3U5TA

The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
230
Chain Sequence
NKVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGIMPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINMSTSQVGLLHPSYGIYAAAKAGVEAMTHVLSKELRGRDITVNAVAPGPTAVRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from Sinorhizobium meliloti
rcsb
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
molecule tags Oxidoreductase
source organism Sinorhizobium meliloti
total genus 75
structure length 230
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u5tA00
1FK8A 4XYBA 1ZBQA 1GFSA 1QR6A 4FB5A 5EPOA 1LDGA 5JYEA 1PQWA 4RVSA 2ILTA 4BO9A 3FSRA 1A9YA 4CR7A 3AFMA 1X0VA 3PIIA 3F1KA 3Q0EA 2ZK7A 3CTMA 3H3FA 1ENPA 4OL9A 3PI7A 4KUGA 4PRKA 5A9TA 3BXXA 2EF1A 3CUKA 4BNXA 2P9GA 1LDEA 2IXBA 4LGVA 5KJ6A 2NVUA 2Q49A 4DYDA 1ML3A 4PLVA 2X5OA 1Y8RA 4CMJA 1P1HA 5F1PA 1YH3A 2D5CA 2ZTUA 1LDNA 3CZMA 1VI2A 2G1UA 3OA0A 2WYUA 4XA8A 3R3SA 3W8DA 4BO2A 4F45A 4A5OA 1A9ZA 3ICCA 3IUPA 4E33A 1ZVMA 1T2FA 1GUZA 1HDCA 5ES3A 3VPXA 4XJTA 3UF0A 1JVBA 5CHEA 3WIEA 3GMSA 4D3SA 3HFSA 4C7KA 2JD0A 2E6UX 2Y1GA 4G81A 2JD1A 2C0CA 4LN1A 3VVCA 1GR0A 1ISHA 2FZWA 4CLRA 4RF3A 4GKBA 4J3FA 4E2YA 5DULA 1DHTA 5MDHA 4OGWA 4WJZA 2D3TA 2VYVA 2DFVA 5IDQA 3C24A 5B1YA 3Q6IA 3PDJA 2C2XA 1IOLA 1ARZA 1MUUA 3ZWXA 1NYTA 1J6UA 4GX1A 3KYDA 3NUGA 3LZ6A 2VHYA 3PHLA 4RVUA 5JDCC 2D4AA 4CMGA 1HDXA 1ZSNA 3ANMA 1ZW1A 1MFZA 1R15A 4GVXA 3AUTA 4BV8A 4FGSA 1U8FO 3F47A 4DIFA 2RHCA 3JQAD 1F8FA 2I99A 4J1TA 1LTHR 5CG1A 3G49A 3U4DA 4BB5A 3NKLA 3PVZA 2YYYA 1YBVA 1E7QA 2DBQA 2F00A 2YQ4A 3DBLA 4L73A 3AOGA 3CPSA 4QTZA 5DZSA 3MJSA 1QXSA 3ZV3A 2OOSA 1RM3A 3INRA 4K6CA 3HB4X 3KLMX 4DA9A 1UDAA 4N5LA 2OO5A 3FRJA 3GK3A 1MLDA 2FR1A 1PS0A 1Q7GA 4KTVE 2GASA 3NT5A 1P3DA 3ZWMA 1D1TA 1DPGA 3JTMA 5TS3A 1IE3A 1O6ZA 2X4GA 1GZ3A 1B26A 3WBBA 3Q2KA 3DMTC 1KC1A 3I9OA 2Q2WA 1IZ0A 2HCTA 2DBRA 2OL4A 3MJTA 4MP3A 3BMQB 1OBFO 2O3SA 5GY7A 3DXFA 2X0RA 4M87A 1EVJA 4YJHB 5AYVA 1R4MA 3W1VA 3CSDA 1K3TA 1Y8QB 3DMYA 4B8ZA 5IFLA 1A27A 3BHIA 3ITDA 3H9QA 4ZGWA 1JQBA 3L77A 4YT5A 3TPCA 5G0VA 4K26A 1ZKMA 2EW2A 3WLFA 1KYQA 2YW9A 3HDHA 4IDBA 3EMKA 4BO3A 1GZ6A 1N1GA 3JD2A 2WDZA 1Z73A 2BFOA 2O2SA 3O26A 5ITVA 2CY0A 2QZZA 4RF5A 3CIFA 3AM4A 5CDSA 1EUCA 1B8UA 3QVXA 5JO9A 3PK0A 2I76A 1PTJA 3BTOA 4WEQA 4DVJA 3ROKA 3MJVA 3UCEA 3WOHA 1PJ2A 2GN9A 1N8KA 1IZ9A 3DAPA 1X7DA 2TMGA 2GZ3A 3D5TA 3FR7A 3KYCB 1HRDA 1R66A 4Z0TA 4DRYA 4UVIA 3WX0A 2VHVA 4J2OA 3UVEA 5JLAA 4CLHA 5G2OA 1I3MA 1BHSA 1NXQA 2YHIB 3H5NA 1JDJA 4ZQFA 5KKAA 4ALLA 2HK7A 3LU1A 3L4BA 3R0IA 3TDKA 1NAIA 2FOIA 5ITWA 2NVWA 4R9RA 1DC3A 1E6WA 4E2WA 4M49A 3QWIA 4S3MA 1MX3A 4EJ6A 1PGQA 4XR9A 3C7DB 1IPFA 2O23A 1QYCA 1QV6A 1UJMA 3A1NA 4WGGA 1NFRA 2AQHA 1Y5MA 3GUYA 3PRJA 4FQ8A 4JP3A 2WE7A 5CEJA 2PZMA 1BG6A 3PZRA 4MINA 4R5HA 3ZU5A 3AY7A 2PA3A 4FJ1A 3TQHA 1S6YA 3HHPA 4Q9NA 4RL6A 3A28A 2V6GA 5LCXA 1R37A 2O3QA 3IAHA 3PGXA 1NQAO 2HJRA 3RWBA 3BTSA 1J49A 2FHSA 4KWIA 5F5LA 3GPIA 1EQ2A 5IDWA 2X7HA 5TLSA 4B7XA 3S55A 4FFNA 5JY1A 1A5ZA 3HFGA 3ASVA 1N7GA 3F9IA 3DR3A 4IGEA 2B4QA 4PLHA 2FR8A 1S7CA 4HWKA 4DPMA 5IN4A 2DUUA 4IDEA 4NZ9A 4ZQGA 1WNTA 3PFFA 3CZRA 4MVJM 4P4NA 5BSFA 3LC7O 2RAFA 3RASA 5THQA 4XYLA 4HFRA 4YCAA 3WS7A 3K96A 3ZV6A 4FD3A 1VJ0A 4LMPA 5BSEA 1BTOA 1YS4A 2B4RO 2QRKA 3K6JA 5A9RA 2JAHA 1UH5A 3OEWA 2AEJA 3BA1A 3V2UA 4KUEA 2X8LA 4NBRA 4D44A 3JD1A 4JBGA 3C8MA 3VH4A 3UHAA 1W0CA 4J2HA 2FSSA 4BUCA 1XQ1A 3PQFA 3FCOA 3W8FA 4CQMA 4BO6A 2GO1A 4R1UA 2XOXA 5H82A 1QORA 4YJFA 4YR9A 4LVCA 3Q11A 4B4WA 4GSLA 2GERA 1H6DA 3GG2A 3WYBA 5KNLA 2GNAA 3FNHA 1UAYA 2DVMA 2E37A 1KBZA 4EUHA 3EYWA 3CE6A 1U3UA 2WEKA 4LVUA 4Z0HO 3EW7A 1HE5A 5FF9A 1WZIA 1CERA 3ONFA 1RPNA 1I36A 1U2GA 3VZRA 3ZNNA 2X1HA 1VC2A 9LDTA 1HZZA 4HV4A 5CPBA 4FJ0A 1MXHA 4RPGA 2FY8A 5A3JA 3X2FA 1CIVA 3BHMA 3A14A 1WVGA 4NDNE 1HDGO 1UXJA 1GYQA 1LRKA 1WW8A 2H6EA 4HUJA 4CM5A 4CMEA 2F1KA 3MCVA 3RROA 1BSVA 3ZNPA 3PPIA 2NNLD 1NASA 1CYDA 5C3MA 4CM8B 2PNFA 4ALKA 3RUAA 5TNXA 1IL0A 4NR0A 1NAHA 3RKUA 3IKTA 2QYTA 1C1XB 2H9IA 3GNQA 3KV3O 4U5QA 4PZDA 3QLJA 4ESOA 3ENKA 1VL8A 3KZVA 3QWBA 3HJAA 3DBHA 2PWZA 2VNAA 4WLOA 4XRRA 4WCFB 1QLHA 5I9MA 5A9SA 2B83A 4GQAA 4HNHA 3PYLA 2W2LA 3V1UA 1AE1A 2R2GA 3ADOA 3GQVA 4FFPA 2HUNA 4NIMA 2CNBA 4UVDA 3NTRA 1XLTA 1KY4A 4JBHA 1LU9A 4J7CA 1XELA 1K0UA 5EINA 3KSDO 4MVJP 1IHXA 1SC6A 1JAXA 1OC2A 4ILKA 1SPXA 4FFOA 2JAPA 3OJLA 3QVSA 3GVIA 3VDRA 3W8EA 3C1OA 2DTEA 4ND1A 4NJMB 6LDHA 4CODB 5T5QA 2I65A 1E1LA 3NGXA 3OJOA 3UICA 4IQ8A 4QSMA 1GEGA 2IXAA 4DQXA 1BW9B 2HMTA 3QWHA 4I5DA 1LUAA 1LLUA 3DB2A 1ADCA 1DC5A 4MPDA 1P1KA 5JDCA 1VE9A 4XDZA 4U7WA 1H6BA 3JCZA 2NSDA 1YQDA 3C7AA 1OZAA 5U4QA 4BNNA 1ISFA 2X5KO 4RVGA 1NHGA 5L4NA 3DOOA 4AJKA 3HE3A 1T2EA 3WLEA 3SVTA 1P77A 4ND3A 5IF3A 2WWRA 1U3VA 2RH8A 4Y9DA 5KVSA 3PJFA 3KBOA 4OH1A 3VZPA 4IQ0A 4JCOA 3T4EA 3D4NA 3K73O 2EKLA 2NU9A 5A4DA 3HN2A 4NBUA 3VZQA 1YVEI 2X0JA 4KP7A 1GPDG 3CH6A 3OM9A 2QX7A 4D45A 4WOKA 5IN5A 4GAEA 4JJFA 3DMTA 1QLJA 4IJWA 2EKPA 4RPLA 2DT5A 3B70A 1U4SA 1ADGA 3SXPA 1LQUA 4AJHA 3VAZA 3HSKA 3MJCA 3ONDA 3QVWA 4TWRA 4RCVA 4OXNA 3ORFA 4HADA 4HX5A 1T26A 4ZD6A 1GU7A 2CUKA 1H9AA 4FGWA 4YT4A 1VM6A 1KIFA 5HS4A 1RYDA 1Z7EA 1FF9A 1Z82A 2IODA 3FNFA 1UP7A 4TRNA 4UVGA 1U7HA 3GDOA 3OJ0A 1CF2O 1FJHA 3TFOA 2J3IA 3LSYA 4Z9XA 1E92A 5JC8A 1LRJA 3UCFA 3LVFO 1LJ8A 1NWHA 1F17A 1QYWA 1EDOA 3H9UA 4M55A 4R1TA 1BVRA 3OH8A 3D0OA 3KETA 3RFTA 1TVEA 1D8AA 2EP7A 4WOJA 1YONA 5DP2A 4AVYA 4CMIB 3L9XA 1VL0A 1T1RA 3DZFA 4KTTE 4OAQA 1DAOA 1QYDA 4UEOA 4EZBA 3PGJA 4DWVA 2JL1A 4RGBA 1I3NA 2PR2A 4ZRNA 4NJOA 4R01A 5CAEA 3DOCA 5AQ1A 2O4CA 1LSJA 4DLLA 1O95A 4F46A 2NQ8A 2VUSA 1PJLA 3F1LA 1BXGA 1PGJA 1M75A 3I6IA 1OMOA 3IJRA 3EC7A 1AXGA 3AM5A 4DIBA 1EBUA 3UH1A 4PIVA 4FJ2A 3F3SA 1YL6A 1QKIA 3JQBC 2BD0A 3PIDA 4A26A 1N5DA 3CINA 2Q1UA 2Y0EA 5KJEA 1M6WA 1R12A 2IRWA 4WUVA 4PLZA 4ZQHA 3GEMA 3SJ7A 1LDYA 1KVUA 3VH1A 4QX6A 4E13A 4XIJA 1IUKA 4PFJA 4ALIA 2IE0A 4BKQA 1NQOA 3HDYA 2UV8A 2Y1EA 3TJRA 3LYLA 1U28A 2R00C 4BNMA 1MG5A 4R16A 2OFPA 4NG5A 4R4JA 3CXRA 2NVUB 4CLOA 1U2DA 2HMSA 4CM9A 4DC0A 1A4UA 4WLVA 1Y6JA 3DZKA 3PHJA 4Q3EA 4Q39A 1KVSA 4CR6A 4P38A 4XGKA 4JLWA 1W4ZA 3I4FA 1V35A 3H6KA 3UKOA 4PLTA 3BIOA 3U62A 3TN7A 1K6IA 4H15A 5L3ZA 4GPD1 1ZK4A 3JYLA 3PFWO 4ROSA 4Z6KA 1H93A 4DPLA 3CEAA 4UUNA 3RUIA 4HKTA 4NPCA 2FMUA 3C85A 4IDFA 4QQRA 4TVBA 3TZHA 1C1DB 2QQ5A 3TSCA 2V6FA 3G0OA 4OYRA 1P31A 1DLIA 2IEBA 3H2ZA 2VNSA 4MJLA 1U4OA 3TL3A 4EBFA 3IMFA 2Q4BA 4II2A 4MDHA 3KTDA 1BDBA 2D1YA 3UXYA 3K2EA 2ZIZA 5F1OA 3C7CB 1LX6A 2GPTA 5G4LA 1B0AA 1HSOA 3GEGA 2EXXA 1PEDA 2NLOA 3TNLA 2VYVD 2ZB7A 4MKXA 3RUDA 5HTOA 3I83A 2BELA 4BIIA 4GSKA 4M54A 3ZV5A 4AJPA 3GZ4A 4EDFA 1E3WB 1PS8A 3L07A 2P4QA 3L6DA 2NU6A 5T67A 3S2IA 2B4TO 4IXWA 4CV1A 1P74A 4BHTA 2C59A 4M86A 4OSOA 3INTA 3GRKA 5C7OO 4R3WA 3WGHA 2J3HA 4WASA 1ZJYA 1EE9A 4PLGA 3COSA 3Q2IA 3VH3A 4GVLA 1ISJA 3K92A 3EZLA 3NDJA 3EVNA 1N9GA 3PZBA 3WMXA 4OJNA 4TKMA 4E5NA 4Y6PA 4ID9A 3EK2A 1ULSA 3G79A 3RQSA 4PG4A 2H63A 4BGIA 4FDAA 5FI3A 3KYBA 2IZZA 1FDUA 2Z1NA 4N18A 5A3VA 3VPSA 3ZWWA 5BSHA 5L4SA 1BVUA 1EBFA 3F5SA 1NVGA 1Q0LA 1XSEA 3R1IA 4BO8A 4K6FA 3FN4A 1QSGA 2H1SA 4KUHA 4Y67A 1HT0A 2ZQZA 1T1SA 2NWQA 2Y1DA 4JN6B 4DQVA 2UUOA 4CJXA 4BNGA 3KHUA 2QZ9A 3UCXA 3Q9NA 1PZGA 4GMGA 5MGBA 3ZI0A 4BNVA 2AHRA 1VJ1A 4B3JA 3L6OO 1Z7BA 5T64A 3W6UA 4DBVO 3WYEA 4E0BA 5GZ1A 2UVDA 3HWRA 3LLVA 5EJ2A 1SO8A 3SX2A 4JGBA 2JJYA 1ZH8A 1GV1A 5I8WA 3NT4A 5JAQA 3ROPA 4CMAA 1YRLA 5KKCA 1M6HA 1E5QA 1Y5RA 3B6ZA 3FBGA 2WM3A 6ADHA 1EVIA 4DC1A 3E9MA 3GFBA 4D7AA 4RPHA 1GUFA 1Y1PA 4A27A 5G4KB 1IPEA 1I33A 5IXSA 2EGHA 4AJLA 4YAJA 4R69A 2PK3A 4X54A 3TZKA 5GZ3A 1UR5A 3JYQA 1QYXA 3JQGA 4DTIA 1PJBA 4IM7A 4P4GA 3NV9A 5KIAA 3HNPA 1RM0A 1B8VA 3FPCA 1W73A 3QJ5A 4IJVA 2BFMA 1NPYA 2HJSA 2WD7A 2ZTMA 2D0IA 1GQYA 2HKIA 2EGGA 3VC7A 3OETA 4NFYA 3GY0A 1EK6A 2HK9A 1R16A 4XD2A 3ZHBA 1OAAA 4F6LA 4KOAA 1I0ZA 1YL7A 1UXHA 3PJEA 4W82A 5H81A 3GZNB 1K2WA 5A02A 1PGOA 2VTEA 3BMOB 4B7CA 2XPCA 3WDSA 5HRUA 3EVTA 3N58A 4DQUA 4W7IA 2RHRA 3G1TA 4IIUA 5J23A 5TF4A 2Y68A 3GPDG 3KUXA 4MVJE 2NTNA 4ONEA 5JE8A 1VPDA 7MDHA 2AEFA 4I9NA 3DHNA 2DFDA 1KETA 4PLFA 3DWFA 4I1IA 1DC6A 1E7YA 1NHWA 2GD1O 3AI3A 3F4BA 3QP9A 4N5MA 4GX5A 5B37A 7ADHA 4OQZA 3JQAB 5JBIA 4KDEA 1QG6A 3PYXA 2GUGA 4XDYA 4AJJA 1IHYA 2DC1A 2Q1TA 4HBGA 5TC4A 1Y81A 4EUFA 1G0OA 4YDRA 3U4IA 1R6DA 2GZ2A 3QSGA 3OSUA 5IG2A 1X0XA 1XQ6A 4RQUA 1SB8A 4U0JA 1YDWA 3D3WA 4RLHA 4AJ4A 2OBNA 4L0QA 1E3SA 1YQXA 3IQDB 1FDTA 4J1QA 1ZFNA 3GLQA 1DRUA 4MIEA 4CR8A 4A03A 2V6MA 4ZN6A 4CM4B 2DTXA 3NJ4A 3CMMA 4YQZA 1HL3A 1H94A 4LCEA 2HSDA 4J7UA 1PSDA 2YV1A 1NR7A 2DAPA 2XF8A 3DZBA 1PJCA 4EEXA 4G65A 1YXMA 1LNQA 4GMFA 2WYWA 3ZN2A 1AUPA 2E49A 2DQ4A 4G5HA 4Y8VA 1HF3A 1TA4A 3QVTA 4YQYA 5FFFA 5JSFA 2QYSA 4E5YA 2PGJA 1K6JA 2PH3A 2BI8A 4CV3A 4E4YA 1SEVA 2BH9A 3PWZA 1XA0A 3AUAA 2A92A 5T8KC 3RAJA 3DOJA 1T24A 2VUTA 3A06A 5A04A 3GNTA 4IXTA 3VTZA 1ZK1A 2NU7A 5HS6A 3ETDA 4IMRA 4CQMD 1ZCJA 2VYNA 3MTJA 5JC1A 4IS2A 3GN1A 4KZPA 5EESA 4HFMA 4HP8A 3DO5A 3AWDA 5AXCA 3RI3A 3VDQA 2VT3A 1DOHA 1I3KA 3LF1A 4II3A 3MWDB 4ITUA 3U5TA 4Z3DA 2X0IA 1PU2A 4F3YA 3JQBA 4E5PA 2BFAA 2HMWA 1PJTA 3SLKA 2DBVO 5FEUA 3Q1LA 4XGNA 3ZWPA 5LDHA 4JK3A 4QO8A 1E3IA 5DF1A 4CL8A 1EVYA 4NBVA 2ZCUA 3OBBA 5KCZA 5BNIA 1P0CA 3JQ7B 4IQGA 3OA2A 1VSVA 2JFGA 3L4SO 3U49A 2C7VA 2HAEA 2R00A 1A7KA 5L7WA 1LBEA 5T57A 4YJGB 3I6QA 3DBHB 4BVAA 1R4NB 4FPXA 3BMCB 1LSSA 3GOHA 1ZSVA 4XYEA 1PS9A 9LDBA 3WR5A 1E0DA 4L4XA 1MV8A 1JKIA 2O48X 2PZKA 3E18A 3LQFA 3ONEA 1R0KA 1CQJA 4CLDA 3TOZA 3BMNB 2E48A 3PTZA 4J4BA 2J3JA 1B8PA 1ZXLA 5A5FA 3KLPX 4WCFC 2HMVA 3JQFC 5IDYA 2FRDA 1O5IA 3GVXA 4A73A 2OZPA 5L45A 1VKNA 3JQ8B 2W2LD 2PZLA 3FHLA 4LRTB 3U3XA 3MWEB 1ID1A 4RF4A 4BGEA 4O63O 5KTKA 2W2KB 1B14A 5ENDA 1PGPA 4NFSA 5A05A 1B7GO 4BKOA 4IIVA 4MVJA 4WECA 5IZ4A 2IZ0A 8LDHA 3W4JA 3T7CA 1JN0A 2ZJ0A 2VZ0A 1I2CA 5B4TA 2VTDA 2Q1SA 3O9ZA 3SBOA 5KJCA 4BNIA 4WLNA 5KJ1A 4BNHA 5I9LA 1NVMB 3VZSA 4BO1A 1L7EA 1YO6A 4K1LA 3TOXA 3GDGA 1I2BA 4N5NA 3O8QB 3PQDA 3B1FA 2YFQA 1SNYA 1VJTA 3RC1A 4PN3A 1JWBB 3DEYX 5F5NA 3WGQA 4UEJA 2V65A 4YJDA 4J7XA 3PJDA 4B8WA 1DLJA 1BWSA 1F06A 1X7GA 3GAFA 1NM5A 2E82A 2XAAA 5G0TA 1ZJZA 1H5QA 3E5RA 1BDMA 4AJ1A 1DXYA 4XB2A 1Z74A 2NUAA 5B4VA 2QIOA 1E1KA 1WWKA 2D59A 4YYZA 3OHSX 3L0DA 1U3TA 2JCVA 4DIOA 1LI4A 4LSWA 4AG3A 2AQIA 1T25A 4PLPA 3GAZA 4NMHA 2B0JA 4GI2A 1L1FA 4A2CA 5F21A 4RPKA 1YOVB 2UYYA 4AL4A 1KEWA 1H2HA 1WDMA 3RFVA 5JAIA 3JQEA 3O4RA 1MC4A 1VLLA 3QV1A 3PP8A 1HXHA 3IDSA 4P4LA 4R41A 5TX7A 1T2DA 2C20A 3N7UA 1BRMA 2NVBA 3EHEA 4MO2A 4XYGA 5IJZA 5ENVA 1E7WA 2Q99A 5BNTA 1XKQA 3QIVA 3NX4A 3PHGA 3D64A 1PJSA 3SC4A 4I08A 3M6IA 4RVFA 5CDGA 1E7RA 2YUTA 4W9NC 2A4KA 1K89A 1VL6A 3DDNA 4RVHA 3BTVA 4BNKA 3WMWA 5HM8A 4GLLA 3KO8A 2JD2A 1PJ3A 1NBOA 3BMQA 1UAGA 2CDCA 2EWMA 3O03A 3IL2A 4UVEA 3GR6A 1Y8QA 4PG7A 1P33A 3V2GA 4JJGA 5FYDA 4RDIA 3ZHZA 2J5QA 4CV0A 1HETA 2FZEA 3ZDFA 1HLDA 4D46A 4UEKA 4JXKA 4PLYA 2BKAA 2Y0CA 2PTGA 3K31A 1ADBA 1O89A 4FR5A 3PQEA 2J8ZA 3I23A 1E6UA 2I5PO 4MVJG 4RDHA 1YB1A 2SCUA 4QUKA 3DQPA 5JCJA 5LDGA 2CDBA 3JQ9C 1H6AA 5CFZA 4Q3DA 3HQ4O 5JMWA 2TMDA 3UUWA 3NTOA 3ZW8A 1XEAA 4BO4A 3DZHA 3UOGA 3VPGA 1YWGO 1KERA 1E5LA 8ADHA 1V3TA 4CM7A 1ZNQO 1BMDA 2CVZA 4XRGA 3KYCA 2DKNA 1ONOA 4IDGA 4ZQBA 4GL4A 2VHZA 4OSPA 5JO0A 2JFHA 2YHIA 4E5KA 3WQSB 2QG4A 1GQQA 1VRWA 5JDIC 2P5UA 1ENYA 1GAEO 1HEUA 1ZEJA 1LC3A 3BZUA 2VRCA 3BHJA 4CM6A 1AHIA 4PVCA 3JYNA 1Q0QA 4AJEA 4E32A 2PH5A 1Z6ZA 2O2YA 5AXDA 2IDZA 3DONA 2G82A 5L53A 1KS9A 5BR7A 1NFFA 2EP5A 3D3EA 1X1TA 1PJQA 1NQTA 4Q3AA 1DIGA 1C14A 1WP4A 4XYMA 4A10A 4NK4A 4XQEA 4ZA2A 1SCUA 4JNKA 4YPOA 3I5MA 1ZMTA 1AHHA 3FWNA 1OFGA 1MXFA 3QRWA 3A4VA 1GQ2A 2HDHA 2EKQA 1B16A 4EJ0A 2DLDA 2X58A 3IJPA 1TT5B 3RKRA 2GSDA 2O50A 1SB9A 3U4HA 2P5YA 3P19A 4D42A 3HZZA 4IINA 2D8AA 5F3RA 5K0ZA 4CM9D 1U1IA 1D4FA 3I9JA 5HA5A 4LRSB 1TB4A 3KB6A 4IZIA 3ZWVA 3WG9A 5I7EA 1DIRA 4GWGA 1JU9A 4B3IA 3R3JA 4DYVA 1RKXA 1J4AA 4E30A 1K5HA 5ER6A 3VHRA 2JCYA 2ZYGA 4CMHA 2YFHA 2PV7A 4EUEA 4IS3A 4NU6A 5IZCC 1LEHA 2DPHA 4F6CA 3PWKA 2Z5LA 1DFIA 3C1AA 1O0SA 1UDCA 4ZICA 1NTOA 2CFCA 1KEUA 1OOEA 1ENOA 4AJIA 1V3UA 5COBA 4O0LA 4NNJA 3H5RA 4OOFA 4B4VA 3FR8A 3H2SA 2O4UX 3NRCA 5T8KA 3JQ6A 4LK3A 1LLQA 3H65A 5TT1A 4O6VA 1LLDA 3ZWOA 2B37A 2DPGA 4QFDA 2NTJA 3OEYA 3GN2A 4ND5A 4GGOA 4RZHA 4BNJA 2J5KA 1HYHA 5L95A 1SEPA 2P4HX 4KWHA 1P1JA 4WNCA 2EG9A 1WMAA 2YDXA 3ASUA 1U9JA 4JIGA 2O3TA 2VWPA 4XB1A 4BKUA 1FDVA 3WB9A 3EZYA 4AFNA 1EFLA 3IKVA 1XCBA 2ZQYA 3STHA 5C7IO 5TIIA 3KEOA 3G1UA 1DO8A 3FI9A 4CM1A 3M1LA 4CQLB 1C0LA 2YV2A 2FPIA 4BGUA 2G0TA 4IZHA 3JD4A 5DN9A 3F46A 3DBRB 1N92A 3VPHA 1M67A 1JKJA 4IUYA 4JX8A 1Q1NA 3JQDA 4FC7A 5EQFA 2CZCA 5COAA 1U5CA 4L8VA 1DFHA 2VN8A 4OO3A 3P7MA 2Q4EA 2OGUA 3I9MA 3UGKA 3TL2A 4CM8A 3KSUA 3I3OA 2I3AA 1C1XA 4BB6A 2Z95A 1LC0A 2C82A 3DFUA 3JSAA 4BKRA 1V8BA 1HE3A 4WCFA 3JQFA 1P44A 4I5EA 4WEOA 4XQGA 5K9ZA 5TQVA 4YRBA 3CKYA 3P2OA 3S2FA 3V2HA 2AG8A 2GGSA 1M76A 4BNWA 1YL5A 3RUFA 2EHDA 4YEDA 1XDWA 4INAA 3WTBA 3VKVA 3VPFA 2FWMX 3IP1A 4N54A 3FNGA 3E6AA 4GX2A 1J5PA 1NPDA 2CVQA 3GUCA 3TZQA 1Y8RB 1NPTO 1E3EA 3ADPA 4D43A 2EEZA 4L76A 1DC4A 3WQQA 2DBZA 4W6ZA 2O7QA 3BYZA 2P68A 1LDMA 4LMRA 4PLCA 1HLPA 4UVHA 1C0PA 4J9VA 2AA3A 4DPKA 2VZ8A 4NJMA 4DLAA 3RUCA 1RYEA 2C07A 2DU8A 2NTVA 4PG5A 4WPGA 1E3JA 4EW6A 4ZJUA 4WKGA 4OM8A 1BW9A 4R3NA 2C2YA 2HO5A 4M1QA 2FR0A 4CLRB 3H8VA 4XR4A 1EUZA 4PG6A 3WYCA 1DJNA 3FTPA 2W98A 3WQRA 3H5AA 4NH4A 5AVOA 3KM0A 1PGNA 2B36A 5GMOA 3WGTA 2VOJA 3TWOA 3ZH2A 1JLLA 3RJ9A 2VCYA 3DBVO 1KOLA 1KVQA 4FC6A 3KYDB 3FNEA 5HWSA 3MJEA 1XWFA 1WZEA 3C3XA 3WNVA 1KVTA 3ZU2A 3MOGA 1PJ4A 2B35A 2PFGA 4KMSA 4DMMA 2BF7A 4YB8A 5I7SA 3E82A 5HBRA 1GL3A 2IYPA 1D1SA 3H3JA 1IB6A 4B4OA 1PZEA 4L75A 4PG8A 2PKRA 1BGVA 1KC3A 1Q0HA 1X15A 3PXXA 4W9NA 3WWYA 5EQDA 3U9LA 4E2XA 3GVPA 3VOSA 3Q3CA 3S2GA 3IS3A 4RO0A 2XXBA 1A71A 2C29D 3DBLB 3T7EA 4YVFA 4ZQEA 3SEFA 1ZZEA 1BXKA 3ZU4A 2Y93A 3GDFA 5K6AC 1U7TA 2EIHA 2O7SA 1YBMA 1UXIA 4IY1A 4UUOA 4RVDA 3EUWA 3NGLA 4FBGA 2AW5A 1GYRA 1N7HA 4ZHSA 5CDUA 3AY3A 3PHHA 2EJVA 1PIWA 1SBYA 4GBJA 1DSSG 4J4TA 3GNSA 4YRDA 5DNAA 3TRIA 4BMVA 1HDOA 3DTTA 1I5RA 1QV7A 4A0SA 1HKUA 5JNLA 4N7RA 2I3GA 2RCYA 3HADA 4NHEA 3RJ5A 3SJUA 2JHFA 3F6YA 3M1AA 1R4MB 4LW8A 3ZZNA 3JQ9A 3M2TA 4WLFA 4HXYA 3AI1A 4J90A 2E4AA 4JP2A 4GLOA 4QXMA 3W4KA 2Q50A 5DCWA 5CEFA 3S1LA 5DCUA 3S8MA 4EJMA 2DM6A 3ZGYA 2I67A 4E12A 1EVZA 1O94A 3UN1A 1KEVA 1GCOA 4CMIA 3ZNOA 1XU9A 4E5MA 4BQRA 4CMBA 4B7UA 3JV7A 1GY8A 1IYZA 1X14A 1FXSA 3DL2A 1JKFA 2QRJA 3N74A 2VYND 4MIYA 4O5OA 4I5GA 1A72A 1SZJG 4D3DA 4P22A 2I6TA 5JDIA 3FPLA 4D0RA 4YT8A 3GFGA 4WE3A 5JYDA 5L7YA 4ND4A 4AICA 3OFSA 5THKA 5FI5A 2OP1A 1YBAA 1YKFA 3RD5A 4BNFA 3VTFA 3LT1A 4XGIA 1YQGA 2IYOA 4CMEC 2P2SA 1CETA 2X6TA 4XQCA 2O3UA 1GDHA 1IULA 3G17A 1E6EA 5L51A 2PKQO 2O3RA 1P9LA 2W4QA 2VHWA 1WDLA 3K30A 3E48A 2ZB3A 3QY9A 2Q45A 2LDBA 2Q2QA 2PGDA 3EGOA 3IIEA 1H9BA 2ZJ1A 1LSUA 1TXGA 4NFHA 3JYPA 4MIOA 5EN4A 2POQX 5G0UA 3LDHA 3P2YA 1PWXA 1LDBA 1ORRA 2Q3EA 5TGDA 1CEQA 1C3VA 3V8BA 4DBZA 3OJFA 3PLNA 1E7SA 5C37A 5EMHA 2YY7A 2G76A 4ALMA 1DIHA 1JW9B 1I2ZA 5CDTA 1JVSA 1U3WA 2I66A 3WFIA 1LLCA 2UAGA 5C5IA 3X2EA 5IZCA 3AOEC 3LT4A 4Q3NA 2B5VA 2JKVA 1O9BA 4I9UA 3MJ4A 4J1NA 2WTBA 4R5MA 1G0NA 1C1DA 1QYVA 3OF2A 4DLBA 4R9SA 1X1EA 4TSKA 2Q46A 5U1PA 3E5MA 1XGKA 4MVJD 3U09A 3PLRA 3AUUA 4TVOA 3ZU3A 4XKJA 1MB4A 1EE2A 1HDYA 1PR3A 2R6JA 4TZTA 1QRRA 3NTQA 4YAKA 2NACA 1E7MA 1ZO8A 1XG5A 1MG0A 3AUSA 3C1TA 4WLUA 3VH2A 4EI2A 1MA0A 2P9EA 4XJSA 4E2ZA 4HFJA 1W6UA 5DBIA 2X22A 2VQ3A 4J0EA 5KJFA 1CRWG 1Q2XA 2Y1CA 1LRLA 2Y67A 4R51A 1NP3A 2ZYAA 3GHHA 1NWCA 1E3WA 2ZTVA 2VWHA 4CQMB 1ZK3A 2Y66A 1RWBA 1WXDA 2Y99A 1EUDA 4R1NA 3QW2A 4YJFB 4MKZA 2PD3A 3W6ZA 4BS9A 1MC5A 3GGPA 2GYYA 3GVHA 1U8XX 4I9HA 1PR9A 4OIMA 1TT7A 3U0BA 1SAYA 4QECA 3U4CA 3FF4A 2HMUA 4EEZA 3GA0A 1PQPA 2X5JO 4CUZA 1EDZA 1H0KA 2YJZA 5AXBA 4KQWA 1G6KA 4BMNA 5KWEA 3I9LA 2G17A 4HFNA 2AQ8A 2XXJA 3UW3A 1GYPA 4XZ3A 2UDPA 5B12A 4L74A 4HNGA 4AJNA 3PDUA 1FMCA 4CMKA 3S2EA 4WCDA 1GV0A 1GADO 3O38A 3FWZA 4L4RA 1C0KA 4MVJH 2X0NA 5ADHA 4U8GA 4YAEA 5ILGA 2I9PA 3PHIA 4CV2A 3AW9A 4R1SA 5DOZA 4DGSA 5EL0A 2GN6A 4BNUA 5L7TA 3ZWYA 5DCYA 4JJIA 2BFPA 3Q9UA 3AY6A 2OXIA 5A9SB 1X13A 2B5WA 5FWNA 2HRBA 1ONNA 2BGMA 4A7PA 1ZMOA 4IPTA 3F5QA 2P9CA 3L6EA 1PZFA 5G4KA 5JCJD 1NVTA 3LF2A 3H9JA 1ZUD1 2J3KA 4FCCA 1LQTA 2OUIA 3NYWA 1DEHA 4U0KA 2FPGA 1E3LA 4DXHA 3JYOA 3D7LA 3ENNA 4JQCA 1ISIA 4AJ2A 3P5SA 4FFRA 3OMLA 2GF2A 1F14A 4XQ9A 1RJWA 1P1FA 1JAYA 2ET6A 3NDRA 5CP8A 2CSUA 1EEHA 1H2BA 3GZNA 1F8GA 3BMOA 3RU7A 1FDWA 4Y98A 1HWYA 1QP8A 4MKRA 4PLWA 4B3HA 3TZCA 1YGYA 3ICPA 4PRLA 4W7HA 2VRCD 1B3RA 3OQBA 2DTDA 2BHLA 2V7PA 1WAMA 3GGGA 1M66A 1T4DA 4K28A 4P8RA 3RC9A 4YAGA 5CG2A 5JMPA 2GN4A 4YA6A 3F4LA 4IDDA 3AFNA 3JQAA 4L9RA 1FDSA 4PGFA 1P0FA 1D7OA 4BNTA 3RUEA 3AM3A 1DFGA 1E77A 4CL3A 2VT2A 1KVRA 3V1YA 3ROMA 3RCBA 4H3VA 5JFOA 5K6AA 1EZ4A 5DBFA 2PY6A 3FD8A 4ALJA 3KVOA 1UXGA 5BT9A 4CM4A 4C4OA 5I9NA 4D3FA 4MP6A 2ZATA 4CLXA 4JBIA 5KOIA 3ANLA 5ICMA 3LK7A 1UP6A 3K8ZA 1F12A 4TMFA 2NV6A 2DUWA 1MP0A 3D4OA 3RBXA 4LISA 1JTVA 1T2AA 4H7PA 1EFKA 3QVOA 1WMBA 1GD1O 1KEPA 2AE2A 5EIOA 3ITKA 1I24A 5BQFA 5A5EA 4BKPA 3KXDA 3ZWCA 4Z9FA 1E1MA 1CWUA 3LC1O 4OMUA 4RJTA 2RBEA 1V6AA 2BMAA 5L40A 1A7AA 1TEHA 2ZB8A 2WMDA 2NU8A 4BV9A 4URFA 1ONPA 4D79A 4DL9A 3B20A 2YZ7A 4YJHA 3BAZA 1N2SA 2QHXA 2QW8A 1HDZA 1HYEA 4YBZA 1EMDA 3OJEA 1YE3A 3E9QA 4W4TA 3WSVA 1NNUA 3GG9A 3KOUA 4OXKA 3WGOA 2Y1FA 4U6QA 3NDIA 3ZWNA 3UAGA 1C0IA 3W4IA 1DAPA 3WXBA 4CMCA 1OI7A 4CPDA 1V3VA 2CVOA 1Y9EA 5TSDA 3EDMA 1X7HA 3DFZA 4GWKA 3WNQA 5CPFA 1VKOA 4QT0A 2VWQA 1ULUA 1DRVA 4OKNA 5BSGA 5CDYA 1JWAB 4NU5A 4XX0A 4DREA 2FP4A 2OBYA 3PWSA 1B2LA 2AG5A 2W90A 4MP8A 2AQKA 1CJCA 2FSVA 1NFQA 2W8ZA 3JQ7A 1BXGB 3NAQA 3RC7A 3WICA 3OP4A 1YB4A 1A4IA 2HLPA 4NI5A 2WJPA 4AJOA 1UXKA 4FN4A 5U9CA 2C5EA 1ENZA 2WYVA 2OMEA 3WGIA 3K2BA 4YJGA 3HB5X 2QRLA 1RM4A 3FTNA 4J4HA 1R4NA 2CDAA 5KVQA 3BMCA 2A9FA 2NADA 5DBGA 3DHEA 4S1VA 3B1KA 3KEQA 3WGYA 4JROA 1KY5A 3DHYA 5ILOA 4KDFA 5A03A 3D1LA 4Z9YA 3BMNA 1YJQA 2YV3A 2ZKLA 2J5RA 3BTUA 3WGZA 4CLOB 3GGOA 1T2CA 1K6XA 3AOEA 1UZNA 2AMFA 4IGFA 3QWFA 4KQXA 3RU9A 5L4LA 4U6SA 2CF6A 3JQ8A 2HQ1A 5TJ9A 4BL5A 3GT0A 1XR3A 1GUYA 2JCXA 3EY4A 5DP1A 3GHYA 5T6BA 5JW6A 2W2KA 3OECA 4NK5A 1V9LA 2CD9A 3ULKA 1ZK2A 1ZSYA 3JQCA 2VWGA 5TT0A 3ZW9A 1PL8A 2PD4A 3B1JA 3RIHA 3AK4A 1R0LA 4I5FA 1PX0A 5G0WA 4XEHA 3QE3A 2NM0A 1YB5A 2Q2VA 2X23A 4YRAA 3GEDA 3ZHXA 1RM5A 3GH3A 3I52A 4D41A 3GC6A 1ISMA 3O8QA 3HG7A 2GZ1A 4ALNA 1UZLA 1SOVA 1ZXBA 3CMCO 1Q7CA 4YACA 3ON5A 4IBOA 1HZJA 4UULA 3DZGA 2GRAA 3V5NA 4RQTA 1SMKA 5I7FA 2RIRA 1XHLA 3LC2O 4J0FA 4OQYA 5JS6A 4YWJA 2WD8A 5ER9A 4TROA 2OP0A 1PL7A 1TLTA 3G3EA 1L7DA 3OIFA 4E21A 2BGLA 1I10A 2GR9A 1W8DA 1R0SA 3NT2A 5F1KA 1I30A 1M2WA 4FIZA 1B15A 2O3JA 3IC5A 3OQ6A 1D3AA 4RV9A 4O59O 4J16A 2X9VA 3PJGA 2FN7A 4UREA 1DIAA 1YOVA 4L4SA 4QFCA 4IJKA 2AE1A 1G1AA 3JD0A 1YJ8A 4OHUA 4B79A 4QO7A 3RBZA 2Q1WA 4J9UE 3RC2A 1EK5A 3QQPA 4BNYA 2PGLA 3MOIA 4Z0PA 4FOSA 3FBTA 1N9GB 4M8SA 4FS3A 3DZIA 4MVJI 5DT9A 3WTCA 5JCXA 3ROQA 4RZIA 1YDEA 3I9KA 4TKLA 4CLEA 1LSOA 1XIVA 1P1RA 4M89A 4J49A 4J1SA 3L9WA 1HSZA 4NBTA 2GCGA 4PZCA 2JHGA 3NEPX 3I1JA 1Z45A 2JFFA 1DIBA 4ZU3A 5JXWA 4BGVA 3E03A 1P45A 2ZB4A 4ZRMA 1UDBA 3R6DA 1P1IA 3ZNQA 1GEEA 3RSHA 3ZV4A 4Z3KA 5A06A 1E1NA 3WWZA 4MOWA 5LC1A 2GDZA 3ZCXA 4TRMA 2EV9A 1SOWA 3ABIA 5I8ZA 1DBVO 2HK8A 1OC4A 5JPIA 1WLYA 1ADFA 4E3ZA 1HE4A 4QEDA 4XWYA 2H5LA 4ND2A 4Q3BA 1J0XO 4UUPA 2HRZA 3GMDA 3ETEA 3ETGA 2VOEA 1NX6A 3LT2A 1GTMA 3LT0A 3LLSA 2X86A 5B4UA 2EERA 3ZHYA 4C7JA 3OIGA 4DMLA 1I3LA 5DOVA 1UP4A 4UUMA 3AU8A 4G2NA 3IP3A 2LDXA 5EERA 2ZCVA 1PZHA 3QHAA 4PVDA 3SC6A 3RFXA 4FOOA 5COQA 4FSHA 4CUKA 5AXAA 3JQGB 4GGPA 3HN7A 4RLSA 1DDOA 3PEFA 4WLEA 3ST7A 4DUPA 1DRWA 1T4BA 1GZ4A 4K9DA 2C54A 4I8XA 5IXYA 1BXZA 4RPJA 3K5PA 1ISGA 2VUUA 3RBVA 2WD7B 4RF2A 5CEEA 3AJRA 1WPQA 3D4PA 4XIYA 5KVCA 4UAGA 2V6BA 1V0JA 2X9GA 2BLLA 2C7GA 3WSWA 3QWAA 1PWZA 4BO0A 4IJUA 3UFXA 2C5AA 4BNZA 3KRTA 2B69A 1QMGA 3WFJA 2BGKA 3E1KA 3IUSA 1LXCA 1Y9AA 3T4XA 5A1TA 4ZVVA 4B4UA 3L4BC 4FFMA 3WJ7A 1ZEMA 2HU2A 2PZJA 1HYGA 2WE8A 1AXEA 3AI2A 4IMPA 2VHXA 3VVBA 3M2PA 1GPJA 3EAGA 1VSUA 2EJWA 4IDCA 5G0SA 2ZYDA 1Q7BA 3DZJA 4XCVA 1I01A 2D2IA 3JD3A 1LA2A 2WSBA 3DAGA 3ZWBA 1TT5A 5TRTA 4OKIA 4PCVA 2PLAA 3HDJA 5KVVA 4IDAA 4FW8A 1I8TA 4BMSA 1PQUA 4TRRA 4TZKA 5I7VA 1MFPA 3E8XA 3H9GA 2IZ1A 1XU7A 3HUDA 2YQ5A 3SLGA 3D3WB 1DB3A 2GN8A 2OORA 4NQZA 4YT2A 5JAMA 1H6CA 4J6FA 2BI7A 4OXYA 4BO7A 4CUJA 5JAZA 4Q3CA 4E31A 3OICA 5L9AA 3ZWAA 2FPPA 3TF5A 4PZEA 1DJQA 4D0SA 2Y0DA 2A94A 1CDOA 4BQPA 2AXQA 1UUFA 2PKQP 2A35A 5GZ6A 4CM3A 1WDKA 3TFQA 3WBFA 4E6PA 1PL6A 2X9NA 3HDQA 4FFLA 3WGGA 3E9NA 5DDIP 1NQ5A 3QA9A 4YAIA 1GCUA 4WNIA 2P91A 1AN9A 2UUPA 3DAFA 4YTEA 1Z75A 4LSMA 4WK6A 2J6IA 3DTYA 1NR1A 4R54A 1F0YA 1HDRA 2CMDA 2GLXA 2NQTA 2YDYA 2BRUA 3GF4A 5IAAA 4EITA 2YHUA 3WIDA 3OQ1A 4TRJA 5AOVA 3I4CA 1CQIA 1MGOA 4MVJF 3WJAA 1AGNA 3V1TC 4EYEA 1DHRA 4H16A 3GVCA 3KSZO 5IDXA 4BOYA 3RUHA 1ZIDA 3D5QA 1JA9A 3GRPA 4RORA 3OIDA 1TI7A 2Z1MA 2IEDA 4BNLA 4CQLA 1U5AA 4O1MA 3H9EO 5TJHA 1IY8A 3PYMA 1O8CA 2OHXA 4J91A 4HY3A 5BNFA 2RH4A 1UZMA 3TZ6A 2PD6A 2ZTLA 4Y6SA 5C7LO 5ICSA 3I9NA 3MZ0A 4GX0A 3DC2A 2EW8A 3DBRA 2AEMA 4EGFA 3K9QO 4OOEA 2VRBA 1N1EA 3INGA 3IOYA 4Y6RA 1ZK0A 5JY6A 3RVDA 2Y1OA 4GH5A 3ANNA 3NJ8A 1HTBA 1I32A 4TQGA 2Y05A 4NBWA 5H83A 2CF5A 2G5CA 3MTGA 4R68A 3VKUA 4YXFA 3A9WA 1B3BA 4GKVA 4LCJA 3MEQA 2D5AA 4W99A 1HE2A 3AU9A 2VZ9A 3H4VA 3H7AA 1EQUA 1Y7TA 4J43A 4BO5A 1XYGA
chains in the Genus database with same CATH superfamily
4L5IA 3O75A 1CC1S 4ZALA 4FB5A 4YJ2F 2GD6A 5EPOA 3JZMA 5JYEA 4RVSA 4ZCRA 4BO9A 1A9YA 6REQB 3PIIA 1X0VA 4OXQA 3F1KA 2W2OA 1GN9A 1WUYA 4GIBA 2WABA 3L4JA 2PGAA 3LXXA 4HMOA 2QLMA 1VJGA 3A37A 4I2NA 1SG0A 4WZBB 4DIEA 3CTMA 4KLAA 2YZKA 1U99A 4DDMA 1ENPA 3H0CA 5J1TB 4ED9A 4BMZA 2Z5VA 4IGKA 4RYDA 4I6JA 3IERA 1LCIA 1CZNA 3G2JA 3GW8A 3OX4A 4JMPA 2OECA 1QE5A 1D5CA 2EF1A 2X15A 3ANXA 1XOIA 2PZGA 4FFSA 4Z2YA 1LDEA 2IXBA 2SHKA 2UUAB 2FQQA 3IUJA 2WIAA 4S1TA 4WDQA 5KYVA 2PMCA 2X5OA 3IVCA 1QZZA 1Y8RA 3NHPA 4CMJA 3MWLA 4B73A 1P81A 2D5CA 1ECPA 1LDNA 3AX6A 1M8KA 3G2NA 4XA8A 4F4DA 1JPUA 1WMDA 3R3SA 4UHBA 3NWJA 4ZYXA 1A9ZA 3IFSA 2DCMA 3NHZA 4UFNA 1MJGM 3ZBQA 1RHKA 3UENA 1GXSA 5E7JA 1XLTC 1OWPA 4LJ8A 4WNAB 2VSOA 3KVVA 5ES3A 3A4MA 3LLMA 4QARA 5CHEA 2IIVA 3GMSA 3HFSA 4C7KA 2JD0A 5JFGA 1E8MA 2X40A 4E22A 3HBAA 2LCFA 4H0CA 3V1MA 1GR0A 1ISHA 4CTNA 1H4TA 1YI0A 2I2WA 2XYPA 3PT5A 1P5ZB 1MAHA 4KMMA 4KR3A 3HVHA 4GKBA 5IAKA 3SI7A 4PR0A 1AB5A 3ZKAA 1F8YA 3JRXA 1BNCA 5T6MA 4YMWA 3IO5A 4OGWA 4WJZA 4DLKA 1JHDA 5AMXA 4K8OA 1SU6A 4B32A 4W5QA 2I6QA 1DRKA 3E27A 4CBVA 3U5ZB 4CCWA 1JZQA 2BE7A 3D6HA 3DCNA 3IV7A 1G3RA 3K5WA 1BHQ1 1RHUA 1V16B 2HHCA 4P4SB 1NMSA 3L7DA 1LPPA 2O05A 6YASA 2BTQB 2C5FA 4HN2A 4DUGA 7REQB 1VYUA 2K2WA 3E9DA 2ISCA 3LZ6A 1L7QA 4CMGA 3N70A 2FWPA 9ATCA 1VYVA 2W6QA 1ZSNA 2PVSA 5JCOA 3FVQA 1OILA 4HXFB 3B85A 5K03A 3AETA 1MFZA 3ZBUA 4M0MA 1ZUHA 4GNKA 2O0JA 1P2VA 4KACA 3Q87B 4TPKA 1A76A 3ZLTA 2ZOSA 1NKSA 3N86A 3MSCA 3F47A 2FPMA 2QYHA 1XMPA 5AM4A 1NW7A 1SC4A 3PNMA 3WRWA 4NBSA 1VE7A 4G3XA 1CS4C 5DLDA 2D3WA 2XH8A 1OAOC 1UEIA 3QFRA 2R8EA 3UBTA 2YV5A 4RU1A 4O4JB 3ZGOA 4YQEA 1VJDA 3KXKA 2GARA 1AUQA 1TKRA 3ESQA 3UV7A 3NKLA 4BB5A 3PVZA 4D3YA 4WUTA 2YYYA 5C9ZA 2PGXA 2DBQA 3DP9A 4ZGGA 1SJ9A 2C9YA 1FDIA 2FMIA 2TMKA 5IAGA 1BROA 4CDGA 10MHA 3T8YA 1HYBA 3M5CA 4PV7A 3INRA 3QKUA 3F73A 4K6CA 2G77B 4GOOD 2Z9DA 2AOXA 1UDAA 4N5LA 2OO5A 1JDSA 1Z8FA 3GPLA 3G9ZA 1A9QA 2FR1A 4HGYA 1ZESA 1Y9ZA 1Q7GA 4KTVE 2GASA 2GAJA 2AMLA 3GLGB 2F8TA 1PFYA 2HNBA 2L42A 3O5AA 5TS3A 5FNVF 2QAGB 1IE3A 3L82B 3WBBA 2N9UA 2QP3A 2VP5A 1V39A 3DMTC 4G25A 2Z2XA 2A1UB 4BWYA 2UU9B 4DWWA 3D8SA 4HYQA 2HCTA 3BHNA 2OL4A 3ICOA 3RVQA 1NW5A 2CKDA 2PUJA 1Y3BE 2EKBA 3DXFA 3TSYA 5BW8A 2X0RA 4GPEA 1EVJA 1N5OX 4M87A 4P81A 2YWHA 3HWSA 2IUTA 1TL7C 3TMKA 3W1VA 2YY5A 5JD4A 1K3TA 4ARAA 2HDWA 3HU2A 3OWOA 3SWWA 5IT0A 3KXPA 3K70D 3K53A 2GXAA 4K2AA 5G0VA 3UMYA 3KZCA 2VNJA 3QUTA 3NYRA 1FSZA 3RTDA 3N2IA 4J29A 4L3VA 4N3AA 4BYMA 1U8UA 3U4GA 4XOIA 1AKRA 4I9FA 1IWOA 4Q9JA 3LXRA 3IUMA 3NNSA 4BO3A 1HFJA 1QX4A 1IJEA 3PQ3A 4R8VA 1E5DA 4HK4A 3SXUA 2SCUB 4DEYA 1Z73A 3L0PA 1AUXA 1SVOA 3QXSA 3L7NA 3UATA 1EIWA 2O2SA 1HDIA 3P0FA 3BX1A 4GECA 5IS2A 3AM4A 1DPFA 5EMMA 1IK6A 1IJBA 1EWKA 1P91A 2P27A 2FZGA 3DO8A 3QVXA 4HS9A 5GM1A 1J06A 5JO9A 1YRYE 3BTOA 1YUMA 2C3PA 3O2SB 3PEUA 3U3ZA 1UFVA 5C4MA 3MJVA 1OREA 2GN9A 2EF0A 3ORHA 3H8JA 3IEUA 5DX1A 5EHXA 4ARSA 2WSLA 1QG0A 2FMHA 1IZ9A 1G2IA 4JR0A 4D26A 1JIJA 3DAPA 4Z1MA 3KYCB 2D1SA 3WAKA 4RIIA 1FJ2A 1H1LB 2VHVA 5H3HA 4EZEA 3C4JA 4N65A 1M83A 5CIWA 5G2OA 2YHIB 3OJWA 3KDAA 2GBLC 5LZ2A 1Q16A 4ALLA 2YOFA 2HK7A 2HWXA 3L4BA 3PBKA 4KIGA 4MW7A 1QGDA 5BYBA 2FOIA 4AY6A 3MTQA 3ZOZA 5JH7B 1E6WA 2XMSA 1QU2A 3SDBA 4M49A 2OSBA 1ILWA 1VRCA 3WVNA 4KVFA 1L8LA 4QQNA 1HM5A 4U7FA 1PGQA 1C2TA 1Z15A 1RPZA 2GLTA 2I62A 1IPFA 4WGGA 1QYCA 1U1FA 4CN9A 1DCKA 2XYGA 4FZ3A 3F8WA 4LC9A 4DNPA 2BPOA 4MEAA 2CL5A 3ZJYA 1DBWA 2APJA 4ZO4A 4JP3A 5C5CA 3W5DA 3CVVA 3RS8A 4AMZA 1SCUB 2PZMA 4KPUB 4ABTA 3LZCA 1G9SA 4ZVQA 1XRLA 3AJ9A 3OT1B 4D6PA 2ONKA 2IXEA 2PS9A 1I1QB 3T12A 2PA3A 2X3UA 4LAFA 1JA0A 2CL0X 1RADA 4H3KB 5FPHA 1G20E 1YS7A 3ZK9A 4YQFA 1WV1A 4TLCA 4N5DA 3GT7A 2FHSA 2RGWA 3GPIA 2X7HA 1QIJA 2EFEB 2ISQA 3S55A 3T0GA 3I12A 2DPMA 4KPYA 5JY1A 1A5ZA 3SQXA 3IP8A 3NBUA 3KWLA 4IGEA 1P5FA 4HQRA 1Z5UA 4HWKA 4L4UA 4O4IF 4EI7A 1XCOA 2XXAB 5C34B 5B6IA 5BYKA 1DNPA 1NSTA 4D9MA 4C5AA 3FOEC 2GOYA 4IDEA 2PKWA 5DXAA 3I92A 4P4NA 3RRZA 4DHWA 2IGBA 1FFBA 4J0JA 4X7RA 2RAFA 3BXPA 5LQAA 2A88A 2H11A 1CHDA 5HJ2A 4W8HA 5BSEA 2RKOA 3WMGA 3ZV6A 1PLJA 1Z8HA 4M8LA 1KY2A 2I8CA 3R7DA 3RDPA 2D1FA 5LB2A 2JAHA 5ALNA 1O4VA 3V4VB 1I51A 1NI3A 2FUEA 3OEWA 1ORWA 1VBNA 3FWYA 4Y6OA 3HFRA 4RD4A 1Z7GA 3V2UA 4HB0A 4KUEA 1F9EA 4KQCA 1O6CA 1RYBA 3FMPB 3ZKWB 3RIMA 2GCPA 4F9FA 4J2HA 4JFRA 3ZWQA 5K8TA 4FZJA 2BCGY 3PQFA 1F3OA 3C6ZA 3A9UA 1N75A 2CWDA 2J07A 1D2HA 1G8MA 3N76A 3V80A 3MLEA 3Q11A 5DGCA 1Y63A 3LUCA 4BQSA 3KAQA 1BKSB 4AP5A 3FNQA 3LY8A 1BA2A 4TTVA 3GG2A 1CUAA 4YCCA 1Z12A 1WQ3A 4KQEA 1T43A 2IYXA 4IXNA 2OY0A 4XWGA 2FW6A 1X92A 3SMQA 1KBZA 2MHCA 1VMIA 3ZHCA 1UPFA 3SX4A 5TGZA 3TUIC 4PCUA 4PGAA 3CC8A 3GGCA 3EW7A 4NNOA 4X7PA 3EGDA 2ZIVB 3S4YA 4F2PA 4BY9E 2RI0A 4BLQA 1C7JA 2COKA 1H2AS 1V8OA 2EFYA 3A3PA 1IWBB 3B1WA 3JW8A 4UBIA 1SVMA 4YECA 3TCXB 5I7RA 2ZPAA 1MXHA 2J0UA 4HWRA 5BVHA 2FY8A 3EARA 3WYFA 1DELA 3X2FA 3R0XA 3TOCA 3A14A 3AKEA 4JR2A 3UPUA 2NP7A 1UXJA 2IOQA 3QHPA 4KXUA 1I7DA 5IT9A 3FMFA 2VAMA 4BVBA 3OE7D 3NGMA 3Q0TA 2CXHA 4PONA 3LFTA 3MW8A 1FYFA 1HTTA 1COWD 3E2PA 2EP8A 3HYRA 1UADA 3OX3A 4V3CA 1G7RA 3TQIA 3QEJA 2ZWIA 3D3KA 3MTBA 4ZAXA 4CM8B 4Y2HA 1AMOA 4IIYA 1ZRSA 2J9ZB 1NAHA 4NR0A 5BYAA 5HIKA 1N77A 3RS7A 4B3SB 2EVWX 5EKTA 1UMKA 2RGNA 2B4AA 2QIPA 3KZVA 3QWBA 5BMOA 4K2HA 3I32A 3PD0A 2PR7A 3HJAA 4WLOA 1WSBA 2VNAA 5FOVA 2E7ZA 3EQ9A 5CBKA 5AQEA 1XWIA 4GQAA 1MABA 2X5XA 2R86A 3QE2A 1SRQA 4PAMA 5IT5A 4EJSA 5LQMA 3U9TA 2WR8A 1Z6QA 3AGPA 3V1UA 2HN9A 1TYEB 3ADOA 2G8NA 2PZ8A 3PI6A 1RKVA 3DT6A 3NTVA 1SC3A 3VKGA 3U19A 3QX7A 1VYTA 3VR5A 4PYJA 2YR0A 3RFCA 3O1HB 2QPOA 4J7CA 4N3CA 3MJFA 4JVSB 1RZ3A 3GJTA 3WGJA 1PN3A 1NXSA 1UKCA 1SC6A 2G08A 2VNIA 4DNQA 3C1UA 2OM6A 1BN7A 1SPXA 1KMHA 3CRRA 3I1IA 5E1OA 2IX3A 2JAPA 2J9XB 2PS3A 2Z5FA 2CUTA 1X1RA 3TPZA 5JMTA 4KWCA 4Z0NA 4ND1A 6LDHA 2CHFA 4RSHA 2RHLA 5HM6A 5JS1A 5T5QA 1IAVA 1TQ8A 5I7HA 1MHPA 2O8VA 1E6LA 4TMXA 5TVGA 3BWEA 3FCSB 1G20A 4KJZA 1BW9B 1BDJA 1K8XB 3H83A 4I5DA 3LHIA 4C7MA 1NNSA 2QTAA 1X19A 1LLUA 3DB2A 3HNRA 5CXXA 2QD1A 3SOPA 4BEVA 5A6SA 1BXRA 4L9SA 2ZULA 3I04M 4UJ3A 3GLKA 4NU0A 3AP1A 1TF2A 2VHQA 3PE4A 3JCZA 3FUTA 4WD3A 1X80A 2AKAB 5KYTA 2ZBQA 3PPVA 4JXZA 1JEJA 5THXA 2A5GA 5BSMA 4L02A 3RHFA 3R2JA 3K8OE 4KXXA 5E9WA 4BNNA 4MLPA 1AHPA 4DKXA 3DOOA 2BBSA 3MG9A 4AJKA 3HE3A 1T2EA 1G4AE 2GWHA 4ND3A 5IF3A 4TT3D 1MRZA 1YSCA 5K3BA 4DRXB 3LUJA 3KBOA 2VPIA 1E2LA 1SVNA 2QVGA 3PJFA 3VZPA 5FLXA 1HQYE 4RENA 3BK2A 4NAUA 1M1NB 3IBGA 5JJ5A 1R9MA 3PIRA 2I34A 3B3GA 4PYLA 2PCLA 1UK7A 2NU9A 2XYQA 1XROA 3ZZ1A 5J1SB 2W6ZA 4ZYZA 4GO1A 3F9RA 1QGOA 4PFSA 2BGWA 4LQCA 2AI2A 3ILVA 2J9FA 1SKYE 5FPKA 3KSMA 4YMLA 5F3DA 2IYQA 3HYCA 4D45A 1NC1A 1WBJB 2PL1A 4JT2A 4BN0A 3TSZA 5EKDA 3H17A 4BFXA 521PA 3PLAE 1UT8A 2XYVA 3ICWA 5HZKA 2R11A 3K9WA 1A9XB 3KZNA 1Q6ZA 4YP9A 4C0KA 3VAZA 2I1VB 2O0KA 1KYVA 4AY2A 3KL4A 2RHJA 3HKBB 3N87A 3QVWA 4QODA 3PPXA 4RCVA 3TLCA 2CCGA 4KPEC 2OZEA 1GU7A 2K87A 1QWSA 2RSLA 4FGWA 1LQ2A 1TYCA 3KE8A 3QMMA 5CB0A 5HS4A 3QPUA 3Q72A 4WZAE 5ES4B 2IODA 1M8FA 1Z82A 4JQSA 3ELUA 3C16C 3R5JA 4K46A 5D7BA 3CKMA 4KITB 1QOZA 2VA9A 3GDOA 3VGJA 2W6NA 3EN0A 2KJQA 2J3IA 3K0BA 5FUXA 2FGKA 5JC8A 1E92A 1P7YA 1SIWA 2CNDA 3UCFA 1OYWA 3LVFO 4EHIA 5JHGB 4WA7A 2TSYB 3CLUC 2EZUA 3IVAA 4ZEOA 3IR6A 1C2YA 4KDRA 3ENQA 4HLCA 2XB4A 5DP2A 1ZI9A 4KRYA 3NATA 1W581 3W34A 5E8RA 2O19A 4KTTE 1DAOA 4H1WA 4YV0A 2HA5A 1POXA 1USIA 1AGXA 4K88A 1DBIA 4UPDA 5FPYA 3PKZA 1Y6ZA 4NJOA 1ZUWA 1RTTA 4B5KA 3AH8A 2ZYVX 2L82A 2O4CA 4F8YA 1JHAA 2YNMA 2YWXA 3WWEA 3F1LA 2EFGA 1PJLA 2VUSA 1PGJA 3IH5A 1M75A 3I6IA 1OMOA 3LBFA 3G2MA 1IM2A 4GPBA 4IIJF 4LHXA 4K6MA 5CX1A 3T1NA 4Q66C 1Z4KA 3ELYA 3F3SA 4PIVA 3FY4A 2ZUSA 3QEMB 3UH1A 4A4DA 3ZHSA 1CNMA 5AKHA 2XCOA 2WHEA 3EUAA 3SZOA 3CINA 4OA5A 1G2QA 3H1TA 1JEAA 2Q1UA 2QXUA 4A26A 4M9CA 2IRWA 2V6JA 4GZLA 4QBKA 4ZQHA 3ZK7A 3WK9A 2QLJA 3JQRA 1DCMA 3LX4A 2XE6A 3HL0A 4LYHA 1WABA 2OLEA 4L4ZA 3RREA 4ALIA 1E1QA 4BKQA 1MNAA 1N4AA 1NQOA 3TRKA 5ECWA 2G3YA 4YRQA 4CTJA 3TJRA 1JXOA 2JDIA 3BCRA 4CN8A 3SZMA 5CK5A 1VE5A 1G8SA 3ESXA 4IOKA 1A9TA 4NG5A 2FDCA 3HEBA 3JRNA 4R4JA 3A9SA 3CXRA 3LY5A 3KV1A 1P5RA 2CJPA 3QU5A 4K1XA 2NVUB 3UHPA 2HMSA 3AHFA 4D5EA 1YVPA 3SBEA 1A4UA 1SHKA 2CXUA 8ABPA 4IAOA 1GN8A 2AI3A 3MNFA 3PHJA 3TVYA 3ROTA 1JKXA 3LUFA 4Q39A 4Q3EA 5DTEA 3SBXA 2WWIA 4JLWA 5ARBA 3I4FA 1K8RA 2WM2A 1KFEB 3RK1A 4KXQA 4V02A 1XZNA 4Y2XA 4YFVA 5A4AA 4LFBB 1Q0TA 3U62A 2WOJA 3LPMA 1KJWA 4H15A 1INLA 2OAEA 4XWKA 1Z4NA 3KD2A 4YRLA 1SHZA 4IJ5A 2DUJA 1T6ZA 2FRDC 1J23A 1TAHA 2BMJA 1ESCA 3RUIA 4FMDF 4BBJA 4MJ7A 4HKTA 4RTKA 3RG8A 2QTZA 2RI1A 3H3XA 3WGLA 1C1DB 4Q7KA 1EU1A 3K94A 2V6FA 1S2DA 2ZSKA 4OYRA 3AUFA 3AB8A 2G80A 2O8CA 2Q3JA 5I7UA 1DLIA 5BSRA 3PFNA 3H2ZA 1C3OB 3E7DA 2VNSA 3GFTA 2IK8A 4I55F 3TL3A 2WU0A 2WMYA 4RTOA 1HNXB 2NUPB 4GBMA 4LDNA 4ZOCA 4U3JA 1ZN9A 2J7PA 2JH3A 2IUYA 3K2EA 3NDPA 4EPWA 4LQ4A 3ZVNA 2NZYA 2GPTA 4QOHA 3V34A 2JKZA 2OESA 2R4UA 2ZKIA 2X0EA 1FXUA 3IODA 1WDWB 3QKTA 2PT5A 4BAUA 4C2TA 1WUIS 4G0YA 5KAMA 2OCDA 4PE5B 3TNLA 2VYVD 3RUDA 1RLUA 2VUHB 3CVUA 1Y7HA 4BIIA 4AN1A 4AJPA 4MJXA 2V7XA 3GZ4A 1K97A 1P2TA 3H2HA 3H7IA 3M6AA 3HVJA 2AOTA 4JLSA 4RANA 4OGKA 5EYPB 1GKUB 2NU6A 1MRSA 3B5JA 2GPSA 2AIRA 1L5YA 3C70A 3EXIA 3K1AB 1VIDA 3OQHA 4IL5A 1P74A 5CGQB 1NOIA 1SA0A 2C59A 4Z8YA 5CXQA 3M49A 5K8JB 1EXMA 3H5IA 4QYXA 4WASA 1JZTA 4PLGA 3FVTA 1QH1A 2HA6A 4F7DA 2RAPA 3EZLA 3LDAA 3EVNA 1NUPA 1TK9A 2WA2A 4HG2A 4WZAA 4C78A 1XZHA 2XR1A 1BKDR 1FS5A 2PUCA 1Z5GA 3CCBA 3EFOA 4OJNA 5EIAA 4Y6PA 1JXAA 2W83A 3TTWA 3CLTD 4KNWA 1FYXA 3RQSA 5G3ZA 4FDAA 2P65A 5YASA 1TQHA 5ULLA 4B6SA 2Z1NA 4N18A 5A3VA 4NDZA 4Q7LA 2ZYUX 3ABZA 1BVUA 3M1IA 2QEQA 3F5SA 2ZU6A 3CVOA 5DSZA 1VE6A 1QZXA 2WTXA 1UWVA 3A1VA 3B13B 1RJ9B 4BO8A 5KTPA 3R3XA 3GLUA 4Y67A 4F38A 2VQEB 2NWQA 4NF2A 4ZVUA 2HBQA 3R8CA 4LFCB 3S2UA 3SIPA 4BNGA 3KHUA 1JEYB 1W9MA 1KNQA 2IH2A 5MGBA 3H2KA 4QOSA 3SYRA 4BNVA 1MZVA 1DEXA 2AHRA 3A27A 1EAMA 1U0EA 2FUG1 2ZRGA 2QAGC 5FNZA 4B3JA 4E1VA 5JR3A 1N0WA 3TLKA 2VPXA 5BN5B 1G8YA 4MYDA 3UB2A 2OPBA 2O9JA 1C4OA 2ZWMA 4NV1A 3HWRA 3LLVA 1YZYA 1EGQA 5ABPA 3SX2A 2R47A 2PX6A 3TQRA 4CNBA 5JZMA 2JJYA 3QXXA 4MR7A 3QNMA 4TXMA 1YR3A 5B3KA 2J85A 2JLYA 1KYWA 5BV0A 5JAQA 3U81A 1M34A 1VKRA 1UKEA 5EZQA 1TO6A 3Q5DA 4CEJA 5FT9A 4XUGB 3FBGA 1UKAA 1F3LA 4FP9A 4P7BA 1UBJS 1ZOLA 2FZCA 6ADHA 3R5XA 1MJGA 4OAPA 1EXNA 3KTFA 2JFXA 3N2NA 1JYSA 1Y1PA 3KLNA 4ZVPA 3KQYA 3UJHA 4A27A 5G4KB 1IPEA 4BPRA 2PWBA 4PAWA 4R69A 4LXXA 1T8RA 2PK3A 4X54A 1J00A 2ORWA 5I5EA 2DPLA 2GYUA 2OHOA 3JQGA 2AL7A 2JJMA 1Y82A 1PJBA 5CH8A 5GWXA 4DTIA 4IM7A 4P4GA 4EPXA 4MYRA 2FEKA 2ZAIA 2Q7DA 4QKQA 1RM0A 1Z33A 3FTFA 4J0IA 4RZXA 2Y8EA 2C2MA 3HHEA 3IYLW 1BFKA 4B44A 1IN6A 4HDAA 4JLVA 4OK5A 3RU3A 3BWBA 2O0LA 1GQYA 2BGUA 2HKIA 2Q5QA 3AW8A 1MQAA 4DMGA 3UK2A 4EMTA 2WWHA 3VC7A 3OETA 4AG6A 5KX5B 1GA6A 1R16A 4F6LA 1XC7A 2DMRA 1I0ZA 3FCUB 4H0FA 4KOAA 4LRQA 5IEJA 1JG4A 2VDPB 4P9NA 5A02A 1RQNA 4D4LA 1BHO1 2XPCA 1QO0A 3PGMA 5CLQA 3QI7A 4M99A 2C58A 2HLNA 4W7IA 1J8DA 2IF2A 2EARA 3DNMA 1P6QA 3TQOA 5F77A 4M7WA 3QA3E 3S99A 5G1NA 3KPVA 3IAM6 4ONEA 1T6NA 5JJIA 1KZ7B 2XGMA 1YFLA 2DOKA 3W5VA 5HKLA 3D6NB 4YCMA 3F4BA 2GD1O 4QSHA 2WNHA 2WIKA 5B37A 4EVIA 1PUXA 3H5LA 2RFLA 1IY1A 1G3IA 5JBIA 2GM9A 3AVXA 2XRMA 2VDKB 3LPDA 3Q7SA 4IDPA 4W1RA 3KOWA 3C5WP 4YDRA 2JLZA 3LD9A 1HRKA 1YB7A 2XUGA 3AV3A 4B40A 1R6DA 3L0CA 3SZUA 5IC4A 1D2RA 6AT1A 1PT5A 3G8DA 4UKDA 3N53A 2HK6A 3PPYA 1MORA 1TD1A 3TLMA 1SB8A 1S9HA 4EB6A 5K0BA 2ZXFA 3D8BA 3EYAA 4AJ4A 2XCQA 5HJ7A 1YBFA 3IQDB 1Z08A 2AMVA 5JAHA 4DMRA 5GONB 2V6MA 3W9BA 5KTYA 5A0VA 4KRGA 2DTXA 2EBFX 3IPRA 5AK0A 3CMMA 1UDRA 1KQOA 3H1AA 4YH1A 4YQZA 1H94A 2JCSA 3OURA 3URKA 3VR1A 1K0FA 2WICA 4U7HA 3K0KA 4DDHA 2IOFA 2C98A 5JROA 1IQUA 2XF8A 4FYWA 1P72A 1E2QA 4URWR 2XNCA 4FT4A 4OHKA 5DNCA 2RD2A 3DV0B 5LMZA 2OLKA 3UNXA 2V03A 1LNQA 3N2YA 3NIWA 2WYWA 4R9VA 1AUPA 2E49A 5EA2A 4GEKA 4JQZA 3SP1A 2PPVA 3P8ZA 4PYMA 1SKQA 5CM8B 1TUIA 4YQYA 3LYHA 3HH8A 5IM4F 1DOAA 1TVKB 1CQWA 4AROA 2W48A 4EPRA 3IRUA 2B9EA 3CNNA 3P26A 4E4YA 1SEVA 2BH9A 2PXXA 2YVLA 4FOTA 2OZLB 1XA0A 1N4DA 2FETA 1PYGA 3LUGA 1X1CA 4JP5A 3A06A 5LD2B 4JI2B 5L3QB 4ZV4A 4IXTA 1XYYA 3FM9A 3VTZA 5DPMA 5KNBD 2NU7A 1JYFA 1OXSC 4GSYA 2CMFA 5HS6A 1S8FA 4JC8A 4E2XA 3UO8B 4FHGA 4RYLA 3WZ2A 4Q4AB 3A9VA 1OWLA 2EWWA 1W4AA 3CB2A 4HP8A 2LR0A 3ZXSA 4ENWA 1K7EB 1H2WA 3MOSA 4OHXA 2P9JA 4II3A 2GAIA 5DGHA 4B3MB 5LSAA 4EVQA 3GJ5A 1ZNZA 3D6AA 5IH7A 1PU2A 3RT1A 4F3YA 1Z62A 1KJJA 4GPTA 1Z28A 4ZCPA 3JSXA 2XD9A 2QSZA 5D01A 4X41A 1V7QA 3SLKA 3U40A 1A8SA 4XGNA 2XQFA 4XX0B 3HVIA 4AC9A 1QF9A 4CL8A 4RKYA 1EVYA 1OT3A 1P7CA 5FUVA 2QX9A 1HK7A 1JS1X 3OBBA 1QIEA 4IJ6A 1FC0A 5IHPA 5KCZA 2V4UA 4IQGA 5BUSA 2ZIXA 2PX2A 4JL5A 3GJ8A 2DHQA 1IY0A 3L4SO 5L7WA 2C7VA 2R00A 2ZRJA 1QK4A 2ZBGA 4C5BA 1LBEA 1X9HA 3RRBA 4L8LA 5T57A 2UZ4A 3V8QA 3W3ZB 2YS7A 2QU7A 5KTOA 3E22A 2B2XA 3DBHB 4EM6A 4XDGA 4LSZA 7ABPA 1UBHS 3BMCB 5LQKA 1P4AA 2YL2A 2ZBRA 1PL0A 4C4PA 3U1TA 2AG1A 1NQWA 5FJJA 4LHSA 4L4XA 1AQUA 3E18A 5FI0B 1IZYA 1E2FA 4DMKA 1T9KA 4EYKA 1R0KA 5FTLA 2YVAA 3PTZA 3KSAC 4PHTA 2X1LA 2E3JA 2NAFA 1N3BA 3GUVA 1LB1B 2O07A 4IEIA 4Z7JA 2PU5A 1JA1A 3JQFC 4Y2PA 1I4TD 1BOFA 3DDSA 1T5DX 2Q41A 3LAWA 3UGQA 4BRUA 2PZLA 3FHLA 1FFXB 4P0QB 3R7FA 1TMYA 5AI0A 5B6PA 4P92A 2IU0A 3G68A 4BGEA 4E08A 3R7AA 2PZEA 1DOZA 4MSUA 5ENDA 3DWEX 4BKOA 4HQNA 4IIVA 1DO0A 4P80A 4KGZA 2IZ0A 1I4LD 3OC6A 3ZQJA 3ITNA 3FKSA 5AK4A 2ZRIA 3T7CA 1F2TA 1TYAE 3ES9A 3BGSA 3TAHA 1JH8A 2XNKA 2C03A 3L93A 3O3MB 4EG6A 5KJCA 3T3OA 4KU4A 4FCVA 3WDLA 2ZZNA 1L4BA 1L8XA 5I9LA 2TRSB 3I2KA 2YFYA 3HP1A 3GQBB 2C7OA 3H18A 2WJ4A 4N5NA 4KQ2A 5DO9A 3S3TA 3O8QB 3V00A 2WOOA 1SNYA 5H5JA 3TDMA 4EARA 5CU7A 4YYEA 3LNTA 5ALTA 5PGMA 1NATA 3HJCA 1DUVG 4HNAA 4UEJA 4RETA 3PJDA 5F9HA 1H2YA 1NJ8A 1DLJA 4M8IA 1NVBA 1JALA 4Q00A 4DLTA 3VPCA 4O1HA 4QUAA 4R2JA 4DYHA 2XNHA 3E2IA 5JNTA 3KUDA 1C4KA 1NNEA 5LXTF 3AILA 1OD6A 1CXZA 1PT7A 1PR4A 1P2BA 1Z74A 3NZEA 4P36A 1E9SA 4DR6B 4YYZA 3KBBA 3QV2A 3RVKA 5IJ9B 5ESWA 4OJKA 1S2IA 1Z4QA 2MINB 2QXYA 3L1UA 4PIMA 5K3DA 4BEWA 4NE2A 1DBPA 2BR5A 4WOPA 3P20A 3ETJA 1SRRA 4LXQA 1YR1A 4BZXA 2WQ6A 4E88A 1XQYA 2MYUA 2IELA 4WBNF 3NV7A 1I2DA 1T5SA 3ZYCA 1DTEA 1N2HA 1XRQA 1YQEA 1VLLA 5BPHA 1L5MA 3PP8A 3OG9A 2KSQA 2GJKA 4P4LA 1O9HA 4M9UA 1J8FA 1T2DA 1XU4A 1B6TA 2C20A 2F6RA 4KAXA 4DM3A 1E7WA 3AR5A 4IF6A 4MQEB 3H2GA 1XXLA 2XJ4A 3TBKA 2VPPA 1YD7A 3IP7A 2G0AA 4MB2A 2WIGA 2G5PA 1J09A 3HYTA 5ALOA 2FFHA 2GJAA 2EOAA 5LQCA 4JDUA 3FPEA 3PQCA 4H60A 4IUBS 4R6XA 1C30B 1IOZA 2H00A 2PANA 3NP7A 3TAUA 3BTVA 3DC7A 3V8EA 1UMBB 2UYOA 2PKXA 4RK4A 1RC1A 3P45A 5B3JC 2JD2A 5TEWA 4L22A 4YCJA 4UDNA 1NBOA 1KEEB 1ZKDA 3K0FB 3ZE9A 1EFAA 3O03A 3IL2A 4R83A 1Y8QA 4YHBA 5EJ6A 2RMKA 1JNXX 1K5PA 1TM7E 3IKLA 4KI7A 5ALUA 3SY8A 2W9XA 2Y1LA 3H86A 5A5DA 2A59A 3MA0A 4WXPA 1GG9A 1E3DA 3UV3A 5FUMA 3OM1A 2Q7XA 2JCGA 4ESVA 4QIHA 1IZ8A 4F6RB 3QK7A 4JR1A 3NVMB 3Q98A 3B9PA 2G40A 4ZI7A 1W94A 3OOEA 5I4KA 3ELWA 1N3YA 2DZDA 1AKTA 3AEQB 4EGCB 3JQ9C 1K92A 2VJYA 4Q3DA 1CVIA 1P4SA 2TS1A 1C9MA 2TMDA 2C97A 1HYQA 1MIOB 1XEAA 4IVPA 1MENA 5E3JA 1QK3A 3DZHA 2WIBA 2PGOA 3UOGA 2GM4A 1IHDA 1QQTA 2R6ZA 1E5LA 3SVZA 2BONA 4WSOA 3EG9B 2VYQA 3R9WA 1QRDA 1O5TA 1QFSA 4XRGA 2W70A 5GQSA 4E2FA 1UBEA 5L6MB 3ILSA 4QGSA 2VHZA 4RXMA 2BHTA 2IPXA 3FOWA 2QUZA 1EJBA 1LPMA 4EHDA 3FDJA 4EI8A 1R8SA 2W6IA 3I04A 2DFPA 1ZW6A 4LXGA 3NONA 4PWYA 5T4BA 4BJ5A 4HI0E 4TV8F 4P0TA 2DWCA 2IH5A 1PK8A 4HDMB 2VRCA 1S7GA 2PFKA 3BHJA 4Q12A 4QFMA 2RGGA 3EY9A 3JYNA 4IR7A 5I47A 5LLDA 1TZ2A 3DSRA 1VKHA 3F90A 1M0EA 1UT5A 5ICEA 2HXSA 2RGRA 1CKEA 3B6JA 3O3NB 5FWXA 1KS9A 1NFFA 4DR7B 3V8NA 2IYLD 1VOTA 2PJRA 1HLGA 1NQTA 3ORQA 5BNZA 2CNWA 1OLSB 2DQSA 4DNFA 4ZA2A 1MB9A 3GCXA 5JZOA 3L0YA 1L4NA 3FWNA 4N12A 1MXFA 2YXEA 2G0NA 2EKQA 1DARA 4NLLA 3ZE7A 2X58A 5A4IS 5ED4A 3IJPA 1VLQA 3L6RA 1TT5B 3VVMA 1MF7A 1ISPA 3U4HA 5M5BA 2PBRA 4KR0A 3O8NA 3HZZA 5F3RA 4X66B 3CIOA 4DXAA 4DG8A 1V6CA 3I9JA 4YI3A 3GLIB 4JITA 3V48A 1DO2A 4NE9A 1PDVA 2YJNA 1JZSA 2XWSA 2G07A 3Q7TA 2AK2A 3MMSA 5A9SA 4FXOA 3A25A 2CW5A 3K0CA 4GWGA 1FE8A 2IXTA 3OZRA 4LBVA 4OHZA 1ECCA 1J4AA 1RKXA 2QW1A 4XLLA 4EG5A 4LF7B 4IHJF 3VHRA 3VNAA 2ZYGA 1AC5A 4CMHA 2XCRB 2PV7A 2ZJZA 4CKCA 5TQ0A 4HDKB 4B45A 4EUEA 1NBWB 2WZCA 2IHYA 4GZ6A 1W19A 2FN3A 4QGBA 1N2BA 1SQ5A 1T10A 1FFDA 2YS6A 3HLKA 3PWKA 1P29A 1DFIA 3I42A 3C1AA 3IJ5A 3JX9A 1G6OA 2FPPB 5JARA 4Y9SA 1E8NA 1M6YA 1NTOA 1KK1A 2BDUA 4IEFB 4ZICA 3W1EA 1PT8A 2QLBA 2AK3A 4LYEA 1K6MA 1WG8A 3MHPA 1K7YA 3RVPA 3E9RA 3EXEB 5JSKA 4OG2A 1U80A 4CCSA 1EM8B 2O4UX 1E4OA 3T3IA 3JQ6A 2J0VA 2WG2A 1M2EA 3H65A 2R6HA 2IYEA 5FBQB 5C53B 3M4ZA 2O5EA 3EVEA 3QGMA 1IDN1 3VHXA 5A9TA 3MWYW 2NTJA 3AF4A 4KQJA 3OEYA 4ND5A 3ZGZA 2WFLB 4GGOA 2BFFA 3BQ9A 3M6MD 3RSFA 1ORHA 4MICA 5C8YF 4BNJA 4B34A 4R9UC 4HVAA 2OG2A 5AW5A 3NOXA 3A9CA 4QUHA 3CW8X 4KWHA 4PN7A 2JIPA 5K09A 3Q7QA 3VR6A 2YDXA 1UEJA 4ZIRA 2QW0X 3HJHA 2VWPA 3PEVA 4JIGA 3DQQA 3LV8A 1QF6A 1TM4E 4AFNA 3WB9A 5HUQA 1JECA 2GHQA 5C7IO 4IQFA 3NVKI 2GWRA 1S89A 2R60A 1W5FA 1DO8A 4CM1A 3M1LA 4UUQA 4F4UA 2YV2A 4Z7OB 2BJHA 4PZPA 2Q3FA 4DV5B 4GM1A 4QGHA 5HFAA 5AVKA 4L51A 5LNK6 2A2ZA 5KTRA 3JD4A 4ZAGA 3L2OB 3UBMA 4FYYA 3EGXB 1N92A 3O1JC 3VPHA 1E9VA 1T4GA 1JKJA 1S3IA 1ABEA 1XVLA 1GRNA 3GRVA 1Y5IA 4MUJA 4FC7A 3A31A 4UBNA 2E5FA 1R8YA 3EVDA 5CVEA 2VJBA 3OM8A 1NW9B 4RMJA 1GLVA 1XVIA 2ACWA 4AZWA 4DN6A 3UGKA 1B73A 2D13A 5GOZA 1AQJA 3KSUA 3ZGNA 3I3OA 2J08A 5ALHA 4B76A 2WHQA 1E2EA 4LPSA 3CHYA 2IPMA 4GDFA 2C82A 1K98A 3NIFB 4BKRA 5B2FA 2Y2UA 1P44A 4FR2A 2HDOA 1DQZA 4X44A 4BBPA 1EJ6A 4L15A 5TQVA 3P2OA 2CLIB 1M9NA 1A8PA 3ZD9A 4F92B 3SHOA 3VU9A 3O92A 3W3AD 4ID3A 2FE1A 4G6ZA 4BNWA 2W6JA 2Z09A 1YL5A 4HVTA 4QPNA 3SQOA 2O8FA 5JJKA 4EA9A 4PHCA 3TNYA 2ECFA 1C3JA 3WTBA 1CZLA 2JFBA 3AHIA 4PHGA 1MOSA 2ICAA 4WZ6A 4D9KA 2FWMX 3RJTA 3L49A 4J03A 3FNGA 4AY4A 4G0XA 1RKBA 3VKFA 1G16A 2CVQA 3GUCA 4IKPA 1Y8RB 4JI6B 2ZUEA 1E3EA 5M2QA 4ZCLA 1KWGA 1W0JD 2EZ4A 5F2OA 2O7QA 1II8A 2A5LA 3WKAA 4AXBA 3W5CA 2ISSD 3QF7A 4WXYB 3BXZA 5JNSA 2P68A 2HPAA 4LMRA 1XTRA 4UFPA 3WQHA 3GJSA 2Z1DA 4DPKA 3BGWA 1GXSB 4FLEA 4NJMA 5B58C 3GDHA 4M22A 4DSZA 3UWMA 4O02B 1K5GA 1N6KA 1XTPA 1RYEA 2C07A 2DU8A 2NTVA 1EA5A 1WTCA 2WPDA 1WZCA 1E3JA 2A1TS 4WPGA 3RR2A 2ZJYA 4LJYA 2PWPA 3NALA 4R3NA 1TVCA 4G01B 4Z9AA 1W93A 2PLFA 3HGQA 5E6RA 4MW5A 1FXWA 1O9GA 3EEOA 1DJNA 2ORED 2AWNA 1USKA 1AKUA 3WQRA 4Z4IA 3H5AA 3NASA 1GSOA 3CZAA 3KM0A 1MHTA 1D0IA 1PGNA 3I0MA 4KYVA 4QHYA 3BQMB 3FHCB 4U2DA 3WGTA 5JPDA 1KZYC 4A8HA 4EB0A 3LS2A 4UHHA 1VFPA 2YC4C 1FY2A 1U2PA 3PE3A 4US1R 1GPH1 3M89A 1KOLA 4G5FA 3RJ9A 2DR0A 3UH0A 4B3TB 4OXXA 3ZDEA 1ML4A 1LI5A 2Y6VA 2PL5A 5KMGA 1WZEA 1OZGA 3UY4A 1A96A 3KEGA 5EKXA 5B53A 2O1WA 1MR3F 5HIAA 4JI0B 3AETB 1PJ4A 1OXMA 3GIDA 3MOGA 3HPRA 3IAS6 3IJEB 1AH2A 1IN5A 3SQNA 5KWIA 5HBRA 3H3JA 3Q3EA 1D1SA 3DVSX 2O6HA 5AW2A 4RTPA 1O97D 3KT3A 4F3NA 5IFKA 2Q9BA 1N6OA 1GNLA 3PXXA 3WKEA 3WWYA 1HNZB 1HNNA 5EQDA 2YQZA 3GVPA 2EZTA 2FQXA 3IS3A 1H05A 1GG8A 3UJAA 1P3Y1 3KLBA 5DYIA 4URVR 1RMQA 3GGDA 5INTA 2AZTA 4HC4A 4M53A 1NN0A 3PCTA 2VT7A 2HC9A 2PYDA 3WYAA 2Q4TA 1KPGA 3KR0A 1JEEA 1W88A 3OOJA 3GDFA 4N39A 4Y2JA 1SXPA 1RLIA 4M1ZA 3SKXA 2ZQ5A 1D03A 1WVMA 2IHKA 1YBMA 2IZ7A 1L7MA 4D3ZA 2C0PA 3HJFA 4U9IS 2XDQA 3B9RA 4FBGA 1M2KA 1TYZA 5DYGA 4ZHSA 5CLHA 3ZD7A 5JAUA 3PHHA 1UT6A 4GBJA 4GOMD 4ERNA 1D6SA 3KQMA 1R8QA 4J4TA 3WL5A 4YRDA 3E3AA 2WZDA 5KNCA 1TM5E 2GA8A 4HDOB 3UB4A 4A0SA