2GCGA 1YB4A 1EVYA 3HNPA 1LDNA 1X1EA 4AICA 3QP9A 4UVDA 1WXDA 2XAAA 1MC4A 1HETA 4MVJM 1QYCA 3ZWXA 1QYVA 2A9FA 4BB5A 1LTHR 3EUWA 3ETGA
chains in the Genus database with same CATH superfamily
3BYZA 3N8HA 4E4YA 3E5RA 1SA0A 1M1YA 2NV0A 3A1DA 4DCJA 3PVSA 2F9MA 4RC9A 3AL3A 2R7MA 4B31A 5JAIA 3O8BA 1IHXA 2H51A 1U0SY 3MUFA 3SC3A 2BBTA 4R16A 1ML4A 2QRPA 4WKNA 3FCYA 3TX6A 3G0OA 1IY8A 3E27A 1XTRA 5FF9A 4DB4A 4GD3Q 2ECKA 4OP2A 2HWWA 5GZ6A 3B82A 1WY5A 4NCNA 4MWBA 1V6AA 4MV0A 3D8NA 3NUZA 4QWWA 1E2KA 3MS7A 4OXXA 5KYUB 1ZJ6A 5FBHA 4X1KB 3VO2A 1A82A 3VDRA 3W2FA 3DEAA 4C21A 3K9FC 1XWFA 5EIXA 3ZV5A 1SXJB 1H8EA 2YNMC 2VAVA 2J3JA 5AOAA 1QIEA 4Z7NB 2B2NA 3PITA 2JI8A 1E5LA 1T3GA 2HJSA 3HKEA 2AMLA 4A8JB 1LPPA 4B7XA 4BP1A 4YMGA 1AOXA 2HBRA 3UUWA 5HKAA 3AESB 3HFSA 2E4YA 1YVDA 3IP6A 5HTOA 3L7JA 3WBJA 2RONA 1MEEA 4UHKA 4ADSG 2NPFA 4HRXA 3UMRA 1T91A 1KAMA 3JRWA 1J8YF 3AY0A 1JQAA 1YBHA 2FB9A 1P0QA 2QORA 4TX1A 3AEYA 2H00A 1BKDR 4DC0A 1QPGA 3NAMA 1WB9A 4DIDA 1AZLA 5K03A 1A7UA 1LF0A 1L5OA 4NV1A 4PF1A 2C96A 2LR0A 1RYDA 1J09A 1QIJA 2D5BA 4MAFA 3WTBA 1E2NA 5LU9A 5CBPB 1WTCA 2QT1A 2V0GA 3SP1A 4FKBA 4OFWA 2J45A 5TEWA 3WIEA 4H15A 3TAXA 4RSRA 2HHLA 3E0QA 3PHHA 3B13B 4LYDA 5GWXA 1KE2A 3T41A 2JANA 2Y0BA 4CM1A 5HYVA 3T9BA 3NHYA 5DRYA 4U7FA 4OJTA 4HZGA 2EV9A 2V97A 2QJTA 2W6MA 2Q4DA 3A4VA 3N8IA 3OKFA 3RU7A 2J9FB 3E48A 3A26A 2Q6LA 2IYPA 3RUCA 1ZRNA 2A4KA 5CEFA 4BKUA 1IL0A 4Q3EA 3ZDDA 2BOVA 5KJCA 1IZ8A 2IEIA 2FX5A 3O1IC 3S2ZA 3G7NA 1JL3A 1UH5A 3TW8A 3E9RA 3X1YA 2VQ3A 1OH7A 3N76A 5ALRA 3TNJA 4N49A 4YPFA 2OBNA 2CHFA 2X5OA 3P9IA 3W9SA 4L6IA 3V55A 2J7KA 2H63A 2V3WA 1Z4MA 1H85A 3GT0A 3NTUA 4G97A 4GX1A 5F5NA 1GILA 2EX0A 4QD3A 4XYEA 1NBME 2VEOA 2O50A 4JYAB 1FNNA 1XDZA 2OK8A 2FG7C 2QUIA 3HR8A 1SMKA 1SBTA 2BFEA 3FM9A 3WX0A 1IUNA 4EW1A 4K9PA 4W4TA 3ZGZA 5FOUA 4KNVA 2CNLA 1F2TB 4J6FA 1RXYA 3L92A 4OFZA 1G20A 4DCGA 3G1WA 1CNFA 3X1WA 2HQRA 5B6IA 4X65B 1DIHA 1JKFA 1FNBA 2OHXA 2R4QA 3ES9A 4HS4A 5AUPB 2OT3B 4EG3A 2FUG1 1Q92A 2GZAA 4QDUA 1QP0A 3RC8A 4JUAA 4RTQA 1A8PA 3TOVA 4EG5A 421PA 3OZXA 4MDFA 4OL0A 4YR7A 1IXRC 2P3OA 3LLMA 1RJ9B 4Y67A 5BN5B 4P38A 3RK0A 5CLHA 2HQOA 4HWPA 3ZVRA 3OPMA 5JBIA 4IHJF 4QVKA 4IO0A 1J2TA 2WEKA 5IJWA 5JMTA 1JG1A 2JHFA 1T0HB 3FJ1A 2A4MA 3BL6A 2AOTA 2PLAA 3JWGA 4XARA 3A6PC 4LRQA 5AVKA 1Y3HA 5JZMA 4K9KA 2IA5A 4AY6A 1Y5LA 1W85B 4TQGA 1HZJA 4ZI7F 3A28A 1Q6ZA 1UZLA 2LPMA 3FHOA 3AQIA 3FWNA 3L1KA 1IRXA 4NCXA 1SG6A 4RXTA 4V1CA 3GRCA 2Z2JA 4HDNB 4Q93A 4XGRA 1WMEA 3R7SA 1FFGA 5BV2P 3U49A 2H4ZA 4N0MA 4DM7A 3AZOA 5BYJA 4HNAA 1WEKA 1ZGHA 2HRZA 2Q07A 1XWWA 1DMSA 2QNBA 5KVVA 2DERA 3AILA 1M1UA 4N40A 4BN4A 3IKVA 3MRSA 1I51A 2QNRA 3AFIA 3HVIA 3NH6A 4XCXA 3UWMA 2L2QA 1N1GA 2C1XA 2Z3ZA 1U8ZA 1CY0A 4E2ZA 4HTFA 4OJQA 2WB2A 4UAJA 3F71A 1JLHA 4UUNA 4TKZA 3OQOA 4F2PA 1DQSA 2PLNA 3ONDA 3WS7A 5JYDA 5FOSA 5JWHA 1QVZA 1URPA 2AJDA 4WIAA 1ZLYA 2QR5A 4S1VA 5B30A 1I10A 2HA6A 2JLAA 3FIUA 4V3BA 4B7AA 4UULA 1JEQA 1QHNA 4LCEA 4GM4A 4OLFA 4XD2A 3AZQA 3TZKA 3ZWVA 2FE1A 2WTEA 3OZCA 4LZNA 3VI4B 2W90A 1T36A 4KAFA 3Q8WA 1DG3A 1S2DA 2GZRA 2IPXA 5IHXA 1CWUA 1PBNA 1YS4A 2TECE 4JXJA 4EPWA 721PA 5L6LB 1A9XB 1U5BB 2XMDA 4OMCA 4KZKA 4O2BB 2VJQA 2VJPA 3NHKA 1TAQA 3PDIA 2ZVJA 5EZYA 2ZWVA 2ZTVA 3T38A 4MW9A 5AOCA 1DX4A 2JGAA 1RKUA 2ODQA 4D92A 1U4NA 3B5EA 3SM9A 3HV0A 2FPOA 3UTDA 4J3JA 1LBIA 3BKWA 3FAKA 2JD1A 1J1ZA 4GGPA 2ZJ5A 3U1VA 4M0LA 1JDVA 5CCBA 1HFKA 3FOEC 2NYUA 4FWIB 4LN1A 4PSCA 3O4VA 3ZLTA 5TMEA 1WXGA 2B35A 4KR7A 5ADWA 4ZO4A 5B3JA 3OIFA 3D81A 3QKRA 2BDTA 5LBIA 4PZZA 3HJAA 4MJ7A 2X7JA 4B84A 1BE0A 2J87A 2LNDA 3KLOA 3P1JA 4BLPA 2WYUA 4TKVA 4Y2SA 1V3UA 3K0AB 3KVNA 1FB5A 4EO4A 2ZB7A 3ONFA 2EXXA 3DBHB 3E7XA 3GPLA 2EKBA 2ZWAA 3CUKA 6NULA 3ADOA 3B3AA 3U6BA 1PWXA 4QODA 3TINA 2Q9UA 4YP7A 3ZNNA 4BIIA 3E9EA 1QIGA 1UPUA 1MPTA 3UMSA 3CUSA 2VF5X 1MFPA 3CRQA 2PAFA 4RSGA 3H9GA 2WR8A 4UMEA 4X71A 3C7TA 2O07A 4ZI7B 5J4LA 4C2BA 3HRIA 5KNCA 1YIOA 3EIOA 3JZFA 2Q1XA 2HR1A 1K6IA 1PYGA 3ICEA 2ZM5A 4EEKA 3A6ZA 3AUUA 1E1RA 2ORVA 2FR8C 2QIOA 3CJTA 4PLVA 4TKMA 5FLYA 4LYHA 4KG7A 3Q5GA 2J0VA 1JYSA 4NH0A 3IQDB 2ZYTX 4F91B 2GQ0A 2J7PA 4UUQA 3W3AD 1MVNA 5IVDA 4J03A 2X4GA 5KYWB 1HYEA 1ZRMA 3K2QA 1YOVA 4NCIA 4V38A 2PUCA 1KDRA 2H8KA 2VJMA 2VJAA 2Y6UA 1P7VA 3WAKA 1Z2DA 3V8MA 2ZUCA 2FVYA 3KEGA 4P3KA 1M7HA 4AO7A 1T8SA 2NZXA 3LBNA 3BWXA 4Z7OB 4BVAA 3RSQA 4ENRA 5JARA 3UMVA 5K20A 4KO3S 2P6RA 2TMYA 2R4TA 4RLQA 2IZ0A 1IC6A 4FWBA 1GGVA 2ZRBA 4ONEA 5ES4B 2QRVA 3PT9A 4EEXA 3EF0A 5AOVA 5AICA 1NLUA 4GC9A 4XEHA 2X58A 3IERA 4EI7A 4Q02A 5AFSA 2IF0A 3CYFA 2PX3A 4I08A 2L42A 1Y6GA 3T5TA 1CF2O 3RNOA 5LD2B 2BFFA 2JFVA 3QYJA 4LRSB 5K4GA 3ECCA 5K3CA 3W6PA 1M0EA 2DWUA 2HBYA 4RPHA 1QFSA 1R8SA 2MDTA 2Q3HA 1XPJA 3VYUB 3LSTA 4Q01A 2DQZA 3D4LA 2NUPB 4ZO9A 1MF7A 2PGLA 4HB0A 4JR1A 1HLFA 5JD4A 1HEIA 1Z2PX 4Y8VA 5G3YA 3QXHA 1YFKA 2R1TB 3TQIA 2HIHA 1JIXA 3S1SA 2X4LA 1EQUA 1GU7A 1T1GA 3KT0A 1SHLA 4WXMA 2PEZA 3JZIA 2CNWD 4I8XA 1ZH6A 4M0MA 3CNHA 3AY3A 2UVQA 4RF3A 3U3MA 4N39A 4D80A 1IH8A 2CXTA 2GUWA 4KX5A 1N5KA 5DISB 2AOUA 3JWJA 4IDPA 4IDFA 5DX1A 5AWFC 5JT1A 5T4HA 3QITA 1TVEA 2P2ZA 1P1KA 4Y18A 3ESRA 5J5CA 3UXEA 4MZDA 2BY4A 2HTFA 2IXAA 2JAPA 2OAP1 2OENG 3H7AA 4QPPA 5COAA 3VZCA 4RHEA 3DH0A 1D2AA 1JBQA 1FK8A 1VMIA 2DPXA 1DIBA 3HJUA 3O4JA 3RROA 3BCUA 3GR6A 4A27A 4BKPA 2GYYA 3OI7A 5A1TA 1EUCB 4A5OA 1X70A 3DDWA 4U7DA 1NXVA 3LBHA 3AG6A 4JP2A 3RGWS 1YS9A 3DT9A 1YBFA 1RXCA 4RZUA 4B6QA 5KSWB 3H83A 1KEWA 1PKXA 2AG0A 2FUEA 4O2RA 4PYIA 2MINB 2NYAA 2B4RO 3WIDA 1RRMA 1Z7GA 3LUGA 4HVLA 2IELA 5A9SA 1MT0A 1EGVB 2JCXA 3L0DA 4RZHA 3VU3A 3CURA 5CT8A 1OAAA 3FLMA 4D9MA 1GPJA 5IRCD 2R25B 5C46F 4G26A 1VIMA 1DCKA 2FW0A 1KI9A 4G56A 4R41A 1SQ6A 2H1IA 1QCZA 4CIVA 1ZN7A 1M7GA 2PJZA 4PGMA 4CKEB 4EG7A 4P0TA 4UDYX 4WOBA 1O96B 4DJJA 4WACA 1YRLA 2V7VA 2B5WA 1NP7A 3REQB 2XVMA 2VPIA 3R0XA 3EPKA 3L7LA 4EX7A 1L5MA 3JQBA 3COZA 2DHDA 4GVPA 5FWAA 2D6FA 3D7NA 4CMAA 2REOA 2YMPA 2YC2C 3HNRA 5EKDA 3T99A 1E79A 1ONSA 1CUUA 2Y68A 1A8SA 1NX6A 4UHFA 3V4FA 3RRFA 2QL9A 3MB5A 1LBEA 3NWEA 3O1JC 4YJFA 1IIBA 2JH8A 3AEQB 2Y1LA 3EAGA 2GBCA 2R5FA 2E37A 2VLIA 2X15A 2XYQA 4I5EA 3WGTA 5IJ9A 3KSAC 1FFDA 1MX5A 3GZ4A 2P6OA 1LSUA 3K1JA 1DAPA 4ZAYA 3WTCA 3JALB 4YYZA 1F4LA 5CT9A 3KHKA 4LV6A 4URXR 1KF0A 2IXEA 1NQ5A 2VJNA 3KFXA 3VOTA 1VGVA 2Y0PA 4UAVA 1H23A 4BC1A 4MKHA 3OEWA 4LJAA 5GJCA 5BYBA 3ANLA 3G49A 2ZAIA 4Y30A 4CF6A 4WXRA 2DWOA 2IYOA 2VBFA 3W78A 4B6OA 4BFUA 1YJ5A 2GCEA 5AKHA 4F97A 2H1CA 3C6BA 1KO7A 3PP8A 4XJVA 3CGWA 3DULA 3EZXA 3KP1A 9LDBA 3RVOA 4ARSA 4A73A 4MYDA 4E08A 4JAVC 1J97A 4FMDF 3TMAA 2E9SA 1U1EA 2WT8A 4CFSA 5C7IO 2NO9A 4RJ2A 4MGHA 5F9FA 4XR9A 1WUYA 3CH7A 5DGXA 5ALOA 1E7SA 4BKQA 2CC2A 1JLLA 3IDFA 2KE5A 3THXB 3NTVA 2AEJA 2HSJA 2JGKA 3R9XB 3NM4A 1YHNA 3AIKA 2WFLB 4LHWA 2ZJBA 1V9SA 4WN9A 4DUGA 2VK8A 3KR1A 3CXRA 3PX7A 2ZIWB 3MYRA 1KAEA 3IB3A 2X8LA 4AQYB 4R8KA 1N2GA 2GNPA 4GH5A 4Y2TA 2JFNA 3R20A 1FFXA 3LA6A 2A9KA 3AIMA 1NTRA 1D2CA 4FVTA 1NKTA 1X38A 2C4WA 3FB1A 4QECA 1I0IA 2WJGA 3BRWA 4IJMA 1A98A 3FSRA 4LXHA 1WPQA 2E5WA 4B09A 1ZA2A 2V1UA 3DEZA 3NV9A 4H27A 2JJ2D 4I50A 1P19A 2Q2QA 1U8TA 4AIIA 3SKVA 1DEHA 5K51A 1A4RA 1SKAA 2PYZA 4HUJA 2BH9A 1B1CA 1IUOA 3QLVA 1DLIA 4P7JA 5FO1A 4H0FA 2YOHA 3TIVA 3ZIAA 5EHZA 4BO6A 2C7QA 2H6EA 2Q0QA 4Q3AA 4RUKA 3T1VA 3NCTA 2AVNA 1N4DA 3NTXA 5EJGA 5L7WA 1UDXA 2Y0EA 3VHXB 3EAFA 1IM8A 1FSPA 3QK7A 1PUJA 4IWYA 3QE9Y 1N7IA 4KXUA 3TBHA 1ZH2A 2WTNA 1MIOB 2P5TB 3GRUA 1G41A 4JLKA 1T0PA 3CVJA 2A6PA 2O7VA 2VHCA 3FWYA 1MNAA 1MJGA 3DAYA 1OBVA 4Z1MA 4P8RA 1FP6A 3ZHOA 4PNPA 2HAEA 2VWHA 5E2BA 4LHEA 3AB7A 1PK7A 2POCA 2FW7A 3DOHA 1MEJA 4MLPA 4L8VA 2KS6A 3OWOA 1KJQA 3FYCA 3E3LA 5DGIA 1EFPB 5EXEA 4DJAA 1OKKD 3FNRA 3I2IA 3QNMA 2HMUA 4GRIA 2ZBDA 3C48A 1TCCA 3ILHA 3NP7A 4FEEA 4KHPB 4NDNE 5I7EA 1T4MA 4E2FA 1QK4A 1Q1QA 1BCSA 4JVNA 5GY7A 1NYLA 1TF2A 2AYXA 4DMGA 3WL4A 4H6VA 4XYMA 2PQ2A 2I6FA 3ZKAA 1XQ6A 4MRRA 4A10A 2F43B 3U48A 1ZRSA 4HZUB 4EI2A 1QLHA 5CB0A 1ODLA 2GLUA 2Q1SA 1NBIA 3JD4A 4FMDB 2CJFA 1TQ6A 2JVIA 4IQFA 3TRHA 3W3AH 4E7PA 5I7SA 1UKYA 3LKVA 4DLLA 3VYWA 2YZMA 2RG1A 2UKDA 3ROKA 2XGMA 2SKDA 3FOWA 4DV0B 3WZLA 5D8DA 3ZKWB 1AU9A 2BLLA 1J4AA 1O8CA 3DE5X 1Z2CA 3E22B 5IBQA 3M7IA 3J81k 4MZXA 3ZLJA 3H5IA 3WG9A 1JRLA 1XVIA 1WY7A 3GH3A 3AJ9A 3L41A 2QPLA 3V32A 2G9UA 4PPQA 2GX6A 3LOQA 2PX2A 4RESA 2H65A 3MAJA 2AS0A 3EFHA 4CQMD 2VTBA 2GHRA 3U1TA 2YV5A 3NNSA 1BDIA 3DPSA 2UZIR 2CK3D 4LSMA 5EXSA 2G4VA 3R5XA 3EXHC 3UUFA 1J49A 1XJ0A 1ZMRA 4MJ3A 1CUIA 1XELA 1D03A 2R79A 3MJTA 4N7MA 2OVFA 4P4NA 1VBNA 2J4FA 3LRTA 1Y33E 4XVUA 2YV3A 2QTVA 4F92B 5CVDA 1A9TA 1P2VA 2GKOA 1UM9A 1W4RA 3JPYA 3LV8A 4GOND 4IH1A 4P3OA 4CKCA 3EQ6A 5A3QA 5IKEA 5AKIA 2B5OA 4E6PA 4X0EA 4AJNA 4QOEA 3OO1A 1SURA 2Y0CA 1Z68A 2F9LA 2LBPA 4H9GA 2J9ZB 3R0ZA 3OF2A 1ZGAA 3RTEA 3AEUA 1RKXA 2G28A 4CW7A 2J3KA 4BB9A 1SHTX 4C3ZA 4YUAA 1J24A 2O1WA 2D2FA 1II8A 1N2XA 5DSZA 4IIYA 3VTAA 2GM3A 4NICA 4H7HA 2C57A 1KYZA 2BH2A 2HBZA 5DYNA 3K8OE 1AA9A 4ZARA 2WQ7A 4ZTZB 3PNOA 1SPXA 1V4BA 4JY7A 3WAJA 4WESB 1O9BA 1BX0A 2CGEA 2TMKA 4FQ7A 4E0BA 3K6SA 1ODIA 2F17A 3K05A 3P32A 1XF1A 4KOEC 4TLEA 1RPTA 3TAHA 7AT1A 4KXXA 3DW1X 3F67A 4V2IA 4C30A 5BN3B 3CKKA 1QHFA 1X1SA 2DUJA 2XUKA 1U9ZA 5E7IA 3T1HB 4DLPA 1K88A 3DC7A 1DX6A 5CFOA 4CWAA 2WU8A 3IPCA 2ZSJA 1SIUA 2WJVA 2QJOA 1NVKA 1NBOA 4TMYA 3CUYA 4N0PA 3OQMA 1R9MA 4EGAA 4ZYWA 2G72A 4JP8A 3ZD8A 3JQDA 5J4VA 1Q7GA 4LF7B 4F7DA 1CUJA 5JFGA 3AT1A 5B6JA 1ZOLA 5A4FS 3JQEA 4D0GA 3ZU3A 4KI7A 3G89A 2JIZA 2FG6C 3LG2A 4DQDA 1NJFA 3I28A 1USUA 3K0HA 1JKMA 4FFNA 5G4KB 2HREA 2OWDA 2VKQA 3T5CA 2G4CA 2CLOB 4URVR 2DGDA 1CR0A 1F20A 2O0JA 2WM2A 3CW2A 1SM4A 1BA2A 1LWNA 3L1IA 4HWOA 1JHAA 4HSGA 4BWVA 2Q3FA 2QTZA 4KQEA 5CB4F 3RK1A 1HA3A 5AW9A 1LPNA 3WGKA 3EBLA 2GVNA 3UCFA 2BE7A 4FS8A 3GCWA 4OA5A 4TV9B 1OGYA 4N9WA 3ZE7A 4BX2A 5HIJA 2BPOA 1QHHB 1XMSA 5CFPA 3JYNA 5FUQA 4UKDA 2O8DA 1OXKB 4HS9A 5IKMA 4JN6B 2QVZX 4INPA 3ZHYA 1H5NA 3RS0A 4EAAA 5JV5A 4CDGA 4EYGA 5JS8A 4YAIA 4CHTA 4XYLA 4FU0A 2R8BA 3DXXA 1Z56C 2V45A 3VR3D 2PVSA 5BSGA 2VSXA 2VNAA 4FFBB 4QPDA 1YZUA 1OWPA 5JISA 1JVBA 2VDWA 3ADBA 1FRZA 1W9MA 1Y1SA 4O4IA 3RDPA 2A0XA 2YZNA 4LY9A 3Q9LA 3KKKA 2GTPA 1ESCA 4D7AA 4PGGA 1N7GA 3EQ7A 3UGQA 1JDBC 1PTKA 4QXRA 3WMEA 1NLZA 4N5LA 2KBEA 3DMFA 3ZJ5A 1B1AA 1PUXA 1NF3A 1E9SA 1Q20A 2GF0A 3G2PA 3R8XA 3RS9A 5KYXB 2YJ3A 1C1HA 4XEUA 4YRKA 4RTSA 2WB4A 3ASZA 2VYVA 1FMCA 5I5GA 3RJ9A 3AR6A 5H4GA 1YR9A 1L9KA 1YQGA 1YSCA 3AWIA 3DMPA 1MMFB 3GLQA 5M29A 1OZ0A 3HDHA 3KYCB 4C01A 1L7MA 2IDKA 1V2HE 1Z75A 3HDJA 4BMYA 2HBQA 2LTAA 3KWFA 1M7BA 2AI2A 4GOJA 1XZCA 1KQFA 4HLUA 1W5TA 1OVMA 3IEUA 3V1UA 1LK5A 4DC9A 1Q0TA 4M9UA 3ZQJA 3M5WA 3O83A 3ZCQA 2BF7A 2BONA 1V0JA 2WU0A 1YRBA 1Z0ZA 2ZSAA 3OJFA 4UAUA 1WXWA 5EMJA 3QM1A 5L7YA 1MJ5A 4EB6B 1OYOA 2EWMA 4X7RA 4CMIA 3LK6A 5DM1A 3LA8A 2PSSA 4IFBA 1NFQA 3WRYC 4GW3A 2WKRA 5CGZA 3ZDCA 1ZN9A 4FONA 2Y1EA 4B3RB 4F2GA 4U2BA 1TU3A 3E6AA 1EUZA 1QYWA 5AK3A 1KJZA 3G2LA 4YDHB 3W4JA 3ADPA 1W581 2F9FA 3DCJA 2F67A 4Q4HA 2F1OA 2PH1A 1P80A 2DFKB 4D8YA 2YMMA 1GSOA 3TL6A 4ZO6A 1DWQA 2FMUA 2CNOA 2GKGA 1W5SA 4KSBA 3I9FA 1UWKA 4L4UA 2JLUA 1SHJA 1GKLA 2CF5A 5KQRA 4BFCA 5FNVF 4K9QA 3QOXA 2XBMA 2JCGA 2YY6A 4LS3A 4MTCA 4DC1A 2RK4A 4DV2B 5LYJF 2I55A 3D8BA 3RC7A 4OI0A 1RHQA 1W5FA 2GKSA 3GJ3A 5G1OA 3T5GA 4ED9A 2W6IA 2VJKA 3PYLA 4CLRB 2C3MA 4WK2B 4J16A 4X00A 1P60A 4IPTA 1JJFA 1QB7A 1T5IA 1TCUA 2JFHA 4ZHQF 5CCDA 2HDWA 1FNDA 4K2HA 3W6UA 3R3WA 5JO0A 3I01A 1VE9A 4PPFA 3OQJA 2JFGA 2EW2A 4M0EA 4DV1B 2FQYA 4JBGA 4BKRA 2ZIVB 3CQ9A 4KUEA 5A05A 4H18A 1FDRA 3WGOA 4BNGA 3WMFA 4G23A 1C7ZA 1KI4A 3WK5A 2P0EA 4HDQB 2O2SA 3KDSE 4V0ME 4ZANA 1MV5A 3FPKA 2RB4A 2AFHB 2XWQA 3C7CB 3ANNA 2BCEA 3OOEA 1YZFA 3IQHX 4LQDA 2V4MA 4LNUB 1EFRD 1NE7A 1PFUA 1V3TA 2AKYA 2OHHA 1BXGB 3BRCA 3SC2B 2C3PA 7MDHA 2I54A 1WEHA 4IVRA 2ZQYA 1UBHS 4EKEA 2IYQA 2QBYA 5CW1A 2X2PA 1TQDA 3A6HA 2KI5A 5JECA 1OROA 3QBVA 4TTVA 3WJ7A 4BATA 1OBHA 4NECA 5DTRA 4N3CA 4YP1A 3PE6A 3SC4A 3GT3A 1F2DA 1MT3A 2P3SA 4JGIA 1KPGA 3EEQA 4KKXB 1JEJA 1W6UA 2WT9A 3LDFA 4GZ5A 3JPWA 1I3NA 4FT4A 3CU5A 3LXMA 1V48A 2FQ1A 4G81A 1PIWA 3HA5A 4F6CA 4UFOA 3E9DA 4HG2A 2GCPA 2IP4A 4TM7A 1R8XA 3QUQA 2E4VA 3LZCA 1D4FA 5CRIA 1G8KA 2Q8PA 5A7GA 3WIVA 3WMRA 1WQ1R 1XXHB 2F7SA 2HB6A 3NOXA 3NANA 2FZEA 4MUHA 5F4BA 5JLAA 4ZK6A 1M2GA 4O4JF 2Q3JA 3U81A 2ERXA 1OHHA 3PFNA 5FOWA 4MPJA 3EX7C 2EOAA 2O1SA 1UMBB 3BGWA 3CZMA 2Y67A 3SHVA 3FVQA 4BVLA 3THYB 3DHVA 1EK2A 1T1SA 3L6UA 1F3OA 3ZG6A 4MYRA 2IEBA 3AI2A 4IZOA 1G291 1KGSA 2ACWA 2DR3A 5KKCA 5LYJB 2DY1A 4IOMA 3NORA 4K6MA 3T5MA 3VA7A 2P65A 2X41A 3DQZA 5EE1A 4JSTA 4FT2A 3NRCA 3RQIA 3OSZA 3TJRA 1QV6A 3Q0EA 4KODA 1FS4A 2TYSB 4ZHQB 4IIUA 1NVAA 2DBYA 4B48A 1X3SA 5DO9A 4Q9AA 1AA6A 2DPMA 2Z8YA 4BJHB 4EHAA 4F56A 4FIZA 4RVCA 5AW1A 3L3BA 4AULA 2C29D 5JSQA 4A03A 3GWZA 1S6YA 3EWIA 3OQ1A 4HRVA 4DXDA 1JEYA 4A8TA 2OYSA 2BEWA 4G4IA 3SHQA 5HQTA 2OCXA 2IOHA 4MJLA 1SUBA 2VXCA 3WGVA 4R8VA 1PCXA 2FQQA 3DOCA 1D8AA 5KSYA 4MB0A 1QRAA 2R66A 2PKQP 2WFZA 5THQA 3I05A 3WDLA 2Q1UA 2VHXA 1EWRA 3SX2A 2C4UA 2X1VA 1B16A 1X7ZB 2P3LA 4NS1A 5EIOA 1DAHA 1GAWA 1V35A 2NU6A 4CLOB 2WG2A 4YRMA 4HWTA 2ZT5A 3FOBA 3OEYA 5F2KA 2RI1A 1XD8A 4LZPA 3RO7A 4DDHA 4KDEA 4PFJA 4EG4A 3MJCA 2ECOA 1YULA 4BTVA 4Q66C 5BYKA 2C7PA 3GELA 1WNTA 1TMGE 1J0XO 3UHFA 2GRUA 1SIBE 1KI6A 2F1KA 5I6DA 4WOPA 1QRUA 4V39A 1Q0SA 4AMZA 1FFSA 2JLQA 1QE3A 3C3AA 4KE6A 4KQXA 3C6QA 3BIJA 2ZIGA 5IC5A 1DDGA 3PFCA 1GNQA 2G9VA 1JQBA 3QVLA 4NZMA 2ID9A 3EDCA 1G5FA 3B78A 3MWEB 4CQLA 2BSXA 4WE3A 2FDXA 3CNOA 5DXFA 1OU4A 2QYOA 3BZWA 1C30B 2OB1A 2ZYWX 1MN6A 2G5CA 4XX0A 1JHVA 5A06A 4RLFA 4RKRA 2JGMA 2Z43A 2I4LA 4HEA1 1XYYA 4LBWA 4YLYA 5TRTA 3X1DA 1OV4A 2QT0A 4C3VA 1D2NA 1NURA 2OV8A 4IDBA 4I1SA 4RK5A 2LZ0A 1IDOA 1U04A 2QUAA 2QG9A 2VZ9A 1FDOA 2WIJA 3UUGA 2PLFA 2YJ6A 4EKIA 2IWRA 2CV2A 3OPNA 5AUNB 2VSFA 2LKCA 1U11A 2VAPA 3L06A 5U1PA 2A57A 1BEEA 1HE2A 1MQ8B 2PH7A 2COEA 2TMDA 3IOBA 4RANA 4YO8A 1C1XB 4YXWA 3DE7X 2BFCA 4QBIA 4QTUB 2C2MA 3HFJA 4DMLA 3ME5A 2D7CA 3D3KA 4AX4A 1E3LA 2O2HA 2P4QA 2QUBA 3FRJA 5LL6P 1U7HA 3B12A 1M0SA 5BOVA 3FWZA 5KTNA 3OMXA 3VOAA 2RHHA 1Y8QB 4JT4A 3FCXA 5JI2E 1AXRA 2AQKA 2DJ5A 3CF4G 3KVYA 3P0RA 4L4ZA 3RHFA 1H1TA 4GM1A 1VXRA 1XQYA 3D3EA 4K26A 4M98A 4J0DA 1U81A 2Q41A 3OVMA 3GIDA 3DL2A 1S2LA 1QTNA 1GZVA 1LX7A 2HN9A 1BOFA 2QTGA 5H68A 3BK7A 3RFVA 3PNQA 1KDYA 3STVA 1AY0A 3V7WA 4OXIA 3ZQ6A 5BRJA 4J0GA 4XTRA 2RK3A 3R1IA 2VHZA 3NEYA 2C7VA 1V8FA 3DQQA 1VHDA 1Q44A 3WYEA 1UEJA 4L3WA 2VZEA 2FR0A 3RWMB 2XTMA 3CSUA 1S01A 1V41E 2F8LA 1HFEL 4JB3A 2H9IA 1Z6GA 3EH2A 4R9VA 3EXHB 4CKWB 5T57A 3N87A 2IDZA 4HFRA 5HQ3A 5BSVA 3KQTA 3IESA 3O8NA 3QF4B 1ZIXA 4UOZA 1SZDA 1VSBA 1EEHA 1O5OA 3M9LA 3NDJA 2QJWA 1C7IA 2VHEA 4R40A 3ROZA 4YAGA 2VTEA 4K0RA 3HCFA 5IKPA 3UIEA 3N59A 3EQ2A 1KU0A 3OFKA 1TKAA 1AV7A 4GRAA 3X3HA 1TK9A 4M89A 3LFHA 2ORWA 1D5CA 2I2CA 3E81A 5KSOA 4YAUA 3G85A 1K4KA 3UAXA 4R0VA 5D3ZA 2X1HA 1VJ5A 2LGJA 4Q39A 5G1NA 3EFBA 3VO1A 4F4DA 4NS4A 5TJ9A 1X9GA 4OGLA 5LZ7A 1DOAA 3DV0A 4JIGA 1AG9A 3PDJA 1K89A 3K1AA 4KHZA 1W2HA 2YWJA 4JKIA 1ZX1A 3IALA 1NW7A 1V39A 3KOUA 1BD4A 1BJRE 3OPYA 3M81A 1ECJA 2QRGA 3FGOA 3WNBA 2C9CA 3FKSD 3F90A 4J9VA 2VCEA 3GP5A 1RMYA 2XR1A 5LB2A 4DUZB 1EZZA 2X5XA 3FWPA 3UKDA 2AT1A 2DULA 3L8YA 4ZO7A 4AX8A 4W5TA 4RV5A 1LDGA 2QUJA 5IKOA 1LNSA 1XVAA 3OE1A 4EYSA 4MIYA 3KDPA 3REFA 3B7GA 5D6OA 4YJHA 5D5PA 1R5JA 1U2DA 1TYEB 2QLLA 3C6YA 5G4LA 3AEKA 1JWAB 1A5SB 1NRXA 1W9HA 1ZYUA 3U1BA 5BQ3A 3FSJX 1N5OX 3WO1A 1KYXA 3RVLA 3NBUA 3NVKI 3OE7D 3L79A 2GZ2A 5AW8A 1T8YA 1KFEB 3TBKA 3TFWA 2GN1A 3MBIA 1J7KA 4IDQA 4R2MA 2HA5A 3VVBA 4RTRA 1IY0A 3HJBA 1EUDB 4OI4A 4UHHA 4XSVA 4E13A 2I5PO 2J3MA 3FI9A 1A9ZA 3QSGA 5TMBA 5C5CA 5KX5A 3OOWA 5JDCC 2EJTA 1YR6A 1K6JA 1QH1B 5L45A 5JTUA 1U7PA 1PNRA 1GA1A 1K6XA 2BFDB 3E61A 1IN8A 1FCJA 3KFVA 4ND6A 1YAHA 2NV6A 2ZRGA 1CRLA 4IRMA 4UE2A 1YRWA 5K2MA 4EG8A 4WEQA 4JC8A 2WIDA 4M1MA 4IGKA 2C97A 2Q27A 2WWHA 1G0OA 2Q1WA 2ZTLA 5CAEA 2YBEA 3ZCSA 5MGNA 1NQUA 3TGWA 4KPYA 3MS4A 3H1EA 1XE3A 2MR6A 1JHUA 3HU1A 4ILKA 3GEMA 3X1JA 5KYUA 3HCCA 4Z51A 1D2RA 3MUNA 1UBJS 1YCHA 1DQNA 2O2IA 4X1KA 3VH2A 4Z6KA 4RIEA 3BM5A 4UPDA 5T3YA 4IIXA 2W42A 5G0VA 1A8UA 3QEAZ 3L4SO 1SXJA 4Z9XA 2Q5CA 2Q7OE 2JJ8A 3CRRA 4TLCA 4JU9A 1WOMA 9LDTA 4LZLA 4A1FA 5CDFA 4KQWA 3QBTA 4M9RA 1SC4A 1XLTC 4YV7A 3JYPA 4A8JA 5K8TA 4MUIA 2DECA 3O0TA 3WNCA 2EEZA 4GSLA 5JALA 2L82A 3AESA 3CLSC 3RT9A 3DHWC 4CNBA 5INTA 8OHMA 2XYPA 3VTKA 3A1NA 3E2IA 3IUSA 3K4QA 4XGIA 1F8GA 2PZLA 1NVWQ 2CFCA 1IIRA 2HXYA 3KUXA 5G2OA 2OESA 4JUCA 4EATA 4EGCB 2O3RA 3REOA 2WJ3A 3GH1A 3SLGA 4AURA 16PKA 1GPLA 4NWIA 1VA4A 1EBBA 3I92A 2CDAA 3D2CA 4YQZA 3AY7A 3UV7A 5DOZA 2V5UA 4C43A 3OTGA 2CLDX 1PNOA 5CBPA 5A4AA 3R9KA 5AYVA 1M6EX 1VKOA 1FFYA 5EY5B 2V98A 3SU8A 2Q3DA 4YQYA 2ZJZA 4FUQA 5F52A 1FBNA 1G9TA 1RQ7A 2A1TR 3AHCA 3N8DA 2ASVA 1VHQA 1SKMA 4PICA 1OMOA 3RD5A 4FZ3A 4JKYA 3K92A 4MV5A 5FWDA 3OOSA 4R84A 3JQFC 5EIEA 2J9FA 3HXMA 3AVWA 2NTJA 4XB2A 5EUCA 2WTUA 2B0JA 2P9YA 1IM5A 4CR8A 2ARKA 1XOIA 5TF4A 3HWSA 5ENZA 3OUUA 4ILEA 2G36A 6GPBA 4RD4A 1YQDA 2JW5A 4Q3LA 3D6TB 3LY5A 4A0QA 3X1ZA 3AUJB 4KLCA 4YJ2F 2GN6A 4GSYA 2OHVA 5EJEA 3FPJA 3LBAA 1G8JA 2D8MA 2GS9A 3TLMA 1A2KC 3LKDA 1GA6A 2DC1A 3NT4A 4XLLA 3W5IA 1FXUA 3CZQA 2QXTA 4POAA 1BDBA 2F1RA 2W6QA 3D4NA 4REMA 2ISQA 5A7FA 1ICEA 3JWIA 4MV4A 2WWYA 2NTNA 5GM1A 3SX4A 4OHUA 1KAGA 1SOAA 3OC6A 1M5RA 5BSMA 1R4NB 4G37A 3ZR4B 2PUFA 3CLHA 3JXEA 3M6XA 3D6HA 4FDVA 5BP7A 1PJQA 2D2EA 1SOMA 4NF2A 3MGGA 1F2TA 3UAGA 1CFZA 4L7VA 5CEEA 3BH6A 1HWYA 4HR7A 1YQXA 4BO7A 1ZK0A 2WU4A 3QVGB 4KWEA 5FUBA 4LTDA 5GMOA 4D9NA 2JCYA 2PRJA 4ZREA 1RJDA 2YFYA 1BYIA 3HA2A 2AD1A 3A1FA 1CRWG 1O08A 1G3IA 1QQ5A 4U9IS 1PAUA 3IO3A 1PHRA 3LUAA 5AVXA 1TO1E 4E4RA 3UJ8A 3BMXA 3KSDO 1F8XA 4GYKA 4X8LA 1P77A 4CTMA 4EY6A 4YBRA 5BN5A 1RJ9A 1RWXA 4BEJA 1P75A 1E8NA 5I9MA 5TQ0B 4AKIA 5FI3A 4HDOB 3RM3A 4NQZA 1J0AA 3BDIA 3NYQA 4HO1X 3LT5A 2WSIA 3CZAA 4EHKA 5HZMA 1UF9A 4EUSA 4Y6SA 1U2SA 2QTCA 3QVWA 1VLJA 1DKLA 1Q7BA 2FN9A 2XE7A 1E0KA 1U2TA 1W85A 5CYFA 4A9AA 3IT1A 3O8CA 1O6ZA 4YO7A 5KCZA 3SF0A 5JEDA 1F7UA 4HDNA 5G0TA 1F0YA 4CJXA 2DM6A 2RJ3A 2ZBPA 1E20A 1QPZA 3T1QA 1B0UA 1RZUA 2H06A 3TJZA 2R60A 5IM5A 3NTOA 3UG7A 4GMHA 1K8ZB 1TT5B 3H9EO 2OTCA 1I3KA 3OFND 5A5FA 1DE0A 2EKDA 1EUYA 1C9JA 2CXPA 4DCVA 5LXTF 1TKCA 3G2MA 2PLRA 5A0VA 1WB4A 3C16C 4ZXPA 3WWZA 4EW3A 1N9GB 1AKWA 2EATA 4F06A 4WY8A 3NKFA 1SPBS 1IOVA 4RVDA 4YY3B 4TL9A 1TFUA 4L5AA 4GL4A 1E58A 1PV2A 1U1IA 2R85A 3NHBA 4U4AA 1CJMA 4YJ2B 5TNXA 4Z0HO 2E7ZA 1CUSA 3GLHB 3H05A 2ZRPA 1A9OA 1XROA 3FVVA 4RDHA 3AYZB 1MU0A 2ZYRA 2BRUA 1KR5A 2B99A 2I9PA 4B0OA 1U5BA 3LCVB 4GPAA 1A7AA 1I4LD 4LVNA 1A9XA 4QA9A 2Z5LA 1F38A 4J4BA 3NOQA 3BJRA 5LDDC 3HS3A 2XIJA 4O2BA 1KJWA 1DEXA 4PYKA 5KU7A 2QV7A 1DDOA 4TRMA 2IOFA 4DCUA 3STXA 4LHXA 1XEFA 4KN6A 5KWIA 3GNQA 4FHDA 1Q19A 5HG0A 2P9BA 3RFXA 4K9OA 3GA5A 2GTHA 1E2JA 2B9EA 3GCXA 1C3XA 4MJXA 1VKNA 3IVAA 1ACMA 4NMWA 4B2PA 1JSZA 4YT8A 1ZD9A 3LGSA 3U7JA 1NRIA 3IT3A 3ZV7A 2FXIA 1E2GA 4OQQA 4AJJA 2XY4A 2XJ9A 3MINB 2X2EA 3C3MA 5HFJA 4PO3X 4PIMA 3U13A 3WNDA 1C9YA 1F5NA 1OYYA 1Y6RA 3DBHA 3I83A 4MRPA 5G0UA 3UW3A 4L8YA 3V5NA 4BFLA 4D96A 4EW2A 1JLRA 4WWHA 2GVDC 3FZNA 2R6JA 4OHXA 3ROQA 2AXEA 4IO1A 1LCIA 1ZU4A 3RVBA 3VGJA 3UWPA 1DIAA 1UXJA 3C3BA 4MWDA 4ZZIA 5JCZA 2BKXA 1P7CA 3UT0A 2FMFA 2YCLA 1EESA 4DIUA 1WF3A 1ZEMA 3A58B 3TIIA 3A9SA 3VHLB 3EEYA 4NBUA 4PGHA 4DVJA 3BL5A 1C29B 1YU9A 4ZI7A 1I14A 1J25A 2QENA 2P9ZA 4J3NA 2A5DA 1NVFA 2A7XA 5AI4A 3OETA 2QVYX 5AJXA 3WP1B 3ZU5A 3P9RA 4HDCA 3IUBA 4L22A 3O7WA 1HEYA 2PMEA 4O1HA 3V8RA 3WLJA 3D7MA 4HWRA 1UM8A 3PI6A 3T3OA 4WDRA