3U09A

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92d) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
MSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNADITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
molecule tags Oxidoreductase
source organism Vibrio cholerae
total genus 92
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u09A00
4DIOA 4AJKA 1P44A 1Z6ZA 3GHYA 4CM1A 3IP3A 1ZVMA 3BMOB 1E6WA 2GSDA 2P5UA 4ND1A 1PX0A 1Z73A 1TXGA 1WDMA 1Q0QA 3WNQA 2WMDA 2HMTA 1DBVO 1LI4A 5EIOA 3COSA 1BXKA 4YCAA 3WB9A 2O3RA 4Q3NA 2DU8A 5FWNA 5IG2A 3GG9A 2Q4EA 5EL0A 3FNHA 1QG6A 2E37A 3HN7A 3S8MA 5IXSA 4FJ1A 5DOVA 1A4UA 1KEPA 3PIIA 5B4VA 3H9EO 3U09A 2I3AA 4JBHA 3ADPA 5KIAA 4JLWA 4A03A 3PHGA 4J1TA 2B5VA 3NDIA 3A4VA 2J6IA 3EGOA 3GN1A 4DYDA 1W73A 4K6CA 2QW8A 2DBVO 1VM6A 4UUPA 1ZBQA 3WIDA 2BFOA 1DIGA 3PPIA 1XCBA 3V2HA 4ROSA 1GEEA 3FR7A 1ZEMA 4CM9A 1ZIDA 4DC1A 4ALNA 3IP1A 3GZ4A 2NUAA 2BKAA 4YAJA 4DA9A 3QVOA 3TFOA 4ZN6A 5FI5A 3D3EA 3LK7A 2Y1EA 1IOLA 1H2BA 2V6FA 3H4VA 2TMDA 4JJFA 1O8CA 3PQDA 1M6WA 4BQPA 4HBGA 4FOSA 3ANLA 2D5AA 1HE4A 1C0LA 5TRTA 5FFFA 4WECA 4FQ8A 1C1DA 3L9XA 3OP4A 1F12A 1P77A 5KVQA 4HY3A 4MIEA 2OP0A 4BNXA 4MVJM 3IJPA 3I9JA 2NU9A 2Z5LA 3BA1A 3DO5A 4JNKA 2C5EA 1AN9A 2VRBA 1Z7BA 3LLVA 2PWZA 4EUFA 2I6TA 4BGVA 3OIGA 4IMPA 1T24A 1UDAA 1YWGO 2GN9A 2V65A 3NRCA 3NV9A 5A9TA 3EW7A 3HFSA 5KCZA 5I9MA 2VN8A 2OXIA 4BS9A 4R1TA 4XQGA 1Q7BA 3EVNA 5JYDA 2AQ8A 3WSWA 3OJEA 3BMNA 4JQCA 5KWEA 3WYBA 3JV7A 1MB4A 1ZJZA 3PQEA 4DLBA 1GZ4A 2X9NA 3BHMA 3RWBA 5IDWA 3CE6A 1LA2A 1D7OA 4UUOA 4R54A 4R68A 2P9GA 1UP4A 1YQGA 3H6KA 5JDCC 1LQTA 1E3WA 5A04A 4CR7A 4PG7A 4E13A 4NZ9A 1LLUA 4FDAA 1XQ1A 1DLJA 1LRKA 3BHJA 5BSGA 3WGIA 1B14A 4RDHA 3TZHA 1R12A 7MDHA 1NHGA 1U28A 5CPFA 4NBUA 2W2LA 4WPGA 1TT5B 2PR2A 3QY9A 1H2HA 2ZIZA 3U4DA 5C37A 2XXJA 5ES3A 3BYZA 5DN9A 4A2CA 3F4BA 2GUGA 5TIIA 2ZTUA 4F6LA 5L7TA 1FXSA 1QV7A 4RORA 1WDLA 4NR0A 4JJGA 1V3UA 4J2OA 4RZHA 1ISMA 1YDEA 5DULA 2X5OA 3I83A 2Q2QA 4W4TA 2AQHA 3RFXA 3NDRA 4IDCA 1BVRA 1I3KA 2DBRA 3T4EA 5IDXA 5I7VA 5TJ9A 4AFNA 4Y6PA 3JTMA 4WUVA 4IDBA 5IZCA 2BH9A 1X0VA 4AJEA 2V6BA 5K6AA 1X7GA 1T2AA 2O4CA 4XZ3A 5GZ6A 3H9QA 3UOGA 1E7RA 1I2CA 4AJIA 1T2CA 4YRDA 4D42A 1DC3A 2H63A 4FD3A 4DBZA 1V0JA 5LDHA 4DPLA 1Q2XA 2XOXA 1DPGA 1N7HA 3AU9A 3PK0A 4PLZA 2YFQA 3GDGA 4YVFA 3FNFA 5L7YA 1XA0A 4IGFA 1GADO 4B7UA 3DXFA 4WKGA 4BKRA 4MVJE 1HYHA 5LDGA 2C7GA 2QQ5A 4EJ6A 3IL2A 1J49A 3GVCA 4NBVA 3G49A 3I6QA 4IQ8A 5C7LO 3MJSA 2C54A 2FR0A 1LLQA 2YZ7A 4KDFA 1H5QA 3WJ7A 2PD4A 6ADHA 2PTGA 1PS0A 2PKQO 2PKQP 5EQFA 4KQWA 5HBRA 3DOJA 5KJCA 3GNSA 1MC4A 2P9CA 1DAPA 3ZI0A 2I5PO 3VOSA 4RF2A 4WEQA 1P0FA 1HL3A 4P4NA 1I3MA 3OM9A 4E32A 1ORRA 1H9AA 3HWRA 3VZPA 4ESOA 3PIDA 5ICSA 4IIVA 4PZCA 2VTEA 5CEEA 3FBGA 4I8XA 4DMMA 4U6SA 3K31A 4E5MA 3AM3A 3TPCA 2ET6A 1NP3A 4ZRNA 4XB2A 1LRJA 1U5AA 5DP2A 4ZQBA 5KJ6A 3JQ9C 3K8ZA 3RFTA 3L07A 1Y6JA 3C1OA 3MEQA 1DB3A 3KYDA 4PIVA 3DZFA 3QE3A 4J0FA 2NWQA 4PG5A 1PJTA 1OOEA 1T26A 2OBNA 1P9LA 1ZSVA 3ZWVA 4E4YA 3NTQA 4NIMA 2H5LA 2NLOA 2F1KA 2DLDA 1KEVA 2E6UX 2YV3A 3K73O 4LN1A 3PHLA 2YHIA 3ZWXA 1CYDA 1FDTA 2BRUA 3G17A 3P5SA 1P3DA 4NNJA 1K0UA 3MJVA 1Q1NA 1HRDA 4GKVA 4HNHA 1LDNA 1R0LA 4PLHA 3S1LA 4XQ9A 4MDHA 3ZV3A 3DMTA 3ANMA 4GKBA 4NBWA 3RJ9A 4HKTA 1ZFNA 2EJWA 1A4IA 3F6YA 3I4CA 4OOEA 3ONEA 3ZN2A 3VPGA 4B3IA 2GNAA 3JQAD 1PJ4A 1XEAA 3UAGA 3JQ7A 5G0WA 5B1YA 1AXEA 3AU8A 2Q1TA 1UXJA 2PZLA 3EZLA 1U9JA 2NQTA 1KVQA 4DQVA 3BXXA 2VWGA 1DFHA 1CQIA 4XRGA 1YJQA 5A05A 3KLMX 4PLPA 3O4RA 2ZCVA 3IKVA 4FFLA 3AUAA 2B36A 3QHAA 1GAEO 1XG5A 5T6BA 3B1FA 4CLEA 3HB5X 2QIOA 4CODB 1F06A 3HUDA 3NKLA 2RH4A 5AXAA 3X2EA 4BO5A 2VT2A 4PLGA 4EJ0A 5T5QA 1Q0HA 4BO8A 4C7KA 1ZEJA 1VSUA 4QTZA 3EYWA 1GV0A 3GVIA 1OBFO 1R6DA 1N9GA 2HRZA 1ENYA 1U2GA 3FN4A 4MOWA 4YQZA 1KC3A 1PQPA 2AEFA 3H5NA 1QYWA 4N54A 4CPDA 1WLYA 2NVWA 3B6ZA 2Y1CA 2VNSA 2WYWA 4Z0TA 3TZ6A 3W8EA 2VTDA 3GUCA 4BNZA 1GY8A 4WASA 3WS7A 4BO4A 5BSFA 4XYBA 3D1LA 4M49A 1C1DB 4BNNA 5LCXA 1YBMA 3L4BA 3AFNA 3PDJA 4TROA 2QYSA 2O2YA 1ZSYA 2B4QA 4GGOA 5EQDA 3H9UA 5CP8A 4E2ZA 3RU9A 3W4IA 4M86A 4ZQHA 1UZLA 2IEDA 3RCBA 1R4NA 4KZPA 4YJHA 1EVJA 4M87A 4YYZA 5ER6A 1ZK3A 3QVXA 3GPIA 4Z9XA 3OA2A 4E21A 2IYOA 1DJQA 1E3LA 1A7KA 2Y1DA 1PJQA 2O48X 4ONEA 3CMCO 2D3TA 5TT0A 1A9ZA 3H2SA 4NU6A 4RQUA 4RLHA 1QYCA 3GMDA 3F1KA 4XGIA 2B0JA 4B3HA 3U3XA 1PJBA 2VWQA 3KSUA 1E7WA 3PXXA 4A73A 3NT2A 3TNLA 1M76A 4CM6A 1WZIA 5A9SA 4PRLA 2C07A 4B7CA 3PYXA 4FIZA 2AXQA 3TL3A 2GCGA 3PGJA 4NBRA 3SX2A 1RM0A 1I33A 1FDSA 2EGHA 4BNVA 1KY5A 4BNHA 3DHYA 4RLSA 3DL2A 4PLFA 4N7RA 1E3WB 1DEHA 2EJVA 3HJAA 3ZZNA 1CWUA 1PJCA 3Q9NA 1LNQA 3LZ6A 4TRJA 4U8GA 1WZEA 1Z75A 3GVHA 2UUPA 1W6UA 4LISA 3AWDA 2CF6A 2FSVA 3CSDA 3LT1A 1MC5A 2OHXA 2VOEA 4ZQGA 3STHA 4AJ1A 2WJPA 1O5IA 3AM4A 4UULA 3AY3A 3AJRA 5IDYA 4PVCA 3Q0EA 1XU7A 4J7CA 4BO3A 1G0OA 1QORA 1JQBA 1ONOA 1WVGA 3CIFA 4G81A 3HB4X 4RVFA 1IHXA 4R9SA 2NU7A 2BHLA 3DAPA 3QWAA 1LU9A 4YRBA 4ALLA 2VQ3A 2EW2A 4BNJA 4BNLA 2Y0DA 2BI8A 3ULKA 4NG5A 3N74A 1E0DA 2C5AA 3ZWMA 3NJ4A 2PZJA 4R3WA 1SZJG 3M6IA 3ZU5A 3ZHXA 1B0AA 4O0LA 2Y68A 4BKUA 4RV9A 2O3TA 2NACA 3D3WA 3GPDG 1ZW1A 4WLFA 3E03A 2DQ4A 3QVWA 5DZSA 3EK2A 1UDCA 1SPXA 4JBIA 4HXYA 3DZHA 4DREA 3UXYA 2EGGA 4W7HA 1JAYA 2DFDA 4H15A 5JAMA 3WXBA 3NYWA 2B69A 3TDKA 1BWSA 4J91A 1G1AA 1NWHA 5DOZA 1AHHA 3GF4A 1K6IA 4Z3DA 3RQSA 1GQYA 3I52A 2H6EA 2E49A 3KB6A 4MKXA 4OQZA 2DM6A 2HSDA 5GZ1A 4FFPA 3A9WA 2J5RA 5CG1A 4RVSA 1M2WA 2Y67A 4IM7A 3V8BA 3FHLA 1ADFA 3GGGA 1ONNA 2Y66A 2GLXA 3AI2A 4Q39A 1E77A 2Q1SA 3ORFA 4EITA 3L6EA 5IN5A 1NYTA 4XYMA 2YJZA 3C7AA 3QVTA 4Q3EA 5B37A 3GEDA 3H9GA 3I9KA 4CR6A 2ZYGA 1Y81A 1PL8A 3HE3A 2Z1NA 4KP7A 3LT2A 3DDNA 4IGEA 4DPKA 2B5WA 1HLDA 2OORA 3SBOA 3U4CA 4ZA2A 3VPXA 3G3EA 3Q11A 2W4QA 5JCJD 4XIJA 2W8ZA 2R2GA 3UW3A 2OZPA 2DBQA 2BGKA 4JN6B 3CKYA 2OFPA 4WCFA 2YHIB 4PLTA 1X13A 4MINA 1HEUA 1XGKA 4D46A 3B20A 1HSOA 3DZBA 4CMEC 4EJMA 3DEYX 2EG9A 3WMXA 3GOHA 3VKUA 2YQ4A 2NTJA 1VLLA 1B8UA 4RVHA 3DR3A 4DVJA 2Q49A 3A1NA 1KEUA 3F46A 1GQQA 2P68A 3AOEC 1U3TA 5U4QA 2DAPA 1M6HA 1KVUA 4WCDA 4PLWA 3RUEA 4R5MA 2FPIA 4CMIA 5H81A 4BB6A 3PP8A 4BO9A 3CXRA 4QT0A 1VRWA 1E6EA 3DQPA 4CMHA 2PA3A 1R0SA 4YAEA 3FBTA 1YONA 1UUFA 3FF4A 2JL1A 3TL2A 2Y0CA 4BMNA 4TQGA 3N58A 2O3UA 1ISGA 3W8DA 1IPEA 3L9WA 2GPTA 5KVCA 4XYLA 5U9CA 2UV8A 4LMRA 1LSUA 2YQ5A 3ZHZA 1IUKA 4I5FA 1N9GB 1YO6A 1GUZA 4GSLA 1LEHA 4B7XA 1BG6A 3R3JA 4R1SA 4J2HA 3NT5A 4TWRA 2XF8A 5L7WA 3WG9A 3OQ6A 5JYEA 1V9LA 1GYQA 4EYEA 4G5HA 1JTVA 3W4KA 2Y1OA 2CDCA 5J23A 3BZUA 3FCOA 2Y1GA 3ZWWA 4MVJI 5ITWA 1I2ZA 2GZ3A 3S2EA 4RPJA 4Z6KA 4QECA 1NVMB 1X15A 2C2YA 3AUTA 1ADBA 2VZ9A 4XB1A 4XDZA 5ENDA 5L3ZA 4B3JA 4YAIA 5CDSA 2WD7B 3EAGA 3DOOA 4C7JA 4BNWA 1OAAA 4AL4A 5C7IO 1YOVB 5KVVA 1Z45A 1TVEA 4P8RA 1R4NB 4E5NA 4YEDA 1NAIA 2NU6A 2PNFA 4PG8A 4YT4A 2OL4A 3JYLA 3CTMA 1LC3A 1OZAA 2SCUA 4BKQA 4D79A 4E5YA 4IS3A 4YJDA 1CETA 3ZWPA 1DIBA 1M75A 4Q9NA 4YJGA 4AJ4A 2UUOA 1I30A 1FF9A 3DTTA 2EERA 4UVHA 3HNPA 2PZMA 2O50A 2X0JA 5A1TA 1AUPA 2ILTA 3UCXA 1W4ZA 1E3IA 5IAAA 3JYQA 2HDHA 1D1SA 4UEKA 2NU8A 1K3TA 1OMOA 1WP4A 3U4HA 3VVBA 1F17A 3GFBA 3Q9UA 1T2FA 4A5OA 1C1XB 2GN8A 4ZQEA 4LCJA 3KBOA 3UCEA 5JCXA 1PJSA 2FR1A 4KQXA 1T2EA 1WW8A 3PVZA 3PTZA 2GD1O 1DXYA 3HFGA 1X7DA 1PJLA 2C29D 1DSSG 2HK8A 3B70A 1YB4A 4MP8A 1NBOA 2HO5A 3DAGA 3KOUA 1MFZA 3U49A 2ZQZA 5I9LA 1ZK0A 2CFCA 2IZZA 3P2OA 4QUKA 1V35A 3LU1A 1MGOA 1I32A 2DUWA 1RM3A 3PRJA 4PLVA 4XCVA 4E6PA 2Y0EA 3BMQA 3I6IA 3PJEA 1I24A 3HDYA 4BV9A 9LDBA 1Z7EA 1JWAB 3SLGA 2C59A 5JDIC 2ZQYA 2X0RA 3V1TC 1BDMA 3QWFA 1QKIA 4IQ0A 4MVJD 1JVBA 3VDQA 4YACA 5DBIA 1NX6A 4WLVA 4EGFA 4IXTA 3HDJA 2Z95A 1S6YA 2VWPA 2FPGA 2AQIA 3VAZA 4I5EA 5IDQA 2C0CA 3D3WB 3VH2A 3NDJA 2CVQA 4OOFA 1QR6A 4Y6RA 1ID1A 1QYXA 4Q3DA 4RVDA 5COAA 4CMBA 2PH5A 2DC1A 4I08A 5K0ZA 1WNTA 4ALKA 1A5ZA 3DBRB 4WE3A 1CEQA 4DMLA 1YB1A 3HQ4O 1PR3A 4QFDA 3LF1A 3T4XA 1GCOA 3ZWOA 1V3TA 1EQUA 2WEKA 4ZHSA 4JX8A 2X23A 2GASA 3RC2A 4A10A 1XU9A 1Y9AA 4MVJH 2ZB8A 2R00C 4KMSA 1X1EA 4U7WA 5B12A 3BHIA 1ISFA 3I5MA 3RBZA 1NVTA 3EHEA 1QXSA 3S55A 3MJCA 3OF2A 9LDTA 1MX3A 3V1YA 4MVJP 2E82A 3CINA 3CEAA 2VHYA 4OKNA 2D1YA 3VPHA 3RFVA 4L75A 3F3SA 4CQMD 1BXGB 1YL6A 3R6DA 3EDMA 2GZ2A 3GG2A 4U0KA 5CDTA 2P5YA 4RPLA 5TGDA 4FBGA 3E9NA 4XYGA 2GZ1A 4FCCA 5DCWA 4L0QA 3FTNA 1O9BA 3ANNA 1LJ8A 4FS3A 3V2UA 2Q3EA 1NNUA 3BTVA 3CMMA 4J1SA 1KVRA 1IHYA 3TN7A 4QO8A 1I01A 4ND2A 3ZWAA 1BHSA 3CZMA 3NX4A 4U0JA 4MVJF 3QWIA 4J49A 3WBFA 4D0SA 3VTZA 1P45A 1PWZA 1DIAA 4OMUA 4CUJA 2E4AA 4WCFB 4BO6A 5JS6A 4FFOA 4CLOA 3DHNA 3OJLA 3A06A 3ZU4A 3UUWA 2I65A 1IYZA 1Q0LA 3GFGA 5F5NA 1E92A 1GTMA 2VCYA 3FNEA 2NTVA 5AYVA 1CDOA 2IRWA 2J3HA 5T67A 1V6AA 5THQA 2BI7A 4K1LA 1ZMOA 2RAFA 2YFHA 4FFNA 1LC0A 5C3MA 3GA0A 3RROA 1ULUA 1HDZA 5F1OA 2YY7A 1UXKA 4FR5A 3OJOA 3E5MA 1O95A 1IE3A 2WTBA 1IULA 4CMIB 2NQ8A 3ETGA 4MP6A 3UF0A 4O1MA 2QRLA 3MZ0A 1Q7GA 2G1UA 3E1KA 3FNGA 3W1VA 1B3BA 5I9NA 5IZ4A 2GDZA 1VE9A 4BKOA 3B1KA 4I5GA 5G4KA 3L6DA 4NI5A 4I9HA 1JAXA 1E1MA 4WEOA 4CM7A 3ZWBA 2VOJA 3FRJA 3JQCA 4N5NA 3CZRA 4WGGA 2P2SA 2C20A 1GD1O 3PZRA 2OGUA 1NVGA 3UVEA 5BSEA 3QQPA 1UH5A 5A9RA 1DC5A 1C0IA 1BMDA 3O26A 4OL9A 1JVSA 2Q45A 1B8PA 1DRWA 2ZB3A 4RQTA 4XGNA 2FHSA 4ALMA 4BV8A 2QX7A 5ILOA 2JD2A 1D3AA 2YDXA 2D4AA 3OEWA 4GBJA 4BQRA 3K92A 4XA8A 5F5LA 3ZU3A 4FB5A 3DONA 1I0ZA 2AHRA 4EUEA 3ZHYA 1ZH8A 1QP8A 3K2BA 4YT5A 5KJFA 1H94A 2WM3A 2QG4A 4K9DA 3BTOA 4RF5A 3G1UA 3IS3A 3LLSA 3PFWO 1VPDA 1N1GA 4B8WA 3DZKA 3RD5A 1FJHA 4JJIA 3V1UA 1EUDA 2W90A 4RL6A 1YH3A 4TRRA 3MTGA 4J7XA 4RZIA 4L8VA 1GPDG 2G76A 2Z1MA 1NFQA 1PJ3A 2NSDA 5L4LA 2AE1A 3ZNNA 4BOYA 1PJ2A 5AVOA 4MO2A 1VSVA 1E7SA 1ADCA 5JDCA 4IDGA 5G0UA 4J9VA 3OICA 4B4UA 2PV7A 4B4VA 4IDEA 3B1JA 5L95A 3M2TA 1PQUA 3TJRA 2PH3A 4BMSA 2WYUA 1NXQA 2FMUA 4INAA 4JXKA 4YJGB 5HTOA 3NTRA 4A0SA 1KETA 2BD0A 3E9MA 3D4OA 4HADA 4ALIA 4D3DA 5BR7A 2CDAA 5ER9A 2J3JA 4J4HA 2D8AA 1EDOA 4DGSA 4B4OA 4C4OA 1P1RA 2X0IA 1HE2A 2D0IA 1GL3A 3NUGA 4F6CA 2VUSA 2FZWA 2VYND 2HJSA 5CEFA 3QA9A 4Y8VA 1DDOA 5C7OO 3SC6A 1Y1PA 1LUAA 4E3ZA 2WYVA 3OQBA 3MOIA 1ULSA 4F45A 3MWDB 5U1PA 2X1HA 3G0OA 2WDZA 1Y5RA 3QIVA 4UREA 1JU9A 4YT2A 3U62A 1GUFA 4IY1A 2CUKA 2EKQA 3PGXA 4I1IA 3QWHA 1K6XA 2IXAA 4DTIA 4AJLA 4NHEA 1E3EA 1I3NA 3DOCA 4FN4A 4CLDA 1ZCJA 3GAZA 1KY4A 5TC4A 3VH4A 5T8KC 3QJ5A 1DIRA 1N7GA 3QSGA 4OXNA 4YT8A 1A71A 1BGVA 1PGJA 2HK9A 2PKRA 3IUSA 3PFFA 4L4SA 4UUNA 3WQSB 4E12A 2HRBA 3D4NA 1ZUD1 2ZK7A 4QQRA 5B4TA 1P74A 4J43A 1R66A 4NK4A 3NAQA 3S2FA 1B2LA 3GRPA 4TKLA 3ITDA 2E48A 4Z9FA 4OH1A 4YAKA 2EV9A 3IUPA 4N5MA 3GY0A 4AJJA 4IXWA 4EI2A 3LVFO 5TJHA 5ADHA 2AEJA 1ENZA 4L74A 2GR9A 5TT1A 5JMWA 3DBHA 1NR1A 1KYQA 3K5PA 4L4RA 4GI2A 1P1KA 3ZGYA 1F14A 4CL8A 1HDXA 2Y05A 4J4BA 4CUZA 3AY6A 2G0TA 2PLAA 4HWKA 3OETA 4IJWA 3RIHA 4JP2A 3DHEA 4LRSB 4CL3A 1NWCA 3P2YA 4MP3A 2ZYDA 4IJKA 4IUYA 2WD8A 1VI2A 2O3JA 5EJ2A 5AQ1A 2HMWA 5JLAA 4TZKA 3WFJA 4NH4A 4WJZA 5JO9A 4W9NC 4D41A 5A5EA 1YBAA 4PLCA 1J0XO 1GZ6A 4L76A 3INTA 2POQX 4EW6A 1ZO8A 4WLEA 1YVEI 3C1AA 3ZU2A 3H5AA 1LDMA 3GRKA 3E6AA 1NFFA 5CAEA 3PJDA 2X22A 4XGKA 4E30A 1N8KA 4TMFA 4CMCA 1A7AA 5CPBA 3JQ9A 4CMGA 1LDGA 2ZATA 1JWBB 3GEMA 1VC2A 4Y9DA 5KKCA 3E5RA 4I9NA 1BXZA 2EIHA 3TOXA 3QWBA 3G1TA 3ADOA 1WPQA 3CPSA 1CRWG 3BMNB 3UGKA 2VUUA 2WWRA 1KIFA 4Q3CA 4GWKA 3HG7A 3OJ0A 3GAFA 3U0BA 1PZFA 3JQAA 5F3RA 2I76A 3AI1A 3WYCA 4CM4A 1E1LA 1B8VA 3E48A 4ZJUA 2DPGA 4OM8A 3A28A 4R9RA 4GVLA 1JN0A 1BW9A 1HDYA 2IZ1A 4H7PA 1HDRA 4B79A 1EUCA 4OKIA 4XJTA 3C1TA 3K2EA 4R3NA 3SC4A 3ICPA 1TLTA 3DWFA 4Z0PA 3OBBA 2EKLA 3UCFA 1PZHA 4RPHA 1FDVA 1LDYA 4J6FA 2PGLA 2X8LA 3QV1A 1IPFA 5ITVA 4CLOB 5KKAA 4DQUA 3ICCA 3K30A 1EEHA 4GAEA 4ZVVA 4F46A 2X6TA 1LXCA 2OBYA 4X54A 3HN2A 4CMJA 2CNBA 4RJTA 4CM5A 2HLPA 2X5KO 5KNLA 2VZ0A 1G6KA 1ML3A 2X4GA 1GU7A 1U8FO 1UZNA 1ZXLA 1MXHA 3L0DA 1KOLA 1TA4A 3WJAA 5COQA 1GEGA 2O4UX 1ENOA 3RC9A 2ZTMA 1DHTA 4JBGA 3RKUA 1A27A 1HYGA 4BB5A 4HFRA 3AFMA 3KVOA 1QLHA 5DP1A 2P91A 3D4PA 3ZV6A 1ISIA 1UJMA 3FD8A 3UFXA 3VZQA 3F4LA 5CDGA 1NTOA 5G4KB 4IJUA 3IC5A 3WLEA 4K6FA 4IZIA 4PG6A 3KYCA 4R16A 2BMAA 2FWMX 4GX1A 1Z74A 4DL9A 2GF2A 4PRKA 4NFYA 3DZJA 1GFSA 4S3MA 3JD0A 1QV6A 3H3JA 2EEZA 3LC2O 5JSFA 2OO5A 2RBEA 5L9AA 1YS4A 1EDZA 3BTUA 3HDQA 4R69A 2O7SA 4WNIA 3ZWYA 1U1IA 3IKTA 1T4DA 4GMGA 1R37A 2HUNA 3SEFA 1TB4A 4G65A 2V7PA 4FFMA 4IINA 4CV3A 3RC1A 5JBIA 4UVEA 1SB8A 2Q2WA 1ENPA 3JD2A 3OECA 3HADA 4EUHA 4NU5A 4BNUA 4GVXA 2CZCA 4ND3A 4CLHA 5DF1A 4JROA 1ZSNA 3TF5A 4GL4A 2PGJA 4IBOA 1R4MA 2A35A 4J0EA 5I7FA 1HTBA 1EFLA 1MG5A 2IEBA 4HFMA 5EPOA 3H65A 4Y6SA 4LVUA 4GPD1 4XR4A 1HXHA 4ILKA 4PLYA 3WGHA 3KYDB 4MKRA 3WGOA 3OIFA 1E1NA 2RCYA 2W98A 4WLOA 4NPCA 1PEDA 1PS8A 2Q1WA 4NDNE 5AXDA 1BSVA 1IY8A 1T1SA 1TEHA 2Y93A 3P7MA 3QVSA 4FPXA 4HFNA 1F0YA 4XJSA 1RYDA 1FK8A 2IE0A 5A3VA 4DQXA 1Y7TA 1XLTA 2B37A 3GC6A 3ROMA 2QRJA 4TVOA 1GCUA 1HYEA 2OMEA 2EP7A 4ND5A 1MUUA 3WSVA 4F3YA 1ISHA 1MP0A 1R15A 4AJOA 4HV4A 4D3SA 2EW8A 2HQ1A 4TVBA 3ROKA 4BGIA 2UAGA 3PLRA 5JMPA 2QYTA 3QP9A 3DBLA 5T57A 3DFUA 1CQJA 4CV0A 2IDZA 4IMRA 2IZ0A 2G82A 4NJOA 2AQKA 1TT5A 2FY8A 3JQ7B 4TZTA 2FPPA 7ADHA 1PGQA 4DLAA 4D3FA 1NQTA 5CG2A 3GGPA 1EUZA 3F5SA 3RVDA 4CJXA 3WX0A 3HZZA 3I4FA 1GDHA 2VNAA 4TRNA 4UAGA 4ZD6A 2HMSA 1DFIA 1SMKA 4BNIA 1FDWA 3IJRA 1MFPA 1UZMA 4FC7A 2C2XA 1JLLA 3I9LA 1I36A 5AXBA 3WGQA 3E9QA 2FZEA 3RSHA 4ZICA 4WLNA 2Q1UA 3GT0A 2VHWA 3NTOA 2GRAA 4IQGA 3KTDA 1XIVA 3DBHB 1N1EA 3E82A 4DXHA 2Q2VA 1WMBA 2AG5A 1GUYA 3KYBA 3F9IA 4GLLA 3EUWA 3WNVA 4AICA 3RC7A 3AOGA 4B8ZA 4R41A 3EY4A 1XQ6A 3GVPA 2VZ8A 4PGFA 4CV1A 3WGYA 1UDBA 3ZNPA 2VRCD 1H93A 2NVUA 4J4TA 3VKVA 5GZ3A 1O89A 4U5QA 4D7AA 1OI7A 1A9YA 1NASA 2JHFA 1I8TA 2BLLA 4YA6A 3AW9A 3O03A 3KRTA 2Q50A 3H2ZA 5DBGA 4G2NA 1SEPA 3M1AA 4GLOA 3JQDA 4Z9YA 1P1HA 1SNYA 2OOSA 4CLXA 3MTJA 1J4AA 5JCJA 8ADHA 1SAYA 3VH1A 6LDHA 1EVIA 4QEDA 1HETA 1DOHA 1NR7A 1I10A 1VJ0A 1AHIA 2GN6A 4CV2A 5HM8A 2DFVA 2VHZA 4M54A 4XD2A 5AOVA 2GYYA 4YJHB 5AXCA 5TNXA 2X9GA 4IJVA 3Q3CA 4CQLA 4DIBA 2PD3A 4M1QA 2G17A 3C7CB 2I66A 1X0XA 1SOWA 3GMSA 5L40A 1KVTA 1YB5A 2EWMA 4A26A 1P1FA 3ZWNA 2GERA 4CM9D 1D1TA 3NGLA 3K96A 4PVDA 2EF1A 4MPDA 2X7HA 1BDBA 3LQFA 5A9SB 3ETEA 3JQAB 5TX7A 2JKVA 1FMCA 2P4QA 5JAQA 5KJEA 5HRUA 1T1RA 1P0CA 1HE5A 1XYGA 1MA0A 4YR9A 2O3QA 1P1JA 2ZB7A 1U3UA 4CMEA 5DCUA 4HFJA 1Y9EA 1JKFA 4QXMA 4NMHA 4M8SA 1SEVA 2QZ9A 5ILGA 1E3JA 5JE8A 1QRRA 3WLFA 1HLPA 1GZ3A 2X0NA 2PY6A 3JYOA 3L6OO 2YV2A 5F21A 4XR9A 3ROPA 4BO2A 2AE2A 1N92A 3AOEA 3Q2IA 4Z0HO 3OHSX 3C7DB 4KTVE 1DFGA 1GPJA 4OGWA 4BNFA 1XSEA 4DRYA 1CERA 3WWZA 1JKIA 3JQEA 2WE7A 2JAPA 5HA5A 3QW2A 2FN7A 3W4JA 4BKPA 3PYMA 2CF5A 3V5NA 3ZDFA 3NJ8A 3VC7A 2R6JA 5EINA 5FI3A 5F1PA 1KBZA 3LC7O 1NQOA 1PL7A 4AG3A 2CY0A 4DC0A 1XHLA 2H9IA 4UEOA 5DT9A 3KHUA 3RUHA 1T4BA 3A14A 1H6CA 2JFGA 1HWYA 1V3VA 2D5CA 1PGPA 3PQFA 4H16A 2ZB4A 4J9UE 2CSUA 3PI7A 4Q3BA 1VKOA 5BQFA 2VHVA 4K28A 3ZNQA 2C82A 5COBA 5HS4A 3JYNA 4W6ZA 2HU2A 2WSBA 4R1UA 8LDHA 1LLCA 2VYVA 3D0OA 1F8GA 3JSAA 4YAGA 1DJNA 5IJZA 2FRDA 1TT7A 2JD0A 3KYCB 4ZQFA 3OA0A 1O94A 3DAFA 2FR8A 1YXMA 1ZMTA 1AGNA 2W2LD 1U4OA 4W7IA 5I8ZA 4FJ0A 4HNGA 1H0KA 2I67A 3SVTA 5IZCC 2IXBA 1LSJA 2PFGA 5BNFA 3Q1LA 5K6AC 3O38A 3VHRA 4BNKA 4YDRA 1H9BA 3SJUA 4J90A 1SBYA 3H8VA 4HUJA 4FJ2A 5IN4A 5TS3A 5G0TA 1GQ2A 3RUAA 3ABIA 2J5QA 3FPLA 1DC6A 4YWJA 4I9UA 5IF3A 2DKNA 2JCYA 3K9QO 3BMCA 1NPYA 1C14A 3R1IA 1I5RA 3KO8A 4ZU3A 1NFRA 5L53A 5EESA 3INRA 3RUDA 4J1QA 2YDYA 2NADA 5THKA 3JQGA 2RHRA 3HHPA 1R4MB 2BF7A 2AA3A 1ZKMA 3ZNOA 4DUPA 3O8QA 2UVDA 4D43A 1EK6A 4GQAA 5I8WA 1DRVA 4YTEA 2D2IA 4OQYA 3GVXA 1SB9A 1P31A 1KS9A 1CIVA 1HDCA 1IL0A 1LX6A 4DWVA 1E7MA 4CLRA 2I3GA 3ENKA 3EZYA 5H83A 4MVJA 2VHXA 3ASVA 1UXIA 3ASUA 2J3KA 3FR8A 3PWSA 3AUSA 1XR3A 1C0PA 1H6DA 1MV8A 3NGXA 5IFLA 2CVZA 4XEHA 4LMPA 2RIRA 1IZ0A 4WK6A 3KXDA 3PDUA 3SLKA 5KVSA 3FPCA 3DBLB 4L73A 3ST7A 3WWYA 3WYEA 5TSDA 1W0CA 3DC2A 1AXGA 5JDIA 5CDUA 3PJFA 3EC7A 4KDEA 4UVGA 1HZZA 4BUCA 3TOZA 1NHWA 4NFHA 4LRTB 4A27A 4B4WA 4RVGA 4MJLA 3GNTA 4IDFA 4TSKA 4JK3A 1JDJA 4ALJA 1RJWA 4KOAA 4PCVA 5JO0A 3IIEA 3VZSA 3WTBA 4KUGA 4XYEA 4FOOA 3LT4A 1E5QA 4GMFA 3PEFA 3WQQA 1KC1A 1K2WA 1L7DA 3KEOA 1GR0A 1U2DA 2XPCA 3DMTC 1B16A 2W2KA 1RWBA 4D45A 1NM5A 1YE3A 5HS6A 1RM5A 1Q7CA 1V8BA 4CUKA 3EMKA 4NBTA 4BO7A 3U4IA 4BL5A 5BSHA 5ENVA 4CQMA 1KERA 4TRMA 5LC1A 1HKUA 4E5KA 2R00A 4L9RA 1X7HA 4LCEA 3QLJA 3WOHA 1Y8RA 4XKJA 1PR9A 2VUTA 3C3XA 2O2SA 2NVUB 4BHTA 1ZK2A 2I9PA 1PGOA 1XKQA 3QRWA 5JXWA 2OUIA 3OJFA 3KEQA 5CFZA 5G0SA 3KM0A 2O7QA 1UP7A 1LQUA 4CM8A 1NQAO 1IB6A 3TZQA 4NJMA 1KVSA 3LDHA 1WAMA 3H3FA 2ZTLA 1B3RA 3MOGA 1PS9A 3U5TA 4OXYA 2H1SA 1HDGO 3M1LA 2I99A 4E2XA 4GGPA 4LGVA 3VPFA 1U7TA 3W6ZA 3FI9A 3WIEA 3C8MA 3RKRA 4S1VA 4CQLB 4DLLA 1ZJYA 3C24A 2EKPA 1CF2O 1RYEA 3KSZO 3KV3O 4W82A 5JAIA 5ICMA 3WGGA 3L4BC 5C5IA 3TZCA 1JW9B 5A5FA 1C0KA 4ND4A 3UKOA 3AY7A 2YV1A 3CUKA 3GZNA 3IQDB 5I7SA 1HDOA 3GDFA 2AEMA 4R4JA 3RJ5A 3FTPA 3OH8A 3H7AA 1PZEA 2RHCA 1ZK1A 2BGMA 3PWKA 4E2WA 2CVOA 1E7QA 1T2DA 4GH5A 1PIWA 3ZV5A 2Y1FA 4BNMA 2EP5A 5L4NA 2PD6A 2VT3A 2J5KA 3AUUA 3ONFA 4OHUA 4M89A 3T7EA 1XDWA 3GH3A 1AE1A 2HKIA 1EBUA 4AJ2A 3VVCA 1D8AA 4JCOA 2QHXA 5CHEA 5A3JA 3DMYA 2AW5A 3OEYA 4FSHA 4LVCA 4NQZA 4EEZA 3WR5A 2Q46A 5H82A 1QLJA 1EK5A 1OC2A 5TF4A 1UR5A 3JQ6A 4N18A 3DTYA 1HF3A 3M2PA 3LSYA 3JD4A 1DRUA 4ITUA 1VJTA 3JQ8A 4O6VA 5TQVA 3RU7A 4BNYA 1HE3A 1YRLA 1ZK4A 3FWNA 5I7EA 1YQDA 4R51A 1E3SA 5JY1A 2DVMA 4R01A 4KWIA 3RUCA 3BMQB 3WTCA 4Q3AA 4NK5A 4PN3A 3C85A 1UAYA 3V2GA 3GHHA 1N2SA 3FSRA 1L7EA 4QO7A 1U4SA 5FYDA 5JY6A 4MKZA 1G0NA 1YL5A 4KTTE 1DAOA 4RDIA 4WLUA 3Q2KA 2BFAA 2F00A 2JFHA 2QRKA 3E18A 4P38A 3JQBC 3D5QA 3R3SA 2PK3A 2AMFA 2YW9A 2NNLD 5EERA 4N5LA 4YBZA 1E6UA 2DT5A 4I5DA 4P4LA 3VPSA 4J1NA 1NAHA 1YGYA 4XQCA 2FOIA 3RBVA 2AG8A 1EVZA 4HX5A 4J16A 5JFOA 4DYVA 1NPDA 5A02A 4J7UA 3WICA 4PFJA 4FC6A 4EDFA 3N7UA 4BO1A 5G2OA 3OMLA 4RPGA 1WDKA 2UDPA 4XQEA 5JC8A 4IIUA 3DZGA 2NTNA 1DO8A 1H6BA 2LDXA 5L4SA 4MVJG 2VYNA 4R5HA 1J6UA 4P4GA 4RF3A 2GN4A 1PSDA 3GR6A 3UHAA 1D4FA 4XWYA 1LSSA 3F1LA 3UN1A 2CMDA 2DTDA 4MIYA 5G4LA 4BGEA 3BMCB 3I3OA 2VWHA 2WD7A 4RVUA 4KUEA 3UICA 3WMWA 5BNTA 1YOVA 3GDOA 3JCZA 4O63O 4YJFA 4LSWA 3RI3A 4WOJA 2CD9A 4QSMA 3TQHA 2BFPA 3WGTA 3JQGB 3OQ1A 1OFGA 1UAGA 4XDYA 3X2FA 1U3WA 1EBFA 4CM3A 4U6QA 3NEPX 5TLSA 4UVDA 3L4SO 3GEGA 3ENNA 3O8QB 4BNTA 3NT4A 3LYLA 4OIMA 4QX6A 1BVUA 2X86A 1UXHA 2BFMA 4O59O 1YJ8A 1GYPA 3GGOA 3SXPA 2A4KA 1B26A 4CLRB 1ADGA 1EE9A 5T8KA 4OJNA 3BAZA 4EEXA 4BO0A 1P33A 3IMFA 1K6JA 1Y8QA 4D44A 4O5OA 3PYLA 2XXBA 5DNAA 1WWKA 3DB2A 3WGZA 1ZXBA 5EMHA 5GMOA 1C1XA 1DHRA 3JD1A 3SJ7A 1EE2A 1YDWA 3ZW9A 2NVBA 1YKFA 2ZJ0A 4L4XA 3AI3A 1T25A 3KZVA 4E5PA 2O23A 3BMOA 1EVYA 2ZCUA 3RUIA 4RCVA 4AJPA 1MG0A 1SOVA 1EZ4A 2DPHA 1U7HA 4CMAA 2GGSA 4EZBA 4Z3KA 3I23A 3D64A 4IS2A 5EN4A 1E5LA 3TRIA 4WCFC 1VL0A 3JQFC 5G0VA 2RH8A 3JQBA 5IXYA 1GYRA 1VL6A 2V6GA 5JW6A 1ONPA 2LDBA 4Y98A 1LLDA 1YBVA 3D5TA 4XX0A 2ZYAA 5CDYA 1K89A 1B15A 2JHGA 3I9MA 4IDDA 3KETA 1F8FA 3VTFA 1RKXA 4AJNA 1FDUA 2W2KB 2B35A 4W9NA 2P9EA 2NM0A 4TKMA 2FSSA 1P1IA 3RUFA 4LW8A 2GO1A 1R0KA 2HMUA 3OFSA 2BELA 4CQMB 5JAZA 2A9FA 3O9ZA 3W6UA 1O0SA 2ZTVA 3PHJA 1M67A 1X1TA 3R0IA 1Y8RB 3ZV4A 2HMVA 4YRAA 5MGBA 2EXXA 4LSMA 1QYDA 1BTOA 3Q6IA 1DIHA 2X9VA 2TMGA 2C7VA 3MWEB 1CJCA 3WFIA 3PHHA 3PWZA 2X5JO 4CM8B 4NJMB 4P22A 3DBRA 5A06A 5K9ZA 5FF9A 3F5QA 1SC6A 4GSKA 4PZEA 2B4TO 5CEJA 5JC1A 2IODA 1IZ9A 3IOYA 3ZCXA 2A94A 4WNCA 4BVAA 3KUXA 1YL7A 3F47A 2QZZA 1EMDA 1S7CA 4ZRMA 1PQWA 3ZHBA 1U5CA 4J3FA 5KTKA 3TFQA 2P4HX 1VL8A 1E1KA 5DBFA 2XAAA 4LK3A 2YHUA 2J3IA 3KLPX 1XELA 1ISJA 1H6AA 3UH1A 4ZGWA 4DBVO 2DTEA 2O3SA 5HWSA 3EVTA 5JNLA 1BXGA 4FGWA 1QYVA 4E0BA 2Q99A 5A03A 4FFRA 3RAJA 2YUTA 3GZNB 5JPIA 3TWOA 1Y5MA 1JA9A 1QMGA 3TSCA 4D0RA 4E33A 3D7LA 4R1NA 3LC1O 4HP8A 3IDSA 4GX2A 3LT0A 4AVYA 2EHDA 1X14A 3GN2A 3IAHA 4XIYA 1PU2A 3MJ4A 4BGUA 3ZW8A 1PTJA 4XRRA 2BGLA 5GY7A 4AJHA 1LRLA 3RBXA 1EFKA 2FP4A 3T7CA 1E7YA 4A7PA 3H9JA 3ZH2A 1PGNA 1B7GO 2WE8A 4FW8A 2JD1A 5DDIP 4OSOA 2Q4BA 2CDBA 4KWHA 4QFCA 4EBFA 2J8ZA 2DUUA 3JQFA 1VKNA 1R16A 3PLNA 4PZDA 3AK4A 3MJEA 3TZKA 1U3VA 3JQ8B 1XWFA 1HZJA 3DZIA 3PHIA 2HAEA 2JJYA 4GX5A 2Y99A 1ARZA 1WXDA 3AM5A 2HCTA 5KJ1A 2NV6A 3I9NA 4YPOA 3CH6A 4OAQA 4CR8A 3MJTA 5KOIA 4OO3A 1MLDA 1NQ5A 1YQXA 3GUYA 2IYPA 5B4UA 4JGBA 5L45A 3ON5A 1UP6A 4JIGA 4PG4A 2B83A 2UYYA 1PZGA 3BIOA 3HDHA 3PZBA 1GV1A 5BT9A 3ITKA 1JKJA 3I1JA 1LSOA 1A72A 4KUHA 4DIFA 4BNGA 1PL6A 1EQ2A 3DBVO 1O6ZA 4URFA 2B4RO 3GK3A 2PZKA 3BTSA 4UVIA 1I2BA 3ROQA 5F1KA 1HSZA 1J5PA 3HSKA 2JCVA 5BNIA 1Z82A 4YB8A 3FWZA 4JP3A 1U8XX 1UXGA 2ZJ1A 1L1FA 3H5RA 1LBEA 4E2YA 1NPTO 1VJ1A 3VH3A 4DPMA 1WMAA 1RM4A 2OP1A 2D59A 4IDAA 3ZWCA 4OSPA 1M66A 3K6JA 4GWGA 3PJGA 4Y67A 4M55A 3VZRA 3JYPA 3W8FA 3INGA 4IZHA 1LDBA 4II3A 1LDEA 1HT0A 1SCUA 4RF4A 2JAHA 5L51A 3L77A 1C3VA 2HK7A 3G79A 4MIOA 2G5CA 3OSUA 4NFSA 3WDSA 1LTHR 1OC4A 3I9OA 1RPNA 2HJRA 2YYYA 3MCVA 1ZZEA 3GLQA 2DTXA 5DCYA 3KSDO 3OIDA 4OYRA 2PGDA 3S2IA 4CM4B 4YJFB 1DC4A 2JCXA 2VYVD 1I3LA 2A92A 2JFFA 4E31A 4K26A 1BW9B 3RASA 3E8XA 5T64A 1KEWA 4FGSA 4H3VA 4GX0A 1W8DA 1N5DA 3GNQA 3ETDA 2ZKLA 2DBZA 4WOKA 4YXFA 3P19A 4W99A 4ID9A 1SO8A 3GQVA 1ZNQO 1DLIA 4IPTA 3WBBA 3DFZA 4RO0A 1QSGA 3ONDA 4BMVA 1TI7A 4YQYA 5FEUA 4RPKA 1K5HA 2V6MA 3LF2A 4UUMA 1MXFA 4RGBA 4II2A 3U9LA 1Y8QB 3S2GA 1PWXA 1BRMA 5MDHA 3WQRA 4CMKA 5A4DA 3JD3A 4OXKA 3VDRA 2X58A 4UEJA 2VRCA 4BIIA
chains in the Genus database with same CATH superfamily
4MB0A 3LS2A 3GHYA 1J24A 1Z4LA 1Z6ZA 3LPNA 3Q9SA 2IHYA 1XYYA 3Q12A 1A5BB 2J32A 1ZRMA 2P5UA 3WV5A 3MBKA 2J6HA 4X7RA 1Z73A 2VXYA 5BWMA 1P5FA 3NANA 3WNQA 1OLOA 4PZ0A 1BXKA 4YCAA 1ZH6A 2ZSAA 4QXAA 4UE3S 3UV7A 1E1QA 5DHSA 1VDZA 4CEJA 3DFIA 1DKLA 2DU8A 1NL3A 4O3FA 3TTXA 3GG9A 1FFAA 5EL0A 3MTDA 1VHWA 1QG6A 4J2TA 3UUFA 1VGQA 2O7VA 4F7WA 3AGQA 4FJ1A 5DOVA 1L4UA 5B4VA 3H9EO 4GPZA 1V8ZA 3TG2A 2A2ZA 3BL6A 3PHGA 4X1YA 4EGJA 3NDIA 3A4VA 2PNJA 2OVFA 3N2IA 3NDBB 3GN1A 4DYDA 2JLXA 4K6CA 4RJ2A 1XJ0A 3DW3X 4D4IA 1FXWA 2OGSA 3AHIA 1N5LA 5KTTA 1CB0A 1KAOA 2KW5A 2W7TA 3L2OB 4Q02A 4Q1VA 1IMJA 4HEJA 3BCHA 2C3UA 2YNMA 4Q7MB 3N76A 4ALNA 2GJAA 2WF7A 1A95A 1YQTA 4O33A 3KQTA 4PN7A 3QVOA 4KQCA 1N0HA 1TC1A 3ZJ4A 1G41A 4MCJA 4BU0A 3ZJYA 2DFTA 1NJ2A 1AJEA 5EOVA 5IW8A 4XTCS 2WKWA 2FMKA 1ID8A 4BQPA 1PQYA 4Y1RB 5CDFA 2V0NA 4D92A 1KPHA 1UBJS 3U40A 4U39A 3S68A 3ANLA 1RJGA 2CWWA 1C0LA 1KK1A 2PA0A 3K1YA 5TRTA 1J8YF 4CF7A 4WECA 4FQ8A 1C1DA 2DWPA 4L27A 1P77A 2PL9A 5KVQA 4HY3A 1TJYA 1UMCA 4MIEA 2BISA 5CH8A 4MVJM 3SYTA 4BNXA 2ZSUA 5FUMA 2EWVA 1WJGA 3SSMA 4AMVA 3UWOA 4MHTA 3DO5A 5FNVB 1PFKA 3UXEA 3GWGA 3ZVRA 2PWZA 2VO1A 4QTXA 4EA8A 2FK8A 4LYFA 5JXJA 1TQHA 1C2YA 1UDAA 3GP3A 1NRXA 4R9NA 4F56A 5L6MB 3G68A 2V65A 3HC7A 2WF9A 1C30A 3IVCA 3NRCA 4FEEA 4M6WA 2ZRKA 3RSZA 3GCZA 3L0YA 2RGUA 4AQDA 2GD2A 1M5UA 3RODA 2WAXA 3CPEA 2OQVA 2FFBA 2VN8A 4JLUA 2OXIA 4BS9A 2QTMA 2FZ4A 2JVJA 2WHPA 4DM3A 5M29A 1ZHHA 2AQ8A 5M5BA 3OJEA 3NWPA 3BMNA 1Z4JA 3DNFA 1SA0A 4JQCA 3JV7A 1MB4A 5FUQA 4PXAA 4DLBA 2X8JB 1RQGA 3M4ZA 2X9NA 3CLHA 3LXMA 4KYIB 3RWBA 2H4WA 5MFPA 1ZOIA 2Z2JA 1JFTA 5C8ZA 1D7OA 2MR6A 5AM2A 1RR6A 1XMXA 1BXRA 1EK2A 3P9RA 4F2PA 3MHPA 2I1WA 5CD9A 3ABSB 5D01A 5BR1A 5ALMA 4CKEA 4ZHQF 3OM0A 4YCLA 1K98A 1W8IA 1WMDA 2AYZA 4WK4B 4R40A 1Z37A 3H83A 2G5TA 2VJYA 1NR5A 1JQDA 1YQGA 2TMKA 3MT8A 2HXGA 2IHTA 4ZQCB 5JDCC 2DFPA 1CP3A 3HY3A 4MEBA 2PH7A 4J0CA 2M6LA 3ZE1B 5A04A 1TUBA 2X8WA 3URKA 1XQ1A 1DLJA 2EIXA 1LRKA 3WIUA 2F8MA 1HUQA 4PIMA 2BEVA 2EZ4A 3PQ5A 4MI9A 4UTOA 1GPYA 4L0MA 4M8IA 3TZHA 2V6IA 4C87A 3ER8A 1R12A 4A4DA 7MDHA 1NHGA 4KXUA 4AZ0A 1I1OA 5DV9A 5GAJA 1TT5B 4IIJB 3QY9A 1ESDA 1H2HA 2ZIZA 3V8QA 2BCGY 5LMCA 2ZRQA 3CF6R 2XXJA 1GL9B 1QHNA 5ES3A 3DNMA 5DN9A 5JWHA 3RPEA 4A91A 4EKYA 3OEED 2QTAA 3U4AA 2OG2A 4R2WA 5FQOA 5EVCA 2DEUA 3V32A 4AN0A 1FXSA 3LLUA 2JLWA 4RZHA 3L4JA 1YDEA 3VSBA 1U8ZA 3DZCA 2QPLA 3T9EA 5IMBA 2DYKA 1NJSA 3NHJA 3F71A 1MHTA 1PDVA 3RFXA 1T3TA 3KVVA 1ZNWA 2AMLA 1JZSA 3T4EA 3ORHA 2YIVX 5TJ9A 2IGBA 3TEFA 4Y6PA 4F4UA 1TK2A 1R64A 3RLFA 4BDSA 2PCJA 2NNWB 3F8SA 4PHFA 1BEUB 3MFQA 4QNRA 5AJZA 4JYMA 2H5IA 1X7GA 1FVFA 3ELWA 1PFGA 2J9ZB 1PT8A 5SY9A 1WIWA 3ECAA 1II0A 1T4MA 1W19A 4EHIA 1RFGE 3K0AA 1YS1X 4IHAA 1C3JA 4TT8A 4OPMA 1GG9A 5AI4A 2Z3ZA 2JARA 4DR3B 3QU7A 2XOXA 4PLZA 1ZA1A 2YFQA 3GDGA 3AR5A 3GFTA 5L7YA 4B7UA 4NQRA 1Y7HA 4WKGA 2HREA 5AJYA 4TUYF 1HYHA 1A2KC 4KQIA 5JARA 3H75A 3LK6A 1E32A 3NETA 4MW1A 3G9UA 1J49A 2WVGA 2VAXA 3HEBA 1L1QA 1UK8A 4NBVA 1M1XB 4IQ8A 1QHXA 3MJSA 2C54A 3OQHA 2YZ7A 4KDFA 4KDRA 2GHIA 1F8UA 4O4IB 5EHZA 3QYPA 6ADHA 2BV3A 2PTGA 3BRCA 3A3OA 4GQBA 1J2TA 4F9EA 4UMDA 1YFZA 2FE1A 2YC4C 1GKIA 4G1MB 3EWIA 3DOJA 2G6TA 5EQFA 3AF4A 4ZT2A 5HBRA 5BSVA 5KHLB 3GNSA 1AZSC 1PJZA 4Y0VA 3IT3A 3K1TA 4W9MC 1Z2PX 3VOSA 1Y8CA 4P4NA 3TCNA 4KQGA 1UOOA 4FYKA 3N86A 5KYNA 2G1AA 3JX9A 1FMJA 1QIDA 3IPLA 3OM9A 2IQ5A 2X8BA 3SF0A 1ORRA 1OB5A 4Z7JA 2IA5A 3IBYA 4JUDX 2VTEA 3G2NA 3SD7A 3NWEA 1NVXQ 3PLAE 1G42A 4N7BA 1N2ZA 3UJDA 4RZ3A 4E5MA 1S89A 2AOXA 4IGKA 4YDQA 2WU8A 2GAFA 4UFOA 3TOVA 4ETNA 4Q4AA 1W5AA 2UYOA 3M82A 4OLAA 3PGKA 4MUMA 5KYVA 1LRJA 1U5AA 3RAEC 2CT8A 4BXOA 4PYNA 3RFTA 4XARA 3L18A 3L07A 3EGCA 4KQMA 4LV6A 3BDIA 1GU1A 1SG6A 2XCQA 3DOIA 2OV4A 4RAQA 1PLJA 3M70A 3CX3A 4PG5A 3WLKX 1NUPA 3GAMA 1HURA 1PJTA 1Z4PX 2OBNA 1YV9A 3GJ5A 4AS3A 2YN2A 4EENA 5FORA 2IE8A 3CLUD 4NIMA 1V39A 4U2CA 2G40A 3EXG2 4H9GA 3UKJA 1A7JA 3DCNA 2W6NA 2BMJA 4HL6A 4TWBA 4O4JA 2VSYA 4LN1A 3VX4A 4ZKDA 2FEOA 3C43A 1DUSA 3NZEA 4ND8A 2J6BA 4IWXA 4YRMA 1XTRA 1KQFA 3P96A 2V54A 3UHJA 4NYIQ 3T38A 4AS2A 4C08A 3FLBA 4BLPA 2XNDD 1TW3A 4LJKA 4YXWA 2GEKA 5CA1F 1TRHA 4S05A 4FR0A 3EBPA 3BWCA 4Y9TA 2JLUA 3QF7A 4AIIA 4LYEA 2AK3A 3E58A 4S2EA 4CKWA 4MEJA 3IPRA 2OV1A 1W75A 2ZYSA 3ZV3A 1IOZA 5CT8A 3ANMA 4GKBA 1L5ZA 5HZHA 3K15A 4HKTA 3RJ9A 4QBTA 1KU0A 3IQXA 2VTKA 3UAGA 1XEAA 4H31A 1PFUA 1QOZA 3JQ7A 4E88A 1MDFA 3JAKA 4R1QA 1EA5A 1U9JA 3ZQKA 1ECJA 3PC8A 4R71A 2VSQA 1L3CA 4WZBA 3FKQA 3TTTA 3BL8A 3KZXA 4F85A 3AETA 2WJ4A 1R4ZA 4XRGA 1Q92A 3LHSA 3QPAA 3U39A 1JTEA 4F91B 4BFCA 4H0NA 1A8QA 2QMZA 4TL8A 4RNDB 1GAEO 1TYZA 3ROEA 2IZ7A 3B1FA 3I05A 3TTWA 4DZRA 2AV6A 4QICA 4LRWA 1VHQA 2QIOA 4M1OA 1UWCA 4BLVA 4CODB 2RH4A 4BO5A 1Y8ZA 3T9AA 5LQMA 2VT2A 4EJ0A 4R8MA 4HDNA 4M98A 5FYQA 4XM2A 4FT4A 3GB9A 4HPWA 4QTZA 1VSUA 1BD4A 1GV0A 2BHTA 4HDSA 3TLZA 4N3CA 2OHJA 2FXVA 2HRZA 3KFXA 2HBQA 3PSAA 4L4ZA 4P98A 5DX8A 5J5VA 3ZU6A 4ADSG 5JFTA 3Q98A 1NBHA 3OKFA 1I5OA 4JB3A 1G6Q1 1WLYA 2G83A 1XCLA 3B6ZA 3IMEA 4O5AA 4WADA 2Y1CA 2F67A 2VNSA 2WYWA 2DHDA 1DQYA 3PQ2A 4ODIA 3AKYA 4Z0TA 4QOSA 2RHHA 2Q6OA 2QRVA 4IUDS 1ND6A 2P9TA 4XYBA 1LFDB 5KOJA 2QRHA 1TO6A 1RCTE 3KKZA 1YACA 5ELMA 4IMIB 4BNNA 3QLEA 5LCXA 1AB6A 3G0GA 2QB5A 3BQ9A 3AFNA 3B51X 1NZFA 1T0PA 3VJMA 2PUWA 3OE7A 1IZ8A 2CEKA 2PUCA 3ENZA 1E64A 1JSLA 1P9RA 5H9VA 2H17A 2IEDA 1C1YA 1XX6A 1IJEA 2ZUFA 3PS9A 3WB2A 4TLEA 2D2XA 1YQQA 2ZYTX 4Z9XA 2J9YB 2OO5C 2OQIA 3OA2A 3Q7RA 4E21A 4E4RA 4DILA 4H1HA 4PX3A 4ONEA 4BWGA 1E94E 3CMCO 1QH8A 5JCOC 1A9ZA 1P61B 3E5NA 5E2IA 5KTYA 1GQRA 4RQUA 2W37A 4CTNA 3UPTA 3U3XA 1PJBA 3KSUA 4LX8A 2X4DA 3A9SA 3NT2A 5IH7A 3K09C 1WZIA 3G82C 4HWRA 2R1UA 2C07A 3PUYA 1KQGA 3BJIC 3PGJA 4L9WA 1WSBA 4MQ4A 2OAEA 3SJAA 3UQYS 1WZCA 3JWEA 1R8SA 5A2GA 4HS9A 1DGQA 4BNVA 1KY5A 2QP9X 4ZQIA 4URVR 4HDAA 1D2NA 3DL2A 4N7RA 2WD9A 4FBMA 3RE1A 2EJVA 4G0NA 1CWUA 2X9LA 1IY2A 1LNQA 1N2XA 3MS2A 2OENG 2BGIA 1XZGA 1R5OA 3EUFA 2V7QA 3QMPA 4H4DA 1ORHA 1PT9A 1WU8A 2GZHA 3KUUA 4RSHA 4TRJA 1WZEA 3GVHA 2QX9A 1SVKA 1Z5VA 3PIRA 5TVGA 4YCSA 3CSDA 1W5SA 1Q11A 5DNYB 4DV1B 5JXGA 2MYTA 3F7OA 1PD1A 3ROGA 3WGLA 1BHJA 3GJ8A 4F8JA 5IDYA 1D07A 4BB9A 2Y1KA 2DHQA 4PVCA 5IT4A 3Q0EA 2PYZA 4I8DA 4NOMA 3VJLA 2H4JA 4J7CA 1QORA 1GKYA 1ZWKA 2Q3FA 3HKEB 4G81A 3SDZA 3HB4X 1FTGA 2WOJA 4PNPA 1B0UA 2JIRA 1LU9A 1MZPA 1J0CA 1HQKA 2QXUA 3NBKA 2BKXA 2YINC 4BNLA 2F8SA 4YFYA 3VO8A 2BI8A 3ULKA 4XTRA 5K99A 1ZR2A 2W4IA 2AOWA 3VVMA 4RKYA 1U1EA 4EAAA 1E0DA 1GNPA 3ZWMA 1ABFA 3NJ4A 5K09A 4OUDA 4QFMA 1BNCA 3U09A 4HN4B 5HJ5A 3ZYZA 4G25A 3PV0A 5HK8A 3THYA 5JHHB 1NURA 2RGBA 3LIPA 9ABPA 4P5PA 1GGNA 1MW9X 2IVFA 2C2KA 4I50B 4G0YA 3IODA 4MKIA 3A25A 2JATA 2DQ4A 4JASB 2HA5A 3QVWA 1P81A 5DZSA 3L5OA 5FL3A 4KBYA 3TQFA 2QMQA 4G0ZA 4H1VA 3VYSB 2PU5A 2VXCA 3T3OA 2HWYA 4H15A 4KAAA 4AMBA 1GFWA 2HQSA 1YRHA 3AXSA 3NYWA 4JODA 1RPAA 2NUTB 1BU8A 4PS1A 5EFOA 1N3LA 4E51A 1B1CA 1G1AA 3TMYA 1E0AA 3IVRA 4X8OA 3MAJA 5AM5A 5EUMA 4KR3A 5JQGA 3DH0A 1ACJA 1XTBA 3F6SA 1K6IA 2NTEA 2P0YA 2ONKA 1E1RD 1OHHA 4MKXA 4KQEA 5EMKA 4YMUA 4RL4A 2JGKA 2HSDA 3CU5A 5JASA 3A9WA 1MABA 3X1XA 4X60A 1ZM2A 2XB4A 5CG1A 4B3CA 2Y67A 3DTVB 4IM7A 4ACAA 2YOHA 1WA5A 4WGFA 2FWNA 4PIPA 3GGGA 4ENRA 4F8YA 2VQDA 1OILA 3T12A 5FPYA 1M54A 1E77A 2Q1SA 3ZY2A 4BVKA 4E03A 4FYPA 4DLTA 4EITA 1NDHA 5IKXA 4B09A 3QVGB 5KREA 4XYMA 4CKBB 1QF7A 4PSDA 4Y2PA 5BUZA 3C7AA 3QVTA 4UOZA 1UKYA 1A3CA 3GMTA 1F51E 3GEDA 3H9GA 5SZHB 2QLNA 3RC8A 1HT3A 2OQRA 5SYAA 4EZEA 3GARA 3HE3A 4WZ6A 1YR2A 4BZQA 3JU3A 3LT2A 1VBFA 1WXHA 1HLDA 4JJ7A 4AX8A 3SBOA 4M9ZA 3VPXA 1KMCA 2ATEA 3MWKA 3EGIA 1GPAA 4RPIA 4UE2A 2P8JA 5JI2E 4Z86A 5E0OA 3EDYA 1OFTA 2A3RA 1CUGA 1WUYA 2BJHA 3L41A 2C77A 1JTFA 2QAJA 3MWYW 3I5AA 4OI4A 3RW9A 1WCIB 1VL5A 3E84A 3EFBA 1YVDA 3U80A 2FX5A 4ZEXA 4D46A 4KR6A 4K9MA 3X0DA 2IXFA 4ZIRA 3C5EA 4CEIB 3WDLA 1IJBA 1GGKA 1DTWB 2A1UB 3H87A 2VZEA 2VPZA 2YHBA 3QEOA 4OHYA 1C7JA 1MEOA 2AB0A 4KVZA 1ULTA 1W1UA 3O4VA 4UTNA 3A1NA 3OCJA 4XSHA 1Y1KE 1S3GA 2XR1A 3WKCA 4CQJA 5MHTA 5D3MB 1I51A 2YYSA 4I4TF 4WCDA 1ICIA 2FPIA 2NO4A 1T5TA 3LBFA 4CMIA 4BB6A 2D1RA 3C8UA 3PP8A 4EL5A 2WUDA 1EX1A 3KEFA 2P2DA 3O0DA 1XPJA 4LQDA 2RMKA 4RV5A 4ZVUA 2IIPA 2G9UA 6PFKA 1XEXA 4YAEA 2X3FA 3I2IA 3PF8A 4BLOA 2QTGA 2NUBA 3KT3A 2YWCA 3L8CA 3OQIA 2QM3A 5DIZA 3IXLA 2C2WA 2JL1A 1DUVG 5AVZA 3TL2A 4B2PA 1T2UA 3R7WA 5FJJA 4TQGA 1ZGJA 4OHCA 3N58A 3D6FA 3A7EA 2O3UA 2PMKA 4YAUA 4CF5A 1IPEA 3L9WA 1AQJA 1EVEA 5U9CA 3H1GA 4E11A 1LSUA 2WJVA 2YQ5A 1OX5A 1U7WA 3BWXA 3K16A 1IUKA 1FP1D 4I5FA 4HSEA 4J0GA 1GUZA 3E22A 5H02A 5KTMA 2CV0A 3C6MA 3EZGA 3KZMA 3L6UA 3L7MA 3TVTA 1BC5A 2RCNA 1WKVA 2XT6A 3ZQ4A 5L7WA 3NU1A 1Z7YA 2ADMA 4GS5A 3R7BA 2W6PA 3WG9A 2ZI3A 1V9LA 1FFYA 4UM8B 2BSXA 5LU9A 5CVDA 3TVDA 4JWKA 3UMCA 3IMKA 4OHXA 1DCFA 3BZUA 4RGQA 5DM2A 5HCIA 1IRXA 5J23A 4XD7D 1EUYA 4MVJI 3QNMA 3W05A 4COOA 1I2ZA 1P2SA 1PR0A 2WPDA 4B0OA 3PQ4A 5IYZA 4XDZA 3AUTA 2VZ9A 5L3ZA 5CDSA 2EFEB 1RAHA 2WD7B 1RAEA 3SDBA 1A8PA 5LYYA 2AIRA 2FHPA 1YOVB 4K88A 1WETA 1NT4A 2ZT8A 1P72A 3JRNA 3PEWA 5JZ9A 3WB1A 2XUIA 4YQEA 1EFRA 2QZJA 2POCA 3A05A 5ESXA 1M8FA 3C8DA 1YIOA 1XZNA 2HC9A 4LMAA 4NBSA 1QP0A 2NU6A 3MWLA 2ZUDA 3EEBA 1FZTA 4RHTA 3ZE9A 4YPVA 1YMVA 1LC3A 2RKBA 3ACBA 2YJ5A 2OV2A 3ER6A 3KQYA 4GLJA 3K72B 4YJDA 3H1AA 4AKTA 2C7QA 2FEWB 2CE7A 2YNMD 3WLMA 3AIMA 4HVTA 2PRSA 4RIEA 1KAGA 1U2TA 2WKSA 3EIEA 3OSZA 4ZZ2A 4DV6B 3LXXA 2A33A 3D8RA 3DA8A 2XIJA 4DNOA 4Y0NA 4A8JC 2X0JA 3A11A 2JZCA 4NJEB 2ILTA 4KCGA 1XWIA 5DRTA 2WNIA 2H2GA 5IAAA 1YAJA 2FA9A 5FLXA 1E2IA 1T1IA 3GFVA 3H4IA 3D8HA 1K3TA 1OMOA 2H1LA 2NYVA 2ZG6A 3U4HA 3GFBA 3Q9UA 4D56A 4A5OA 2Q5FA 3C2QA 3R5SA 4D1YA 2RI6A 3DYBA 2GN8A 1BN7A 2GMWA 2Z2XA 3KBOA 3UCEA 1PJSA 4F1KA 3HXLA 1T2EA 4KFSA 2JG3A 1WSWA 1WW8A 2B2NA 1U2SA 1J2UA 4C0WA 3LUKA 3B8EA 3ICQB 3PTZA 2GD1O 1DXYA 3HFGA 3TQRA 2P9FA 3CEHA 4FHEA 4MYHA 1CT9A 1DSSG 2PWYA 1GSOA 4IDQA 1KY2A 1SUEA 2WQZA 3B70A 4Q37A 1YFKA 4B0PA 1PKEA 3I6BA 3IOMA 1U90A 3T5BA 2HO5A 1H0SA 1YS6A 3EG9A 4GQIA 3STVA 3GLIA 1J07A 1JDZA 2HJHA 2XB8A 2FN9A 2A9KA 221PA 3N5CA 2CFCA 5J5CA 4JI3B 2JCSA 1WEKA 5IBCA 3TW0A 1NYQA 5AHXA 4NXNB 4MLPA 5AK6A 3MBIA 1LF0A 4F12A 4A3SA 2R5WA 2FOLA 2ZBGA 4E6PA 2Y0EA 4K6HA 2I62A 4J6EA 5FOTA 4LXHA 5HUHA 1V5FA 2YJTD 3C3MA 4S24A 1Y3BE 3AUFA 3DDUA 4AY6A 2KI5A 1P7PA 4B7ZA 5K0FA 4KN6A 3JVIA 3U7EB 4UUAA 1JR2A 4YN3A 1JVBA 4D25A 2F9FA 2P62A 1ZN9A 4QBGB 4GM4A 4EGFA 5EJEA 2CHUA 4IYRA 5SZJA 1YA4A 3ZV7A 3I39X 5DWVA 1NW3A 1RHMA 3HDJA 4LTMA 2Z95A 1S6YA 1J42A 2C5HA 2AQIA 3LQQA 4LF7B 2D7CA 4Y6QA 4PTLA 4JT9A 4Y9RA 3VH2A 4BRUA 3PXGA 3MPUA 3LHIA 5DFAA 1W5BA 2GFQA 1GPBA 3AJDA 1ID1A 1QYXA 3ZC3A 1TMGE 1ZD1A 2JZNA 5AK0A 1JUDA 2PH5A 1I13A 1U2DC 3GLGB 2D1FA 3NCTA 1ZLYA 2FEMA 2HTEA 3MFYA 4ALKA 1A5ZA 3AFHA 3GMIA 1CEQA 5JH7B 1RU3A 1RI3A 1YB1A 4IV0A 3M1YA 1ZNZA 1J97A 2Y4OA 2RGRA 4QFDA 5E8RA 3AQ4A 2PBFA 4HZUA 4GE0A 3ZLUA 3ZWOA 2XGSA 3IRVA 3MCTA 4N65A 4ZHSA 5HUQA 1H2YA 2GASA 3MVEA 4JEMA 2B25A 2J3EA 1N6KA 4WXPA 4BRWA 4TTVA 3B6MA 1P9OA 2C04A 4KMSA 4XLZA 1ZICA 1KPIA 3B6KA 1ISFA 1TNDA 1T6XA 1QZXA 3V7WA 5BW5A 1M9NA 3EHEA 3OTWA 4LE1A 1NBME 4RTLA 4TZ0A 1RQPA 1N75A 2RI0A 4QATA 4WV3A 1GAXA 1QQ5A 4YI3A 1T5DX 2TECE 2AN3A 2EKZA 5ADVA 2QLBA 2EFJA 1S8AA 2PVSA 2VHYA 3BH7A 3OM8A 4GEGA 4OKNA 5TDHA 5JTUA 3QZUA 1O4WA 1I2DA 4IKPA 5AKXA 1AQNA 1G8MA 4R0VA 4TMXA 1L0BA 2FLKA 4HDMB 5DMXA 2C8VA 2IHUA 4QUIA 2NO6A 1I2MA 3U61B 2GZ1A 1TM7E 4OHVA 2D5LA 1Y6RA 3FTNA 3BX1A 5KNDA 1OBVA 4BQNA 4FKBA 2R11A 1BA2A 4ARVA 2V98A 3BTVA 3S70A 1VYUA 3DYVA 1ECGA 1M1YE 1RRVA 3AEXA 5IT0A 4JGGA 1MNQA 1P6UA 1RKVA 3NX4A 1GCAA 1G8PA 1RWPA 1EM8B 2XE7A 4UMEA 3WZLA 4D0SA 1TL7C 1CIJA 1UL1X 2JLSA 1BDJA 1P45A 2JLAA 1BO6A 1DIAA 1F9AA 1P80A 2AZ4A 1Z35A 2GPJA 2LRHA 3D3KA 3FUVA 4WCFB 4YMLA 5JS6A 3AR7A 4CLOA 3BSWA 2WY2D 1OH8A 4ER5A 2RGXA 4IG4A 2MSCB 1U31A 4NCAA 3SC3A 2VCYA 5BWNA 1H4TA 3CNNA 3LX4A 1NJ5A 3V1MA 1LPMA 5AW1A 3QJGA 1TVMA 3DE6X 1M1NB 1PR5A 1ORVA 2LIPA 2NO7A 3O4IA 4BB0A 2XQKA 1PFQA 4GICA 1FYFA 1R6BX 2RAFA 1NW4A 2HXSA 4KBGA 3TW8B 1TM4E 3WIVA 1DADA 1LC0A 1OI3A 3BMXA 3QXGA 1Y33E 4BZZA 5C3MA 2H52A 3RSCA 1ULUA 4B45A 5LUAA 2YY7A 4IIFA 3V1LA 1Y7PA 5FBVB 2YZMA 4MVCA 2AI2A 5IKEA 1IULA 2C3PA 1TEZA 4NYJR 4O3MA 2NQ8A 2VJAA 4MP6A 2X41A 3GEEA 3UF0A 5A6VA 1VIMA 4YV1A 5ENZA 5H3LA 3NATA 3DF9A 4NHOA 5I9NA 2FSUA 1B3BA 1RQXA 3LJKA 4AKGA 4LWQA 3VDNB 1YZNA 3B1KA 2VJOA 4I5GA 2SHKA 1PAUA 2XEXA 1J1ZA 1G291 2PT9A 3OPVA 3LUDA 4I9HA 2JLRA 3ELUA 4IYJA 5HM8A 1IMOA 1IWOA 1FFHA 3EPLA 1FNCA 1FDIA 2BM0A 2VOJA 2ZQ5A 3FRJA 4N5NA 4WGGA 3U4GA 3OOHA 2XVYA 2BI4A 1XEFA 2P2SA 2FW6A 1SXJE 3CPHA 4RA9A 3WQHA 5T4HA 3ZX4A 3I61A 3EFOA 3AG5A 1PUJA 1UJ4A 1ESCA 5C18A 2BL4A 1E2QA 1Z2NX 2EZ9A 4GPIB 3QQPA 3UVEA 4KGVA 3PC3A 3X44A 4CIDA 3SQMA 1C0IA 4ON9A 4AXBA 2QVZX 3MRXA 1W88A 2W2QA 3OWXA 1LBSA 1MB0A 2ZB3A 4RQTA 1X39A 1DE0A 4IOKA 3I5UA 5JQWA 5AVKA 5AI9A 2YDXA 2D4AA 3HBLA 3OEWA 2B5OA 2VJMA 4Q4HA 4R84A 1QHSA 3IOBA 4EVRA 121PA 3N8NA 4WZAE 4F96A 4KQJA 4JI0B 1JVNA 1I0ZA 2AHOA 2AHRA 4LX0A 5DB4A 1G4AE 1KDTA 2R65A 2A59A 2VYCA 4Q16A 1ZUIA 4TSRA 4GR4A 4ZVQA 4F71A 5KJFA 2DHCA 2ZTSA 4INZA 3KJNA 4K9DA 2I2AA 4RF5A 4U7FA 1X87A 3H0EA 4FZRA 4XM0A 1U0RA 5TMBA 1WM1A 2E87A 1K4MA 3W2FA 4IIHA 4AMZA 4D4JA 1K8ZB 1VPDA 4CCYA 1N1GA 4HWGA 1CZLA 1X9HA 1U7XA 4JJIA 1Z38A 2W90A 4KIJA 3V1UA 4FHFA 4IV5A 1VLJA 3MTGA 3MMPA 4J16C 4L8VA 4RZIA 4WX2B 1GPDG 3QF4B 1S5PA 4XPZA 2MSNA 2XB6A 2ZIVB 4JLBA 3KUKA 3QSYA 4MGEA 1XBTA 3FYTA 1E7SA 3VNUA 5JDCA 1DAMA 4IDGA 3UC5A 1U1DA 5G0UA 1TPZA 2UU9B 1RABA 2DFNA 3QU2A 3M2TA 1BD3A 1QK5A 1XEWX 1ZGHA 2IXGA 2PH3A 2XBUA 1EP1B 3MC1A 3RC3A 2FMUA 3TD6A 4INAA 2A7XA 1NJ8A 4H08A 4TMVA 4WTOA 4X5OA 3FETA 3ZDEA 1Y37A 3IESA 1AK1A 3D4OA 4L0CA 3V7NA 3I09A 3BGVA 1TIPA 1IBMB 1L5SA 4MKFA 5I7WA 3FTDA 4RZQA 2XHZA 1FLDA 1JFLA 3O75A 3DFKA 4LBWA 1Z0SA 3WK6A 4FGLA 1IXKA 4RD3A 1CYEA 2C8LA 2VUSA 1NIPA 4HJRA 1VBKA 2LZ0A 2VYND 3PXBA 3RAPR 4Y8VA 5C7OO 3UAOA 1YTUA 4R2MA 4L5BA 2FMTA 3BXHA 4E3ZA 2V7XA 4MUHA 3BD7A 1ULSA 3PEVA 1A4RA 2VPQA 3D02A 1Y5RA 2C00A 2YW2A 5IUNC 5E7IA 5H59A 2AXEA 3ET5A 2FSIA 2H08A 4GFDA 5EJGA 4DJDC 1WCYA 4I1IA 3A36A 4TQAA 3J7AC 1K6XA 2IYEA 3KTAA 4L57A 2HQBA 4AJLA 4NHEA 5ECWA 4A0HA 1UFOA 5KHAA 1FSZA 2IY9A 4IKOA 4DA7A 4CLDA 1WBJB 4EKGA 4OFWA 5TC4A 1JFRA 5T8KC 1VYTA 1K9SA 3QFSA 4W5WA 1N7GA 3QSGA 5JFGA 2XOEA 3IUSA 1BGVA 1ESEA 1YCFA 3DB1A 5JSZA 2P1DA 5KINB 3WQSB 2MSEB 1E1YA 1T3GA 3ONVA 4D3XA 2QT9A 5CCDA 1Q3TA 2PMFA 3HR7A 4MW0A 3NDPA 1R66A 3O3NB 3FZNA 3NAQA 4U2GA 4L8GA 3S2FA 3ZGLA 4AUMA 2WIDA 4INOA 1Y34E 4YAKA 2X42A 4RJJA 1ETUA 1KTIA 1KE1A 1KS2A 1BFKA 4INPA 2II6A 1E63A 5DGCA 3CX6A 1UDXA 3LVFO 1HOXA 5BMVA 5HE9A 2G4LA 4NVRA 4WIAA 3SKXA 1FFEA 1NR1A 1KYQA 1I3OA 3E4CA 4TMYA 5K05A 1OSNA 3DYIA 1XK6A 4GI2A 3ZGYA 5BPFA 1Z12A 1F14A 4CL8A 3FMPB 1DJLA 2H7VA 1WE2A 2PLAA 2XWQA 2HV8A 4FYMA 4ZOEA 1BWQA 2J07A 2RAUA 3D8TA 1KH2A 5AKLA 4Z2YA 4QPZA 4JP2A 3DHEA 2RGWA 2YN4A 1OZGA 3GZTB 1U7DA 3O3MB 2HOQA 1JPJA 1E61A 3QIAA 1OY1A 3UHFA 3Q3VA 1G8SA 2QNRA 5AQ1A 4TXLA 1U2RA 3WFJA 1NP6A 4HWOA 3FOCA 3LUJA 5JO9A 5K4AA 2WI8A 2H1HA 2SICE 1YBAA 4FSDA 3WNCA 1NI3A 1CD5A 3PKZA 1N77A 2NXWA 1LW7A 3T5DA 4DR6B 1NSTA 1IN8A 1IRIA 2H9AA 1ZO8A 3HI4A 3T6KA 2W6JA 3C1AA 4X3CA 3ELBA 4NSNA 4H3SA 3MD0A 3GRKA 3T35A 2ZTHA 3MF4A 3NEYA 4RIHA 4RE5A 2P1ZA 5JJCA 3MQ4A 2X22A 2YH2A 3PJDA 4OJTA 1YR6A 3UOWA 4Z53A 1G1MA 1XALA 4R8LA 2PE5A 3TIXB 2PRKA 3I6MA 1RE1A 3OUZA 4CMGA 1U4NA 2JIPA 2NO0A 5CIQA 2XSZD 5EP3A 2HA0A 3E5RA 2MIIA 3BSYA 4QXRA 3UT0A 1KSJA 3LY5A 5K5EA 1X2BA 1CRWG 1IVSA 1F8XA 1QIIA 3EIWA 4LXIA 3OPNA 3TXAA 1A2BA 1T4GA 1W0JA 4LI0A 1PVOA 3HG7A 1N4AA 5AOCA 1SZPA 3GAFA 2DR0A 2FW0A 2OM6A 4C0AC 4MR9A 5F3RA 1M2VA 2I76A 1G2IA 3E48A 3VISA 2G9ZA 1JEYB 3SYNA 1J90A 4B87A 4CYMA 2A9OA 2Q0SA 3JW8A 1CUJA 3A28A 4AURA 3G6WA 1JN0A 1E1CA 3FHTA 4ZHQB 1BW9A 2BP7A 4MUKA 3UQZA 4DQ0A 5BXQC 4QZVA 4KREA 4JI6B 2IZ1A 1ZKDA 3R5FA 2FYTA 4H7PA 4KQ6A 5AJVB 1HDRA 4OKIA 1NN5A 1KI8A 2AFHB 3K2EA 4FZJA 2IYWA 4PFSA 2PLNA 4PZAA 1DKUA 4NONA 3SC4A 4EAQA 4HNTA 5JD5A 1VL1A 4I1RA 3H2HA 3BXPA 4GR5A 4RADA 3IUJA 3H2YA 3EN0A 3B7GA 1K92A 4MYDA 2QG9A 4RPHA 4M1YA 3Q4GA 1WQ3A 2ZR8A 4J6FA 4RDIA 1M34E 3IBSA 4X1KB 3U4QB 1BJTA 1W5FA 1B23P 1XZJA 1XLTC 3G2HA 2ERXA 2INGX 2I6SA 2VJBA 2C2GA 1EFVB 2JZOA 3D6AA 1OHHD 3N0TA 2ZAIA 3GJTA 4GAEA 1QGYA 4NNOA 4FXOA 1ZHFA 2OBYA 3GRRA 1M6YA 2CNBA 4LFCB 2RKWA 3CR8A 2HTFA 2Z5GA 1W4AA 3R8CA 3ZDAA 1JEQA 2PVCA 4Q18A 1QB8A 4CM5A 5KNLA 2HZBA 1OBHA 2XZOA 3F3MA 1GN9A 1KK3A 1ZXLA 3AX6A 2BZSA 1ZD4A 3I01M 4BVLA 3UBTA 4DR5B 3WJAA 4DR7B 2P3SA 3KR0A 3MRSA 3KJEA 2YCLA 2ZTMA 4JBGA 1UQRA 3ENWA 4ZV7A 3OZBA 3AFMA 4MV8A 3U0VA 3ZV6A 4FFVA 2GRJA 1IM5A 5CW2A 2CYCA 1KI1A 4Q1AA 1VSBA 3VZQA 4MVXA 3L43A 3EVAA 5CDGA 1NTOA 3NKFA 4MX8A 5G4KB 3SVZA 3KL2A 5AI8A 3G9ZA 3KYCA 4CMEC 1HFKA 1I14A 2BMAA 2CDNA 3ASZA 5HHTA 2FWMX 4GX1A 5DM1A 1Z74A 1ITZA 5F2NA 5KTNA 2K4MA 4K5QA 3K9HA 3QTLA 4RENA 3SZMA 2LIVA 3QUCA 2B8EA 3A37A 2ZAMA 5LKAA 4ZVSA 1GAQA 2Y76A 4OP1A 1P62B 1EWYA 2PUHA 1T4CB 4DLPA 1T0IA 2AD5A 5JXHA 3TR0A 821PA 4RULA 4FGKA 1Z15A 4LI3X 1FNNA 2PANA 3HM2A 2VRNA 3RVLA 1QV6A 4KE7A 3AEUA 3BIFA 4O4HF 2DR2A 4QGSA 5A7FA 2VRWA 3LC2O 3AKEA 4REQB 2IY7A 1DEXA 1KIAA 2OO5A 2RBEA 3HRIA 4U2DA 5A4AA 3X2SA 3IKTA 2O7SA 1U2PA 4U7DA 1THMA 2C61A 3A32A 1VKJA 3F98A 4RTKA 1SU8A 4JJKA 2HUNA 5KAMA 2ODPA 1TB4A 2A5GA 3QI2A 4MDYA 1XXLA 4G65A 4X0EA 2ZVQX 1ZXXA 2GETA 2BEJA 1T0UA 3PG5A 1CUXA 2QX8A 3K09A 4JR2A 4L0DA 4AZWA 1ENPA 4HNAA 2PSHA 2AR0A 3RS3A 2CZCA 1WDWB 3H8SA 2N46A 3I64A 4XH9B 4LY9A 4M83A 4ND3A 3AP3A 1D7AA 1G9SA 1UANA 1ZSNA 3ILYA 1EXNA 2ZJ2A 1B8OA 1F8YA 3I8OA 3UYLA 4HFMA 2OZVA 3W7AA 4F38A 1QC5A 1UKZA 3WKDA 3GJ0A 3FUCA 4GPD1 2PR7A 4TL7A 4XR4A 3UPUA 1OA0A 1TAGA 4BN5A 3KYDB 4D82A 4MKRA 3MGAA 3OIFA 3C6XA 2O54A 1D09A 2X8JA 1DXOA 1F2VA 1FSFA 1M5TA 4FUQA 4N9QA 1TEHA 2PS0A 3EXEB 3L1JA 4FPXA 3ECCA 1RYDA 5BRAA 1HH4A 2P27A 3OG9A 1PZXA 1JG2A 1E5DA 1P39A 1S1MA 1Y7TA 2WJZB 3NH9A 3RU2A 1CNFA 3DG9A 4XUCA 1UPFA 3UMJA 2ECPA 4Y7DA 1GCUA 1LCIA 2ZJ4A 1N3YA 2F3UA 4RNCA 1MP0A 4KIGA 3BE4A 5FBQB 3O95A 1FLNA 2J4FA 2WJ3A 2QL7A 3P9NA 1JU3A 2JW5A 2WPDD 1EPUA 3G2QA 2R66A 2QTBA 1CUIA 4U7JA 1G59A 1UBSB 3FUWA 2W2XA 3CEMA 1Z88A 3DBLA 5T57A 3SLRA 1XCGB 2JIQA 4M22A 1CQJA 2GM5A 4CV0A 2IDZA 3FLMA 2DPYA 2WWWA 4XPIB 4NJOA 3FZYA 4HWPA 3F90A 1TT5A 3EZ9A 3KD2A 4WDRA 1E9VA 2CDRA 3E1GA 5DX0A 2GM4A 1EX9A 1PGQA 4DLAA 3DAOA 4G41A 1N3BA 4D3FA 1ABBA 4V38A 3L7LA 4F11A 3GGPA 1EUZA 3NG1A 3WX0A 3I4FA 4YGYA 1LX7A 4E08A 1YRWA 1UC5B 2UVQA 1DFIA 3W5SA 4N6NA 1A8HA 1SMKA 4KFCA 3UG6A 1FDWA 3L8EA 5FPPA 1MFPA 1UZMA 5HOQA 3OPYA 4DM7A 4JKIA 4TV9B 2X0EA 2VAPA 2W0MA 2UZ3A 3CZQA 4D9NA 5KQLA 3HCRA 3NTOA 4JLVA 3WLNA 1DMRA 4ZI7B 2GRAA 1NQUA 3KTDA 4N8DA 4R05A 3GPCA 4EY4A 4G5GA 1OFHA 4ZCMA 4EB8A 1L4HA 1N1EA 2ZSKA 1D9XA 1WMBA 2RK3A 1U65A 3DVRX 3KKNA 3R2JA 4Q9KA 2GEBA 2QVLA 2P3QA 1DEKA 4AICA 1H22A 3AOGA 1YKGA 3EY4A 1WY7A 4AJ9A 3UJ3X 3HNRA 2FZLA 5HIIA 2VRCD 3K2IA 4JT2A 4NZZA 5DTMA 3GRZA 3VO9A 3ECSA 4YJ3A 4HRYA 2DCMA 4DLXA 5KVAA 2B4YA 4IILA 4RXTA 1A9YA 4GI7A 1R3DA 5DU2A 2ZE7A 5HIMA 5BQXA 2ZVPX 4RY2A 1JBEA 4TS1A 3T5GA 1O94C 5TPZD 3H2ZA 5DBGA 1NBMD 3RF6A 2XOKA 4YJ2A 2E4WA 2RC5A 3JQDA 3U3OA 2GEVA 3IMCA 2O2DA 2Q5JA 3MTJA 4O4IA 4MQFA 1GRQA 4XB6B 3T5TA 3WZMA 6LDHA 3J7TA 3MJDA 1PNRA 1KK2A 4MWZA 1DOHA 3VGJA 8ATCA 2DFVA 2E4UA 4XD2A 5HFJA 2GYYA 5AKYA 2ROQA 2VI5A 3A4MA 1G21E 4JS0A 2AKEA 3EXG1 1QWOA 2X9GA 4FWIB 1JEJA 3DPIA 1QZUA