3UNXA

Bond length analysis of asp, glu and his residues in subtilisin carlsberg at 1.26a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
274
structure length
274
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGSSGSTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Subtilisin Carlsberg
publication title Protonation-state determination in proteins using high-resolution X-ray crystallography: effects of resolution and completeness.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 86
structure length 274
sequence length 274
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3unxA00
4MZDA 2PKCA 4WOCA 3WQBA 1C3LA 3VV2A 5JXGA 2Z2XA 4Z2AA 2W2NA 1HT3A 2E1PA 4CG0A 3DE2X 5FBZA 2WUVA 5B1DA 1V6CA 1T1IA 3SICE 2X8JB 2P4EA 5ARBA 4J94A 3DE7X 4C3UA 3I2YX 3UNXA 1P7WA 1IC6A 4KB5A 1OYOA 1THMA 1BJRE 5AMXA 5JXJA 3VSBA 2W2OA 1S02A 1ST3A 2V8BA 3TI7A 2SECE 1NLUA 3I37X 1S2NA 2IY9A 1BH6A 1GTJ1 1ZVKA 1CSEE 1YJAA 1IAVA 1BE6A 5AVJA 2HPZA 5FFNA 5ARCA 1Y9ZA 2WWTA 1SCDA 3DE5X 1TK2A 5JXIA 4CFYA 5ARDA 1TM5E 2W2MA 1SBCA 1Q5PA 1SUPA 2ZWOA 1AH2A 1GTL1 1DUIA 3DE3X 3Q40A 3DDZX 3BGOS 3A3OA 3BPSA 1AF4A 1GNSA 2DUJA 3D43A 1AK9A 1KDZA 4H6VA 1WVMA 3I30X 1R64A 1WMFA 5FAXA 4LVOA 1Y3DE 3AJ9A 1SPBS 2Z2YA 3VV3A 1C9MA 1TO1E 3LPDA 2ZWPA 3DW1X 3TECE 5AQEA 3CO0S 3F49S 2Z30A 4DJ5X 1NDQA 3SQOA 1BFKA 3TI9A 1TM3E 3AFGA 2DQKA 1C9NA 4HX2A 4AKTA 1MPTA 1TO2E 2Z58A 1WSDA 1AQNA 1TM4E 4DWWA 4CFZA 1YJBA 1R6VA 5AVKA 1ZVJA 3A3NA 5JMOA 1KDVA 3Q5GA 3I34X 4B5LA 4K8RB 2W2PA 1UBNA 3H42B 3PRKE 2XTJA 1SCNE 4C3VA 2PMWB 2SICE 1LW6E 1XF1A 1SVNA 4DZTA 4RYDA 3BX1A 1SBNE 1GTG1 5CW1A 1GA6A 1Y3FE 3QMPA 1GA4A 3CNQS 1SUBA 4KG7A 3GCWA 2XRMA 1NDUA 2DP4E 3DW3X 3DVSX 1AVTA 4ZOQI 1SH7A 1PEKE 1SBTA 4KPGA 1Y34E 2Z57A 4NMXB 1PJ8A 3OSZA 3VTAA 2PRKA 3EE6A 2SBTA 1Y3BE 1GCIA 3HJRA 3D9QX 1JEAA 1TM1E 4ZARA 5I9SA 3DVRX 2PQ2A 1SELA 1Y48E 4OMDA 3DE1X 2HD4A 1SUDA 4WOBA 2Z2ZA 4HVLA 3A3PA 3DVQX 1SUEA 1PTKA 1TECE 4NE7A 4OV6B 1SCJA 1KE2A 1GT91 1OYVA 2PWBA 3PTLA 2PYZA 1Y4DE 2WV7A 1R0RE 3DE0X 4H6WA 3ZXYA 4M1ZA 1EA7A 3GCXA 4BWGA 1MEEA 1AV7A 3DE6X 1BFUA 1Y4AE 3AJ8A 4FONA 1P8JA 1Y33E 1SCBA 1TMGE 5JXHA 2TECE 3WHIA 1EGQA 4NE9A 3GT4A 2W2QA 1S01A 1SCAA 1CNMA 1WMDA 1V5IA 3VYVA 3EIFA 3QFHA 4GI3A 1KE1A 3LXUX 3DYBA 1TM7E 1BE8A 1Y1KE 5SICE 1SIUA 3GT3A 4YN3A 2IXTA 1T1GA 1GA1A 2QTWB 3DE4X 1KDYA 3L1KA 2ST1A 1SUCA 2GKOA 2PWAA 4I0WB 4LVNA 2SNIE 3F7OA 1AU9A 1Y3CE 3T41A 1SBIA 1A2QA 1YU6A 1SIBE 2X8JA 1GNVA 3DWEX 3WIVA 1WMEA 1OT5A 2ZRQA 3P5BA 1C9JA 1PFGA 3EDYA 1P7VA 1SUAA 2B6NA 4OMCA 1DBIA 4JP8A 2ID4A 1SBHA 5B1EA 4H6XA 3LPAA 1VSBA 1SIOA 1T1EA 1YJCA 3WIUA 2WUWE 3ZXXA 1SN7A 3QTLA 3VHQA 5K7SA 1ST2A 2Z56A 3LPCA 2ID8A 3F7MA 2G4VA 4AKSA
chains in the Genus database with same CATH superfamily
5EHNA 3GRPA 3WRXC 1QHGA 4OFWA 4AJ2A 3IQDB 3O84A 3GOHA 4UZFA 2ZUCA 1SR8A 3ZD6A 1KK0A 1J07A 3CXUA 3E22A 2I3BA 1JG3A 3ISTA 1JHAA 3O7MA 1O7JA 4OA5A 4QUGA 4WE3A 4X85A 2WSLA 1KY3A 1O6GA 1Z4QA 2W37A 2FGKA 4Q1BA 5EWMB 4II7A 3OOSA 5GIPE 3I4CA 4R4JA 1QVVA 1M5RA 3IIIA 1XZCA 1VIAA 4MGYR 2WZDA 4DCOA 2LZ0A 4CKEA 4EKEA 1PWXA 1DPGA 2ZRBA 4WFQA 3W4KA 4RNDB 2I76A 5JD3A 2JLAA 2RBKA 1HR0B 4HXFB 5IEJA 3C43A 1FP6A 1XA4A 4HB4A 4QTXA 5G0TA 1EXDA 3FZNA 3DE7X 3BE8A 4U9HS 1RWNA 2BFFA 5AW2A 1IVSA 2DPGA 2RGNC 3UNXA 1YSCA 1ZU4A 2XIJA 4ZO4A 1ACLA 4MH0R 3ZJ4A 2UUAB 2JGNA 2IP2A 5FDFA 3T3DA 1R2QA 1RHJA 4QVIA 1R4MB 1XRMA 4D97A 1V3VA 4E4TA 3WAGA 5AMXA 4CIVA 3Q88A 3PE3A 3UT0A 1PT6A 5JO0A 3LY7A 1H2ZA 3E35A 4EG7A 4BNVA 1L4LA 4NS1A 1UFRA 4FYYA 3OICA 1K8ZB 3N2GA 4X64B 4M89A 1VPWA 1VL6A 3CLUC 5E6UB 1PHRA 1G7CA 3QVTA 3E7WA 4ZKEA 3IBFA 2IIVA 3MJRA 1I7LA 2ORIA 2PS0A 3I37X 5HEKA 4AJ1A 2VHYA 1PS0A 1PQYA 2J3KA 3R5TA 5JLAA 5JYBA 3HVKA 4QPJC 1D07A 2Z0MA 2CE7A 4A0FA 3TSZA 1T4DA 5K9ZA 4W99A 4PG4A 5EVJA 1S8FA 5EZQA 3S68A 1BH6A 5JD4A 1QCCA 5TVKA 3MJSA 1R74A 1QXSA 2XGSA 4KFRA 3RABA 5KX5A 4L4ZA 4YRIA 4FYJA 5A3RA 4DQLA 4DNQA 3GFOA 5ICCA 4YHHB 3BG5A 3LP6A 1O5IA 3U44A 5FA5A 1CD5A 3GHYA 1FFBA 1XK7A 1YCHA 1PR5A 2C20A 2YVAA 1WXIA 4IIJA 3JD1A 3RS2A 1SGWA 4B34A 4QAJA 5IAAA 2W2LA 5CFQA 1DPFA 3HJHA 3KS9A 3AZQA 2BKVA 2ZI9A 4BLOA 4P92A 3HR7A 3V7WA 2IEGA 2WG2A 1OFIA 4Q24A 2O8CA 2CUZA 1R4NA 4M6WA 4RGYA 5EXEA 4D9GA 5CLFA 4TTQA 1BMQA 4JBGA 5LU8A 1Y7IA 1T6ZA 3OJXA 4HAIA 4ZOCA 1F60A 1QMPA 3E2MA 2O4UX 2JAWA 4CKZA 1EUQA 4XQEA 5AXBA 2B4QA 4EATA 3V2HA 4YJ2B 1FYVA 1EE9A 4RTNA 5JS1A 1T8WA 2OGUA 3BJEA 1ECGA 3K8YA 3JZFA 4L0DA 4OLHA 5B4UA 3OHMA 3BJZA 4TGLA 4MW7A 1J0EA 2BEVA 2G63A 2JFHA 1V16A 1WCYA 2KWIA 4DQVA 5L6LB 1QAQA 1S8NA 1Z47A 4ACBA 3A9UA 2KX7A 1BTOA 2VC2B 2PK3A 4C87A 2GKSA 3NT4A 1GG2A 2Y0DA 2G6TA 4Q9KA 4DQXA 3ABSB 4G0NA 5EE1A 5FO1A 1A7AA 3E9NA 4K03A 4EHJA 3IT1A 4BMSA 1V0JA 3H17A 3CKYA 3OZDA 4Q1FA 4RHTA 3U4AA 3D3WA 3JYPA 1VJCA 3K96A 5DLEA 3ZDBA 4JVSB 3BUSA 3KTDA 3AUKA 3D6VA 1RI4A 3QX7A 2OORC 4D9KA 3ESCA 1NQAO 1EGMB 4K87A 1V1MA 1UINA 3D6FA 3FCSB 3AHDA 2P4QA 1T8RA 4P1ZA 5AXDA 4HADA 5AM1A 4QTTB 2KHZA 4Z0NA 1II9A 2NUPA 3CH7A 3ONDA 3K4HA 1N3BA 3PUXA 1TJ4A 3RAPR 3GN1A 4LYDA 2EGGA 4J6FA 2ETVA 2AMVA 3HLKA 5C81A 2C54A 5TE9A 2B8NA 5F7JA 2O8FA 2JFOA 3AV0B 3HYRA 3WLPA 1A9XA 5CK5A 4BNLA 2BR4A 1FC0A 1E1YA 4LOLA 4FHZA 4TTSA 2ZUWA 4XFDA 4IDPA 1EDEA 1W76A 5ALYA 3H99A 3UJ8A 2ODEA 5JRZA 2IDKA 3EK2A 3WL8A 1O87A 3U9SA 3UJ3X 3PLAE 3TMYA 4CIDA 2HOQA 2QM7A 2DKNA 4JU8A 1LV7A 4MW1A 1KJWA 2QTRA 2QL9A 3CCFA 3OZUA 4GLBA 4Y6PA 4D9FA 4U0KA 2XNJA 1JILA 3KJFA 1EFVB 1MV8A 4BL5A 4CL3A 2JLXA 1TDJA 4HZUB 1UP4A 3WTCA 5JNRA 1BQ4A 1F9AA 2D7JA 2VR1A 3OCZA 2FU5C 1IK4A 2W90A 4Y6LA 2ZFUA 4YJHB 4QNMA 4GYWA 4QELA 5ECDA 3UCEA 1Z4JA 2JVKA 5KKNB 1R6XA 3DP9A 3L6EA 2CUNA 3TQHA 3F49S 5FOSA 3JQ9A 1X80A 3JQGB 3MT0A 3NWPA 5JZVA 4EGAA 2BGNA 3HN2A 2FMKA 5BR8B 2FN4A 3A4LA 3G2LA 3LQFA 4LDRA 2YN4A 4KSYA 4K5QA 2P2GA 3BAZA 1TQHA 3MD9A 4PO8A 2Y6VA 3CUTA 4YJDA 3GLIB 1H4TA 3K0FA 2F3PA 2VXCA 4FXOA 1NT2A 4PAWA 5EYPB 1K06A 2G8LA 5FUXA 4B3CA 1U2RA 3HDYA 4R1QA 5C5DA 2J4FA 3JASA 4ZV7A 4BPRA 5EJ5A 1ZM7A 4INJA 1CY1A 3HWRA 5K4AA 3VR6D 4RTPA 1PZHA 2WFMA 1G64A 5DB4A 1J1UA 4AKHA 1YZHA 2FMFA 3WBKA 1GTMA 2O14A 2C7QA 2VRNA 5FBVB 1M7GA 3PS9A 5D00A 1DARA 1OBFO 1E2IA 3SC3A 2IZ5A 1IBMB 3UXHA 1OGJA 1U5BB 4GL2A 2YKGA 5CFOA 3KALA 4ZQCB 1A96A 2GEFA 2GKGA 3NEYA 4RA9A 1VKZA 4QO7A 3SHWA 2ZTLA 5JO9A 5CCXA 4EIWA 1NVWQ 3U61B 2I4OA 3AF1A 1M9NA 1EJ6A 4MAAA 1SCNE 1UF9A 3FFWA 2GWHA 2JIZD 4WZAB 2SKDA 4HQFA 4L5AA 2AZTA 4UUPA 1WTCA 2OO7A 4MRSA 4GMXA 2I80A 4QD3A 5JU6A 1GRQA 1Z5PA 4FYXA 4PBSA 1CDZA 2FSSA 3RFTA 1SBNE 3F3SA 1KIFA 2FR8A 3BXOA 1XWFA 3O6VA 2BBOA 1N5LA 2BSQA 3C5EA 3E0QA 3K32A 3CR8A 2X0FA 3IMGA 5KOJB 1DFIA 2O19A 3JWHA 3H9BA 4O5OA 5AVYA 3KTAA 4C4TA 4ARCA 2EF0A 2NXWA 3EEBA 1N6IA 3LDUA 4IQ0A 3T6KA 1HE2A 2NZ2A 3W0LB 1Q91A 5DMHA 4IUYA 4NCXA 2PL1A 1G19A 1PQWA 3SBXA 3K9NA 3OPYA 1CIVA 1NVGA 3H5IA 1PGOA 3PGXA 1WZIA 2FPOA 1RAEA 2LR0A 4U2EA 1TVCA 3WBFA 1FLAA 4IKEA 5HJEA 2VA9A 3U3ZA 2H07A 1PEKE 5DHRA 3KJQA 1OLOA 1YAJA 1ECJA 2NYRA 5I5GA 3TO5A 4B3SB 5FWNA 3MWDB 4D4JA 4WK2B 4H7HA 2NXEA 4WI1A 4TYPA 3VR0A 4A8JA 2V59A 2XLCA 2X2EA 1QP7A 2GRUA 5J58A 4M9RA 4NMXB 4DV0B 1I9CA 4XX0B 1VHTA 3KVVA 4WCVA 1N36B 4D9BA 3A1WA 5I7VA 4HQOA 1WE2A 2R7NA 4ZO7A 5K8LA 3IFSA 1TZKA 2YICA 4AVYA 4D5GA 3OT1A 3PGLA 1V11B 1L3CA 4WN9A 1TM1E 4BB6A 4KPFC 3PBKA 4KGZA 4DN6A 1M6NA 2JLZA 4DUZB 3CVVA 2VNKA 3GUYA 2FQ1A 2YZ2A 1B73A 3R7DA 4NJEA 3RTBA 3GLHA 1CDOA 2YWBA 1FFCA 2O0JA 4TS3A 1QYDA 2J31A 1XZEA 4MVYA 5A05A 3S99A 3W06A 3C3DA 3GFRA 3QTTA 4HTFB 5DM2A 3BGVA 4DV1B 3FFAA 3CU5A 4W7IA 2MINB 1WXEA 1V8ZA 4CLOA 1ECLA 1QHHB 2XGGA 4GUAA 1R3UA 2WWFA 2X8BA 3TOCA 4TM8A 1W4LA 1IHXA 3K31A 4PS1A 3GEGA 5BY2A 1JFVA 3IPAA 5BPFA 2PJRA 1JXOA 4X63A 1N75A 2N75A 3KZCA 2J3LA 3HVIA 3EGOA 3JWPA 3G89A 3WMEA 1EIWA 3HXLA 2O2HA 1LBHA 1DGQA 4I55F 4V39A 2XKBA 3GD5A 1U3FA 3OX1A 4N3CA 4MIOA 4JKOA 3RJ5A 5BORA 1Y4SA 1RQ2A 2WP8J 2GNPA 2HQRA 1DVRA 5JG7A 1XLTC 4MP6A 1TCAA 1UM9A 2SCUA 4M1ZA 4C6SA 5LM3A 5FI3A 1JQEA 4F38A 2BI7A 3SZUA 1FFGA 3MAAC 4BWGA 3R0JA 3PPXA 3WLHA 4X9XA 1MO6A 5JRDS 4FBMA 3KTOA 1EIZA 1L9KA 4J0CA 2Q7XA 4GWKA 1DAMA 2J67A 4L4SA 1C0LA 5SV2A 1XWIA 2B6HA 3NUGA 3TW6A 3EY9A 4XSVA 4Q7QA 2CNWD 1N9GA 4LOJA 5CG1A 5ALQA 4L0MA 5FQOA 1FRVA 2Z83A 1DAIA 3PWSA 3ERCA 3ANYB 1WXQA 1Y9JA 3NT2A 4Q4JA 1RPJA 3IEPA 3GVPA 4N0QA 2YMMA 3HSSA 3INYA 1ULTA 2A33A 4B0PA 4ROSA 2J7PD 3E7FA 2CSXA 1VYUA 1U63A 4A15A 5B3KA 3WLIA 3AERB 5F1YA 4C43A 3VPXA 1IUOA 2CJXA 3DAPA 2VZLA 3AM4A 4HLNA 5F1OA 5ILGA 1X7ZB 2BI8A 3EG5A 4CG3A 3HO1A 1B00A 4PLYA 5T3YA 5FOTA 1Q44A 3WGIA 1KZ7B 3F73A 3I73A 1TOAA 2BF4A 3MG9A 1JHZA 2E37A 2E49A 2GFQA 2NSLA 2UZ1A 3A2LA 2OE2A 3DAYA 3TM4A 3MJ4A 2RKWA 2WMDA 3MINB 1PJTA 3SIPA 3T5CA 3R40A 1I24A 2DHCA 4X97A 3W5AA 1ZXLA 1M2FA 2FKNA 3EUFA 5LD2B 2QVXX 3CX7A 3AIIA 1ZOOA 2XTNA 2AGVA 3NVKI 1GAJA 2DQ4A 2W7TA 3BQ9A 5A5DA 4IFTA 1YOVB 4US1R 2VQEB 3BMQA 1I33A 2BEUB 4GWLA 1MC8A 4MTLA 3I3SR 1Z9BA 4I55A 4EARA 2EBFX 4OJTA 4OQDA 4URUR 4HDRA 3IA7A 1LDEA 3FCAA 5T6MA 4O4LB 3B6MA 2H2WA 2I8LA 5SICE 2GI4A 4P5EA 3FZQA 2X9VA 1RRGA 1IBRA 2IPAB 4KIWA 3N7AA 4Y1FA 5JCJA 5TRTA 4D98A 4Z4CA 4AM8A 3AWDA 5JROA 5MGBA 3ECSA 1ZUWA 5ENDA 3N5KA 3W5DA 3T06B 1XZQA 4KACA 3WKAA 4C4YA 4KHPB 1OVGA 1WMAA 2GF2A 4KQXA 4MRNA 3L1KA 4PNZA 5EJAA 4EB3A 4PC7A 4EF6A 4ZYLA 1EHCA 5K6AA 2GN1A 1M0EA 3TLMA 1PWHA 1ZG3A 3WK9A 1C3EA 1EZ4A 1A8HA 3K9BA 3H75A 1QYXA 4JEUA 3ZCVA 3Q6NA 1YS9A 2KW5A 1ZAKA 4K8OA 3EZ9A 5H1YA 3I9LA 2OOSA 4BLWA 1YR2A 3PDWA 2RAUA 3UMVA 4DV2B 5L45A 2Y93A 5LBUA 4D4IA 5KTSA 2V6IA 4XWGA 1YU6A 3ZWWA 1LPOA 4PX9A 5AUNB 4DJTA 3JAWA 1R9MA 2QY9A 3QH4A 3R7WB 4HLUA 3RNOA 5CX1A 5F7OA 2HIGA 2Q21A 1ZJ4A 3QPAA 4NOLA 1L4KA 2QVBA 4QDZA 4CU5A 5JNSA 2VCHA 1USKA 4RH3A 4DIBA 3L0ZA 4RJKA 1I2BA 1BX1A 5D5PA 3TQIA 5L4NA 4O0MA 4DMHA 3RUIA 5FRDA 4C9BA 1CP3A 1EFPB 3DV0B 4O4JB 4Q3CA 4XE5A 2JIQA 2HSEA 4NRDA 2UXCB 1G5RA 1E0JA 5C1IA 4QDJA 2OGZA 2O20A 3COWA 4QGAA 4DMKA 2HN9A 5FOUA 5BOSA 3O03A 1C8KA 1BDBA 2FZCA 1TB4A 2QMHA 1DG1G 2BMVA 2M2IA 2PU5A 3PR3A 4MS3A 4X8LA 1GPBA 1JHMA 3DZBA 3TIVA 5KTRA 3D3NA 5BVGA 4GGMX 4U7PB 1FDWA 1S2DA 3GU3A 1CUEA 4J4HA 4IQFA 4S1OA 3NYWA 3ZGXA 2H92A 5JAHA 1YDEA 1Z4OA 2IQ5A 3PGA1 2R00A 2BDTA 4C4AA 1QPGA 1A9QA 4GXRA 1ONSA 4DCUA 3MMSA 1ZHFA 3W3AH 1PK9A 3PF8A 1NJFA 2H0RA 2HCTA 4JI2B 1JKXA 1XPUA 2VYCA 3FSEA 2HJRA 4HWRA 3DE2X 2VUSA 4G5GA 4IJ5A 4GZ3A 3LBIA 5BSTA 1VFNA 4XWWA 2BTQA 1QE3A 1KVUA 2V3WA 1G9SA 1VPTA 5DEIA 4RZ2A 2I9PA 1EM6A 4GR4A 2ZUUA 1Q19A 2ZSUA 1GUBA 3AXSA 3MGAA 3TPFA 2MJLA 2AUNA 2XDWA 2NADA 2B2CA 2JW5A 1JWBB 1DDOA 3MAJA 2MT9A 3INNA 4BLUA 4QQRA 2NZVG 4K9NA 1A5AB 2WTEA 3SICE 1POWA 4ME6A 1O94A 4R9UC 2VDUE 5HIIA 5BSGA 1TKRA 3BJRA 3BERA 3RVKA 4ADSG 4GFDA 4P4SB 1KZ1A 3MBIA 1RI1A 3FSJX 2H0AA 1VCIA 4XSGA 2OVBA 1GTVA 4K9MA 3SHFA 4HWTA 1ZCJA 2PBRA 3AFIA 4OJQA 2C2BA 4OXQA 4RKYA 4UCQA 1NHGA 2UYGA 3R8FA 1QKIA 4DC9A 4QHTA 4QTZA 1DC8A 3PHIA 4EJMA 4ALMA 4ZKDA 4J16C 3Q2OA 5FXMA 2AZDA 1NLYA 1K66A 3Q72A 4C89A 1YFLA 4DR1B 1EX6A 1ZSVA 4F3CA 1U6KA 2HKIA 1R0BA 3L0IB 4PAGA 3VO1A 1CUCA 1IQUA 3KUXA 4IINA 2VXYA 4KQ1A 2FPLA 1EAYA 2VPIA 2VVTA 4NTZA 2C4MA 2C5SA 3RLFA 1E2DA 3DNPA 3NT5A 4WVFA 1NJ8A 1YZ3A 1RWBA 3ZGLA 1H3NA 2JVIA 3AKZA 1KMIY 1P0MA 3WK8A 3CLSC 3FTPA 2HHCA 3FWHA 4PHGA 2O50A 4PHCA 3O82A 2BTEA 4CM5A 1E8MA 1EVQA 3NOXA 3NEAA 4KGDA 5AHOA 5GMOA 5C7IO 4IZHA 3R9XA 4N0EA 4O4IB 1GTJ1 2EFYA 1XYGA 2NSHA 3HCWA 3E3OA 2JGMA 2LD4A 1SG9A 4RVUA 3LVBA 5B30A 4XGQA 1LWOA 1H69A 3T3HA 3IR7A 1GZUA 4HDKA 2NQTA 2VUTA 4P4TA 1KHHA 2IIQA 1WU8A 3A4YA 1Z2AA 3IALA 4RQAA 2VJDA 1CSEE 2CT8A 3W7AA 2ZRPA 1BE6A 4F45A 1U2ZA 3BMNB 3VZDA 4TVKA 4HZIA 3LYLA 4PFQA 2IVFA 3RRYA 3BF8A 4HF7A 4V0QA 2J30A 4FFNA 4G07A 1Y9ZA 1TKBA 1TVKA 3DDCA 3NIBA 5G1NA 2A7QA 3TOZA 3U37A 3A25A 4DLVA 4IDQA 4EF5A 1V1RA 2RC5A 3GFQA 4FU0A 1L1RA 1R16A 1DKUA 2HRDA 3MD0A 2X5XA 3FDIA 2R7MA 3Q11A 3Q7QA 3DZCA 1N2HA 1H1TA 3NKLA 3R8XA 3IILA 4YRFA 1RRFA 4JU9A 2XOKA 1U31A 1UMKA 3EQ9A 3HP7A 3R3UA 1MORA 1V6AA 5IK2A 5CXSA 3RUDA 1O08A 2C96A 2ODTX 3GBSA 4GMFA 1CUHA 1MC5A 5EGNA 5K3FB 5BVHA 2B8JA 1C4WA 1K0FA 2IPXA 1B43A 3PX2A 3AHGA 2VBGA 3HR4A 3PXAA 4X7RA 2KMLA 1VLMA 1Z45A 4RX1A 5EL0A 2DR3A 1T9KA 3ZZMA 2HMYB 2VDPB 2PO7A 1GFIA 3I32A 3G9TA 4BU1A 5IJ0A 1ISGA 1E3DA 2YC2C 3LNTA 4DA9A 5LZ7A 1M34E 4KQGA 4IGKA 3SKYA 2X4DA 2I6GA 2ZIFA 3IAUA 1W5SA 3PDIA 4BIIA 1CF4A 1SXPA 5DEOA 1MQAA 2VF2A 4LZZA 3KR2A 3DEJA 1QO0A 4FFWA 1QTRA 3ZU2A 1I9GA 4CV2A 3GCDA 1PW5A 5DSZA 3FDZA 3UMRA 2GVZC 4XTCS 4BMDA 4BNUA 3GPLA 2ANCA 2ON6A 4W8OA 3L9WA 5ESRA 1XXHE 4PX5A 1U8EA 4QOJA 2XVXA 3KSZO 4G65A 5HZKA 4OFBA 3L4BC 4RIHA 2ZIVB 5E9WA 4J9UE 3K1ZA 2GBLA 3KVNA 1T9DA 2GCOA 2PNJA 3P9CA 2QHXA 4G26A 2VSFA 1CQPA 4JLUA 1DT5A 1R64A 1V7ZA 2VQDA 1EFCA 1LZLA 1TVEA 2QWXA 3F46A 4C21A 1IPEA 4XWOA 1F2TA 4RFVA 1P61B 3AJ9A 3CEPB 3VPGA 3OWHA 2AXNA 4QBGB 2VZ0A 4WXEA 4EYOA 3SZOA 1Z0JA 3BC1A 4ZAFA 1AUVA 4HLCA 2CJWA 3ROEA 4D9EA 2P40A 3UFXB 2GO7A 4PPGA 2W70A 2BUAA 4WIAA 3CNLA 2VTEA 1VRCA 1FSSA 1H85A 2HQOA 2XMZA 5CLGA 3TECE 2NXJA 4Q4HB 2ZBEA 4WOPA 5GV8A 4UM9B 1R6UA 3JCZA 3NEPX 1EDOA 3GBPA 4JUAA 2FZLA 2IP1A 4NC9A 4EYEA 2Q3BA 3JD0A 3FTQA 4JA2A 4NESA 4BNKA 2WJ3A 1IVNA 1LEHA 2VDNB 1EHIA 2Q7DA 1DCFA 4OBXA 4CR8A 1QS0A 4ZCQA 4R0MA 3FCEA 3ZYZA 1E0DA 1TQ4A 4YFYA 4WBNB 1ZEMA 3MS2A 4AECA 3M4NA 2XE4A 5CYPA 2ODAA 4F4DA 1BROA 3OU6A 2H31A 1U0FA 2H17A 2WVJA 1QFZA 3EZ7A 4PGFA 4RXMA 3QWHA 1TE2A 1WLYA 3I9OA 4AJIA 2OSVA 3FTFA 3MRSA 3G5UA 1QIMA 2J3HA 3MILA 2R6CA 2ODBA 4KYIB 4WINA 1RW4A 2GJKA 4MW9A 2H4ZA 1L7EA 3WLTA 3KC2A 5FORA 4WNYA 3DOCA 3DUFB 1O6BA 2JGAA 4DNXA 4Z0TA 2OZVA 10MHA 1A4XA 4RA6B 5G2OA 1TAQA 2ZBGA 3W3AD 3BWMA 1P45A 2C2YA 3QU5A 4BP3A 4E09A 3AETA 5DYIA 4FGLA 4PC6A 1RP1A 2F3SA 5K8CA 2WFZA 3ZHUA 3A6ZA 4MR7B 3A31A 5CW2A 3W9YA 4YXFA 2BZGA 4KDEA 3FLAA 1GNTA 5D1NA 2P0AA 4REQB 1CRPA 4Z54A 5SYNA 1SBQA 1VE5A 2H6EA 1YK1A 5CA0B 2J3JA 2XTMA 1GWNA 1Z6TA 2P1DA 3PD0A 4XYMA 4E88A 1YR8A 1N2EA 3G8BA 4RL6A 4UUBA 3QNMA 1KOFA 4NCKA 5AK0A 2PTGA 3RH0A 4YT2A 1JN0A 1M1YB 1FP1D 5F77A 3TBFA 1SVLA 2IHYA 3P97A 3ZVLA 5KS2A 2IS2A 1NW4A 4J1TC 5D01A 2OK7A 2PIAA 1KU6A 4MKHA 3SK0A 5LOVB 5EVCA 1KYQA 1NPTO 2BUBA 3GARA 1QGAA 3LCMA 1CYDA 5DN9A 4AFNA 3ILHA 2FXVA 5C1PA 1MOSA 5FLXA 3KSBC 4I14A 1ZGZA 4CEJA 2C84A 2HCRA 2XGJA 2CLIB 2BBWA 3UAVA 4CJXA 4UHBA 1T2FA 3HMQA 1BJTA 1QH1B 1J8DA 4OA8A 3MWEB 4WBSA 1EP3B 3PYMA 3KFLA 3WRWA 4GGPA 3S8YA 3NATA 1Y9EA 1RMQA 721PA 1RQ7A 4LCJA 3KPVA 4C05A 5DXJA 1DJOA 4HH0A 5CLHA 1GOTA 2JASA 3LBYA 3NH6A 2IHTA 5A9TA 2LKDA 1OWPA 3LQQA 3FBWA 1G21B 2H9IA 3EZYA 4JQSA 4CM8A 4D4KA 1DBPA 1RZRD 3ZKWA 4KWHA 2YL2A 1WHTA 1AXRA 1KK2A 3U26A 2QTTA 3QEBZ 2EZ9A 3L05A 4MKIA 4HFMA 3T4PA 2O8NA 4OLAA 3KSRA 4P36A 1NVDA 3P9YA 2CMKA 4IILA 4E2FA 5AW0A 3ASZA 3L9XA 4FLFA 3A1CA 4ZCPA 1V71A 4U9IS 1ZC4A 1KSJA 4QGSA 3JQDA 2CWDA 2QI9C 1ELOA 3K70B 2WAXA 2D0PB 3FRHA 1Y98A 3HI4A 2OWEA 2A9JA 2R5NA 1MQ8B 2W2KA 4C0WA 5A4MS 1KAMA 4XJSA 5FTWA 4RH1A 1TEZA 1EI9A 2NNLD 1HFWA 2NSDA 4TSFD 3ZVRA 2O2XA 2O8DA 1NTOA 3QLUA 4IDEA 5BSKA 4Y2VA 3VPBA 5B7NA 3H9GA 2XA2A 2HA5A 4IJMA 4WOBA 5E38A 1NXPA 2EWMA 3JQFA 3UOAB 3A3PA 1QU2A 4KLCA 5KBYA 2HRCA 1ID1A 5B6PA 3IPCA 4R8RA 2JVJA 4C78A 1JEYA 3PDJA 1E8NA 4NWIA 3VU1A 3AM3A 4TMWA 4HPXB 4BLTA 1F17A 2EAUA 4BWYA 4YQYA 2PIDA 2QRLA 2IDMA 1H66A 1SAYA 2PYDA 4XA8A 3RIYA 1Y7PA 4CM9A 3P9SA 4QU8A 4BNDA 5EZYB 3EC7A 5L7YA 4A27A 1I13A 1LTKA 2XQIA 3VDNB 5ICFA 1R7RA 4Y6QA 1URPA 3JQQA 4UD6A 1DUVG 1XT6A 4K6OA 4Y6OA 2AYXA 2GILA 3KXKA 3LS2A 2F8MA 4OAQA 2CD9A 3ZXYA 1OTYA 3JWEA 4YDQA 1AS2A 2KB0A 2LIPA 1NU6A 2OQRA 4TROA 1O4VA 2LNDA 4LF4B 2H4YA 1VKJA 4BQEA 4I6JA 3CGWA 4Z8XA 4MQ4A 1XLUA 1LY1A 2R0QC 2AOXA 3I9V6 1MEJA 4GPBA 5H9WA 3CNEA 2E55A 2QTCA 4NI5A 2ZR7A 4K3UA 3EGVA 1DG9A 2ZITA 4D80A 4EENA 3DPSA 5H3LA 1LBIA 4DYVA 1CV2A 2YNMC 6ADHA 3PHCA 4KDFA 4HEA6 1F8GA 2Q5CA 4TSKA 3AF0A 3I8XA 1UP6A 2F3UA 2ORED 4UBNA 2EBWA 3A4IA 1N0UA 1KJZA 1YHNA 3LQ4A 4I9UA 3OOEA 1J8QA 1E0KA 3MIIA 1CVLA 1NJGA 3OA0A 3WHIA 4RZSA 1JWLA 3K0HA 1E2KA 4L0CA 2BN4A 1A82A 1YFZA 2OAP1 3JARA 1JHQA 4F2PA 4MO2A 2FAXA 4WXPA 5J4KA 6REQA 3ADBA 2XJ4A 2VT6A 4OXNA 2HXYA 3A1TA 4ZMBA 2XVAA 4LHVA 4UVDA 4JMLA 1KRWA 5HCNA 3FOAA 4NH0A 3SX4A 1XYVA 2W8BA 3I09A 4M53A 2YXLA 3ZNPA 4D9NA 1L6RA 2HSDA 5ALHA 2V7TA 3RVBA 4HUTA 1WIWA 1XVVA 4DSAA 1YI0A 4R2WA 1ZOSA 1DTWA 4QVGA 2UYOA 2YFHA 1J5XA 1OYYA 4K9RA 5KUTA 2Q2OA 2GASA 2Y8EA 3HJNA 3FUWA 3PFNA 4OQ4A 1C7EA 4LVCA 1OFVA 3U7EB 1C3OA 1ECFA 2H11A 3C7TA 4R9VA 2C9BA 5K4HA 2XCQA 1A2KC 1YWGO 4J7AA 3AR7A 1FXUA 1VKNA 1GVNB 1XRRA 4EG8A 3TOXA 2OHGA 3I9NA 3UAGA 3BIXA 2YW2A 3JY6A 5CNMA 2Z8YA 3M9WA 2QJOA 1F1JA 3GP5A 3RD5A 5BWLA 1HTBA 2HRRA 2Q5EA 4GLLA 4KFTA 4XEUA 1PJ4A 3Q10A 3E18A 3D6AA 1CZOA 1BE8A 1Y1KE 2VHTA 1IWOA 1UAGA 3DO8A 2C3PA 5B1SA 5C7YA 1O8BA 1EJ0A 1OXVA 3ZTWA 1T4GA 2DB3A 4TKUB 4JC8A 3AEUA 3T3GA 3CSSA 3VI4B 1HSZA 1P39A 2JGKA 4FFBA 1QH8B 3CM0A 3MSCA 3DG9A 1MUUA 2PKEA 5DYYA 2E4ZA 2RJ3A 3G2KA 3BWVA 5DLPA 2GKOA 2PWAA 4I0WB 2CKDA 1FFEA 1Q2XA 2MSEB 3THRA 4RDIA 2P9BA 4ZVNA 4ER6A 3RF6A 5BXYA 3EF1A 2N9UA 2WUEA 3X43A 4NVRA 1I4OA 2V7QD 2G1AA 3L6RA 1JIVA 2IE0A 1A2QA 1GRNA 2EATA 4RJIA 4Y9RA 1B8OA 3N2YA 1EUCA 1P5JA 1YMUA 1RM5A 3ILVA 3BRWA 3LUHA 3LXRA 4FNGA 4L0QA 4CMEA 1LS1A 1CQIA 3WNVA 2K4MA 4IQ4A 2RHWA 2W6ID 1JT2A 3FNRA 1YQGA 5DP2A 1KJNA 5LD2C 4CQMD 2H59A 2UUCB 2VOJA 1OOEA 2YC4C 3BRQA 4HAZA 4XB1A 2QTLA 5L3SA 2WOOA 3LLVA 4RZ3A 1TQ2A 1KTVA 2FJPA 4KIGA 2O2CA 1QHYA 1VFPA 2O07A 3GAAA 2QUBA 3L5KA 1ETUA 2ACVA 3M83A 4U7TB 4IEEA 3GGSA 4BQRA 2JFGA 2QD1A 4U5XA 3UHJA 2A3RA 2K7ZA 4IY1A 1XTIA 2Z6VA 5TQ0B 4FB4A 4JI0B 2C3OA 2WF8A 3EAQA 2ID4A 3DTNA 2AN5A 1OFUA 2HTFA 1DAHA 2QN1A 3FGNA 3FRJA 3QUTA 3KQOA 4G1UC 1F5SA 3UBMA 2HYIC 5K0TA 1N92A 2RHLA 1C1HA 3BXHA 4GDMA 2O3SA 4GMHA 4OSPA 3U5TA 4DXAA 1SZJG 1UXGA 1QRUA 2ZAYA 3G02A 3MA0A 3BHMA 2DVMA 1OAAA 2PRSA 3QEJA 4ZI5A 1XCOA 3ODGA 1Z39A 4HAUA 1CEQA 1VMIA 5E7IA 1SN7A 4FOSA 3UMFA 1Z22A 1UZAA 3O73A 1HUQA 1M1NA 2C57A 1OIVA 3QWIA 5FD8A 3T7EA 1H2WA 3ACCA 2P69A 3AOEC 1O96B 1XDWA 2BFDB 2QX4A 2UDPA 3OMLA 3GLHE 3HP4A 4YJFB 1MXHA 5I7UA 2Z3ZA 1ARZA 4KXLA 3ONVA 4IJVA 3AYZB 4B4OA 4DDVA 3ET4A 5AVQA 1NIJA 2R84A 3EH2A 4BATA 1VG8A 3N1UA 5EN4A 4EKGA 1UWKA 3D3QA 5TF4A 2AJLI 1FIUA 3GRYA 1CR6A 1Q1QA 2I7XA 3MELA 5D3ZA 2P4SA 2GZ3A 2Z5VA 3CW8X 2NZUG 2XVMA 2PD3A 2ZDGA 3KEMA 3EWSA 4KH1A 5L3ZA 3UA4A 2EZ4A 1FRZA 3FPHA 1YC2A 1JIKA 1M8FA 2Z2XA 2W2NA 3S29A 1WB4A 2LDBA 1QO7A 1K89A 1B6GA 5BQ3A 3U4IA 4BQOA 2HQ1A 1PRYA 2DBRA 3IOBA 4LJ8A 1KMHB 5I7AA 5A3QA 3UJ6A 1X7XB 1JDTA 4TLCA 3IAM6 1GP2A 3KOYA 1AE1A 1F3LA 3AESA 3DOFA 4M99A 2J0VA 4LGYA 2C2KA 2OGWA 2QLJA 3WYEA 1AQYA 4MLPA 4UNSA 2XOKD 2XWQA 3A26A 3N3BC 2GUWA 4DG9A 2J9XB 4AL4A 4EA8A 1KWGA 1NQUA 2HSJA 2WU1A 4MR9A 3V4OA 3VZSA 4M7WA 1KXZA 3Q85A 2PZBA 3SDZA 3D8HA 4RY9A 2A0UA 4F85A 1Z75A 1K1EA 2YYYA 4KZKA 3T7CA 1XZIA 4C0BA 4DM3A 1S02A 3I4FA 3WB0A 2VXBA 3DCYA 3WYBA 1E2BA 2QXUA 4G8CA 2I87A 1B1CA 1CJKC 3KX2A 4Z53A 3UWDA 2Q5FA 5KYUA 2SECE 2HREA 5B3LA 5KNDH 1IN4A 3J7TA 3EB9A 3UMMA 3I2JA 4MI9A 3VHLB 2DLNA 1ODIA 1IN8A 1XEXB 2PLRA 3MT7A 2XD4A 3M5WA 5AUPB 5B2EA 4AY3A 1QO0D 2FRVA 3N07A 3CH6A 2VSXA 3D0RA 4X1KB 1VLZA 1SC4A 4YRZA 3TTYA 2QG4A 3TTUA 1WX1A 4JJZA 3WLKX 1C9EA 3E9RA 4I08A 4K6KA 4PZ0A 1LJ8A 3ZJTA 4H15A 1W1IA 3E81A 4QE3A 1JQDA 1J5PA 3T9AA 2R1UA 5FI0B 3X1JA 1RXIA 2CNLA 1DKLA 1T29A 1YJAA 2X5KO 1K0UA 2NVUA 2ZG6A 3LWBA 4I4TF 3A6DA 3OQ6A 2AR0A 3D4IA 1F48A 4E22A 3P0EA 2A92A 2IYTA 4ICIA 1T6NA 2AEMA 2M6RA 3ORQA 3DFUA 2JFFA 3HWX1 4J29A 3VGJA 2OECA 4ZOLF 5ARCA 4EX6A 1E9DA 5BUZA 3IEVA 5YASA 5TS3A 2H1LA 1KI2A 2WWTA 2YINC 3N8GA 2B30A 1DV1A 1W5EA 2GAJA 2NPOA 2XMDA 4QFDA 4EJSB 5I7RA 5JOQA 1T35A 1VBNA 3EARA 4ND8B 2VF7A 4OQPA 3KU1A 1CT9A 1QLWA 1YIDA 5KREA 4YRSA 1FVOA 1G3IA 3WDKA 1PW7A 3OIFA 1Q7CA 2XXAB 2Q3FA 1D2RA 3F2IA 3IB6A 3ITDA 3GLGE 1JPJA 2HU8A 1ISHA 1VYTA 2X4GA 4MIKA 3BZUA 1E3TA 2AHOA 1QX4A 3ZHBA 1B6RA 1GGVA 1A4RA 2C5LA 1JDNA 2FLVA 3EDRA 3FETA 3KAKA 3H1FA 4ITUA 3PC8C 4YECA 3ZY6A 2BMAA 1B16A 2X58A 4MJXA 1CUBA 1U7WA 4UEQA 3RBAA 3NC1C 1FMCA 4KE9A 4BTEA 4I1PA 3O4JA 1CRQA 1VLVA 3BWXA 1KO7A 1OX5A 3H1BA 4LJAA 4LXGA 1QAMA 2VSYA 4LYGA 3ZY3A 3RYHA 4PG5A 1G5HA 2JD1A 3I76A 3Q15C 5CDHA 1Z34A 1LI4A 4ND5A 2YBEA 5CK4A 2XWJI 4J1QA 5CXXA 4EYGA 4OHYA 1J8FA 4QQNA 5FEMA 1QDEA 1H8ED 3H6HA 5WRFA 1BVYF 3OM0A 1RJFA 4LK3A 3X1ZA 2BM0A 1V6SA 3CMCO 1WPGA 1Z0KA 2DUJA 2AX4A 1UIMA 4MA4A 4L08A 5ULLA 4ZO9A 4N47A 1J8YF 5A1JA 4MRAA 1AO0A 4C08A 3GEPA 3KE8A 3KOWA 4JV5B 3W8NA 1XQYA 3HUDA 4N5NA 1XKTA 1A0OA 4EHNA 4ZEWA 3QW2A 1Y80A 2A9QA 2OCAA 4M1EA 2XR1A 4OHPA 4YAIA 3ZLJA 4E32A 2PMEA 2HHLA 5K8IA 2XB4A 4L3OA 1SQ0A 2FPPB 2VDQB 4K6GA 4G9EA 4LTMA 1W4RA 3WIBA 2VH5R 4I4TA 5G4KB 1GAXA 3H13A 4C0KA 4RPHA 4D82A 1H4QA 2AB0A 1G8YA 1ZNWA 1FNSA 2O0KA 3IH5A 1ILWA 3UUFA 3VKVA 5AM4A 5SZJA 1XUOA 2QF7A 5MDHA 3QUQA 4X65B 4ZOLA 3ZDCA 1BHSA 3V4VB 1TO1E 2AWNA 4B4KA 2F9LA 2OBYA 1G7TA 1J9GA 3EXG1 4UBLA 3LP8A 1NUQA 3OLYA 4E5SA 4F60A 4GYJA 4US2R 2EC5A 1XEAA 3V1TC 1X8KA 5DIFA 2I6FA 2H4XA 2OO5C 1AGRA 5TSDA 5B64A 4K6CA 2B9VA 1BRMA 1P7ZA 2Q3EA 3KP1A 4UM8B 1D2MA 4ZEOA 2MMCA 3NBUA 5GP1A 4CLRB 1PNVA 1VECA 2CHQA 3QV1A 1WBDA 2ZRGA 4ZOAA 1RI3A 2QD2A 3VNSA 3ZE7A 1SU7A 2OBLA 2JJQA 2C0PA 3TQOA 4DLNA 2XXJA 5K0NA 1UBRS 3W5SA 1DBWA 3PFBA 1Y6GA 3DDUA 4EHDA 4H1WA 3V6LA 3FUCA 1WWKA 1GNLA 2O05A 4PLTA 1P1JA 1TMKA 2VXOA 5EIWA 2Z58A 1QZ3A 2EWWA 4RUKA 1CY4A 1JBKA 3D2AA 1HDRA 4B4WA 4ENRA 4TN5A 2EW1A 2EYQA 2Q2NA 4TUYB 4EF4A 4A91A 3WVNA 1P81A 1ND5A 1R6VA 1U3TA 2JFUA 2PQ6A 3PQEA 4YUZA 1GM5A 2IYPA 3FBGA 3K0KA 3N39C 4P7FA 1P2VA 2Y4NA 2AOUB 3TTTA 4TZKA 4WJZA 3VVCA 1ZCZA 5KTNA 2P2LA 1IXZA 3JWGA 4MCAA 4YCNA 1T9HA 4GHWA 1X86B 4ZQFA 2FWAA 3WK6A 4BKPA 1VZ3A 2NQ2C 2RAVA 1YJ5A 4UZEA 1G8HA 2OPHA 3PT5A 2FMUA 4ARAA 3I34X 4ALNA 4MS1B 2CHGA 4G1FA 4NFYA 5FBLB 4HR7A 1W88A 2AS0A 2YWFA 4N8SA 4LMAA 5K0CA 1HH4A 4X71A 4HNTA 2YJ5A 1GKKA 1PFQA 2ZJ6A 2PMWB 4LBWA 5JWOA 3L1HA 1MVLA 3G6KA 3F9CA 5IDWA 1EFKA 4MV0A 2GHQA 2RHCA 2YRXA 4IDNA 3AO0B 3IVGA 3VO2A 4MDFA 2Q6KA 4D1YA 1QMGA 2C8JA 2HLHA 4KKVA 3LUJA 5KTYA 2X15A 2ZETA 1G2OA 1LF0A 5CW1A 1GA6A 1E61A 1Y3FE 3HYNA 4H31A 4JNCA 4DIOA 4WESA 4YRRA 2DGDA 1W6UA 4JB8A 3COVA 2WK1A 3KETA 3BKXA 3OY2A 4RESA 4D3YA 3HC7A 3T54A 1U9JA 3H8SA 1ORIA 1X1SA 4RS4A 3IGFA 3KQWA 5AJWA 4CM9D 4EY7A 1P60A 4UNNA 1GGEA 4DNFA 1Q0PA 2DP4E 4LWOA 4OB7A 4XRRA 4QYWA 2NQ8A 1PYDA 4D46A 4RKEA 3D7KA 4ZCMA 3IAFA 3DEYX 3B38A 1V5FA 3HYTA 3KDSE 2Z4TA 3ZHCA 5IULC 3AF4A 3WGMA 2WU3A 3NYQA 1OB2A 1ZC3A 1KHTA 2H4FA 2Z98A 4PPQA 2UXBB 4MA0A 4FIZA 2VAWA 2BD0A 1M8GA 3L1JA 4RMHA 5CFPA 2HFKA 3FWKA 2JF0A 2PBLA 3BXFA 4JLSA 5FTNA 3TZCA 2WKRA 1YVUA 2XNHA 3RHFA 5KWIA 3TD6A 4W6QA 2I2XB 2R65A 3NORA 1JEDA 1XNGA 2OG2A 3P4XA 4UEJA 3ZJVA 1JAZA 2DJ5A 2IUUA 1LA2A 2CBGA 2HV9A 3AW8A 5EQDA 3O95A 1ILEA 4A2PA 3F5SA 2PRKA 4TT3D 3QK7A 2Q41A 3GXBA 3H1TA 1W4BA 2G9QA 1OI4A 3ZHSA 2ZTVA 1RQLA 3E8MA 2R8XA 5AJXA 2Q6TA 3E03A 3CLHA 4M0MA 2WB2A 2CB9A 3C3WA 3QKUA 5EUCA 4HH3C 2XUOA 3C7DB 1U2GA 4XUDA 3IPXA 3I28A 4QBFA 3TCXB 1QF6A 4MPPA 4LMRA 3DZ8A 3UUEA 1WJGA 1Y48E 1I2DA 2ZIZA 3OIYA 1QIJA 4MVJI 1WETA 5DJ5A 1UQRA 2HR1A 4YIKA 5FYQA 1EUDA 1R18A 1W8DA 2F9FA 2GRAA 4Z7JA 5J2UB 1VB5A 1VCNA 3CONA 2V8OA 1U2DC 2A9FA 1P3DA 3PSAA 4IEIA 3ZWPA 3DDHA 4BNXA 5IMBA 3AUXA 3LKDA 4LZJA 4NPAA 3WSWA 2JFQA 4ZDWA 2X7JA 4OV6B 3VAZA 3LCJA 1W87A 3A05A 5T5QA 3V3TA 4OYRA 4B87A 2WWYA 1MCZA 1K4YA 3U7JA 2BGRA 1PFUA 3GNSA 1OYVA 3KDAA 4NYIR 5G1OA 1P3Y1 2JZCA 3ITNA 4ARBA 1A69A 2H16A 2FEPA 1JR3D 2OKGA 4UE3S 4ZPXA 4ZHQB 5AVSA 1MQSA 3BD9A 2AUMA 3O4RA 4FMCB 1QLHA 2C3YA 4MKXA 4EFNA 2PD6A 1B3BA 2P1RA 5IM4F 2JLRA 4K0KB 3PGJA 1YRHA 1O97C 1Q0SA 1V4BA 5AKLA 4CF6A 1U9IA 3PFHA 1UPFA 3PI7A 1QQ7A 4FGSA 3ZHQA 1HKHA 2J5RA 1R0YA 3IUBA 1MG0A 2WHXA 4WT7A 5DNWA 1H9CA 4MP8A 4DDUA 1SULA 3EGDB 5KQRA 3MW8A 1M34B 1BE0A 4FUTA 1ZHOA 5HG0A 4Y9UA 4UATA 3AJRA 1SKUA 1WQ1R 1WUTA 2ZAMA 3WRXA 5JJBA 3P0JA 3X2SA 4Q9JA 1K6XA 2PX6A 3PEVA 2QZJA 1ZH6A 4AY5A 4ITVA 4M8SA 4BHTA 1HSOA 1TMGE 2P3QA 3LOQA 4FC6A 1CHDA 3MWGA 3E5HA 4GMKA 3RFFA 4AZSA 1LBEA 3IDAA 3QITA 1YBFA 3AR8A 3CH5A 3N0WA 5HKAA 1UAAA 1GGKA 3F4BA 3RIHA 5CH5A 2NTNA 4OVKA 3T95A 1YQWA 2DOKA 1AXGA 4FYWA 5IH7A 3MCZA 2AFIE 1FF9A 4U39A 1XGKA 5C9ZA 1S01A 4OHWA 5HIMA 5DWVA 2NYUA 1P4AA 1RSZA 2AL7A 4J0EA 4JUFA 3ZZUA 5G1PA 2DSNA 3W8RA 4LF8B 1VLLA 1BWRA 1NBOA 3WLQA 5HOQA 4FMBB 4XCXA 2RGNA 3MOSA 3PIRA 2E87A 3EXHB 3OI7A 1OLSB 5E4JA 2ZE7A 4WNIA 3W8FA 3RO7A 2PSHA 2R96A 3IMEA 3WNQA 3R3VA 3HKBA 3AFNA 4Y7DA 4JOBA 4P0PB 1SC9A 4JH0A 2P0YA 5JC8A 2BC9A 1HE8B 4GKKB 2PVSA 1KE1A 4QRDA 5A4DA 1S2GA 2JIBA 1T36B 1U3UA 2CDAA 2XWSA 3NBYC 1M67A 1GKLA 4JT8A 3ETJA 1BU8A 2QK4A 1NUSA 2VYVD 3EISA 3O75A 4FMDB 3TPCA 3KPWA 1HORA 5IM4A 5AKKA 3GUHA 1D6NA 4BNGA 1P9NA 1UPUA 1Q7RA 1UJMA 4P0TA 1T5SA 4JEMA 1AUQA 3E22B 3L07A 1E3MA 4JGBA 4EDHA 4EYQA 1P18A 4OM7A 3BBLA 3D64A 4BRWA 4O3FA 3LECA 3G49A 3PJGA 3EODA 5FFFA 4CT4B 5C80A 1BXKA 4RD6A 4CKEB 1Q1ZA 3R6GA 3T41A 1L4UA 2BCGY 1CNFA 3PITA 3T35A 5ALDA 4PYJA 1D3AA 3GEDA 4EM6A 2J45A 2BGGA 1N8TA 1EBUA 1LTHR 3F47A 3OPVA 1U02A 3PX7A 1JVNA 3NX4A 1YQUA 3LC2O 4OYLA 4DARA 2BGWA 2XH8A 2AG5A 4L6CA 4B4DA 1YZGA 1YZTA 1SUFA 1PZXA 2A0XA 4HFNA 5JAMA 3U4QA 4W5NA 2HXGA 2FPMA 5C3UA 2AF3C 1TT5A 2QD5A 1CY0A 2FF7A 1ZVMA 2XCRB 2I3GA 4TV8B 2QRMA 2GN2A 1JJFA 2PKXA 3P0FA 4C5BA 3O3OB 5C4IA 2Q8QA 4N41A 2ECFA 2V7PA 2IV7A 1I4TD 3LVRE 2RDMA 2JC3A 1M2WA 2R1TA 4M1TA 4ZT5A 3PXUA 3ENQA 5LZ8A 3RYIA 2ZZKA 1E6MA 4PZDA 4LA4A 2Q0XA 4AW9A 1J24A 4KPYA 2FCRA 3HU5A 3O5AA 2X77A 1E7SA 1TJ5A 3SVLA 3DBRA 1DHTA 2EFCB 4QJ3A 4DAOA 4NZNA 3AM5A 3WLRA 4BMCA 5B36A 1CUIA 1RAGA 3UKOA 3SEFA 3QBJA 1JJBA 4LX8A 4OJMX 5CVUA 3FTNA 5KX5B 2OORA 1YR9A 3E27A 1AN9A 4KRFA 3NIWA 2QL6A 1BCSB 2WIKA 1QHEA 3B7PA 4PYMA 5JZ9A 1UH5A 4EGCB 1GUFA 2VNJA 4HGZA 5MFPA 5EI5A 3U44B 1X15A 2JRLA 2YFYA 4C20A 3VVMA 4E03A 4G41A 2X0DA 1FLNA 2O2ZA 3LC1O 3EJ6A 8ADHA 1R12A 2WG1A 2G4VA 4YAWA 2ID9A 3UF0A 3I0NA 3DMNA 4LNHA 4H18A 3V00A 3DOIA 1C1DB 3CBQA 2WABA 4G5SA 1GZSA 2FUKA 2ZB2A 3EA4A 4G3XA 5DPMA 3FVTA 5EKXA 1F2DA 4D0RA 4DLZA 4E5DA 2UVQA 3AR3A 5D2CA 2O8CB 1D4AA 1R4NB 2GWRA 2CCJA 5HXAA 4K05A 3L6DA 1CZLA 4HGOA 2AW5A 7ABPA 1XD2A 4K0RA 4J91A 2WYUA 4FFVA 4ZTZB 4GDFA 4CLHA 1V5WA 3LPNA 2I22A 3HBNA 3EXG2 5JCZA 5TT0A 1YDGA 4ZCSA 2IWHA 4YRMA 1ESNA 2R8BA 3B8EA 3EGIA 4RE5A 2ISSD 1E9VA 3O38A 4I9FA 2FQQA 4AWBA 2ZR9A 1XEWY 3C5WP 5AKYA 3WA6A 4TLAA 3OFNA 3OTQA 4HYEA 2D8MA 4HDMA 3OM9A 2I4LA 1A5SB 2XOXA 1HYGA 1DBRA 2ZVQX 2XBLA 1Z0UA 2OLEA 3LT0A 2QVGA 1IC6A 2VZEA 5EP4A 1FDVA 4DVJA 5JAUA 3JVEA 2YWCA 5HR5A 2ZJ5A 1SEPA 1UBGA 3LL4A 2ZSEA 1O3YA 5E7MA 2O7SA 3FYTA 3ONNA 1QVZA 3GJYA 4BNZA 4H27A 3PHGA 2VPWA 3DKPA 3L4SO 2FX2A 4JSTA 5AVUA 4V0SA 1BYIA 1M6VA 1UBMS 1ZIXA 3JQ8B 3EC2A 3RHZA 3D8NA 1BEUB 5CD1A 2G1JA 2W6PA 3ET5A 3VKFA 1E2PA 2GK3A 1KAEA 4IV0A 3PJDA 1A9XB 4A2WA 5JY1A 1C1XA 1QGED 2WPDA 4WASA 5BW6B 4OG2A 1XWWA 2EFEB 1UBKS 2H1IA 3IRVA 3K0AA 4S24A 1NF9A 4IWXA 3E0XA 5IWCA 2NZYA 3I58A 1QM5A 1ZVKA 2NPIA 4RQUA 4XCVA 2RD2A 1H05A 2LBPA 2O2DA 3F6RA 1BX0A 1VGVA 2EWVA 3EWAA 3OUUA 5BRJA 4OJYA 4TXLA 3OJWA 3EVZA 4JC5A 2NWQA 5HMMA 4L4YA 3WXBA 4R9SA 3A1VA 4JBLA 4RHXA 1Q21A 3MM4A 4RJJA 4GOKA 5DXAA 4IGFA 3AVQA 2DT5A 2ZROA 1NXSA 2V1XA 4QJBA 4WERA 3VOAA 1IHUA 5HOEA 7REQA 1NNEA 4IOMA 4HT3B 3L6BA 3P2MA 2ZIAA 4MRVA 2C1EA 4PR3A 4BVFA 4CTMA 5GINE 3NHZA 1RJWA 1CG6A 2B36A 3NXSA 4MA5A 2BISA 1IM8A 5TDHA 4ZJZA 4AJNA 2VJKA 4K1LA 4WZ6A 3SM9A 2G9UA 2WYIA 4PIVA 1WB9A 2IYUA 4GLJA 3AEQA 3SF0A 4YHBA 4M2LA 1KJJA 1MJGA 1C3JA 1ML3A 1NF8A 1XZDA 2CFSA 1NYQA 3P94A 4EK9A 3WKCA 3THWA 4YCBA 1K3UB 3GNLA 1KEEA 3UW3A 1Q6ZA 3K0FB 2GPBA 1GUZA 3LC7O 4ZVOA 4EZEA 2GARA 4ZOBA 1UPBA 1FE8A 3BCHA 1MH1A 3ORHA 1QQBA 2VLIA 3JASB 3DS8A 2Z09A 4HDSA 5GJWC 3OE1A 2QRZA 4J8PA 4PCUA 1KWKA 4DLXA 4XIYA 2X22A 5EZ5A 3ANTA 2YVQA 2V55B 3K9HA 3TSWA 4G9GA 4LJSA 3UA3A 2PBZA 1L5MA 1PDVA 2AXPA 4N3GA 5GADl 5JSFA 4RWZA 4BFSA 3R5HA 5E8RA 3MC1A 1EQAA 3IJRA 3OCWA 3K8QA 4HDQB 4KXWA 1FZTA 1UC8A 3I5YA 3AB7A 2EBHX 1F2UA 1J42A 1EX7A 3FUUA 4GQAA 1ACMA 5JSHA 3SDBA 3BSFA 4FVTA 5T4FA 4M37A 4XLTA 4F72A 4CMAA 4EJSC 3QKSB 3E2PA 2GSWA 3GX1A 1XKXA 4FNAA 1T4CA 2FDXA 2XV1A 3QUAA 3TPZA 1XMQB 1KKMA 4JVNA 1HG1A 4BECA 4KSCA 1O77A 5CT9A 2IH2A 2JCVA 2P5UA 4NDZA 3T3IA 3R3WA 5LXTF 5LVAA 3Q7PA 1OMOA 2BL4A 3LE8A 1OBVA 4FE3A 4PNPA 4LVOA 9MHTA 3KPUA 1YB4A 2NIPA 3L8CA 2RMKA 4C0HA 4D45A 3AU9A 1J2JA 2XWPA 3H9JA 1M2KA 3VJKA 3SPXA 1C9DB 1VKOA 2FRDC 3C5HA 1ISRA 5FUBA 2IFTA 3FYSA 4CT0A 2HLDA 1PT8A 1R0LA 2ZWPA 2HM7A 3G3EA 5C1BA 4IP0A 1Y6FA 4O25A 1NBWB 5FV7A 3KTAB 1NRXA 2XJ9A 2CMFA 4IVPA 4F84A 1RE1A 5AW6A 1PG2A 4FYKA 2ZJBA 3ROKA 1JHPA 3TL3A 4D42A 1JL3A 1HRKA 1RBZA 4Y2TA 2CN1A 1ZI6A 2D0DA 1JQ3A 1E2GA 3TQFA 4LV5B 1KH1A 4TV9F 3OPYB 1DP4A 1TM3E 2Q5IA 3MMPA 4GL4A 1QZUA 4QASA 1C9NA 3MWJA 1D0SA 4JJFA 1J8MF 3COYA 1I01A 4U6SA 2WNHA 2N46A 5JWRA 1HYEA 4IHJF 3CUSA 5TPZA 5B4TA 4E1VA 3M1YA 4WHMA 3EIOA 2G07A 4DWWA 3PV0A 1XLTA 4M9SA 4YQEA 2WDZA 4A8JB 4CFZA 2VOEA 2NVBA 4XR4A 4LC9A 3HADA 4EY5A 5AQ1A 1YJBA 2DE0X 4R8VA 5DGXA 2RE8A 3M4YA 3ZXSA 3QUSA 3G8CA 3WR5A 1ZVJA 1R6BX 4PTZA 1KPIA 3R3XA 2UU9B 1ZM9A 3QU9A 4PO1A 4MV8A 2GF9A 3OFVA 5C7OO 1VL1A 1FQJA 2IF0A 2W43A 3CZRA 2X9NA 4NKRA 5EGSA 4BV9A 3DZGA 4FCWA 3RR2A 1QR2A 3OT1B 4D0LB 2JG3A 4OJNA 4WN9B 1JLMA 3M81A 4ITRC 1U8AA 1P9WA 5G40A 3KJGA 1L7BA 3EN0A 3CPEA 4GMGA 4B9AA 4RPIA 1TLLA 1AUPA 3ZWAA 4NJEB 1MVNA 3V7FA 3GLHB 1KP9A 4MLZA 4PS0A 4RDHA 4EPTA 4RKQA 5JFOA 3ZOKA 5NLLA 3NM4A 5LXTA 3PGVA 3C3CA 4OF4A 1NN0A 3FHCB 3O8CA 3AVTA 2CNKA 5EXSA 2F1HA 4WGGA 3I52A 1SCIA 2WVGA 2TSYB 3I64A 4U02A 4CLOB 1FDSA 5DM0A 3F7TA 5FNVB 5HRUA 1E60A 2XWBF 4HLDA 2PUAA 2QQ0A 3DB2A 1OY1A 1X7WA 3TZLA 3R44A 4LHZA 2XRMA 3GUVA 5JS2A 2ZIXA 1ODLA 1RWWA 4KXUA 3IHLA 1OH8A 2VPTA 4RGBA 4MI1A 4GKVA 1GZ5A 3DFKA 1PJSA 2IX9A 1VIYA 1W6RA 3M2TA 4ZWNA 3RSCA 3DVSX 3EGCA 2FFHA 5D85A 3IV6A 5FB3A 3VAAA 2A67A 1Z15A 4TV9A 1L7NA 5BWCA 1I14A 3GEEA 3GJ0A 4WUTA 1E4VA 4ND4A 1UM9B 2SCUB 1XG5A 3IULA 4XWAA 1JDJA 5KYWA 2ZZMA 1PZFA 4AJOA 4Q9HA 4UTOA 3TL6A 1NKTA 2FW1A 5BV1A 2CV0A 4ZVRA 2HF8A 4IHJA 5BN5A 1GDDA 3II6X 1BWPA 4PRZA 1GYRA 2RGGA 4DDKA 3SSOA 4DL9A 3DL4A 1Z74A 4FD2A 4J9VA 4WACA 2ALJA 2JJYA 3RFCA 3V4PB 1WBBA 1D4OA 4IDGA 3VR5H 3W5HA 1PL7A 1M5UA 1N9GB 1Y5MA 4TKLA 3WKEA 2X8LA 4LF9B 1YTUA 3WP0A 3G2JA 4CMCA 2PFKA 1E89A 3SZLA 3QUCA 1Y5IA 4DQKA 2PGAA 1NFQA 1XN1A 2FHPA 3GPBA 4Q4JB 3UJBA 3JAKA 1KPHA 2QR2A 4ABYA 4ZAVA 1VCHA 1V47A 2X2FA 4C0LA 4R40A 1ZOPA 2X3YA 1E3LA 2ZE6A 1VJ1A 2RG7A 4JZKA 4LRYA 1WZNA 4AXXA 4A16A 2PDAA 3NOQA 4KQEA 1QIEA 3O8QA 4MWSA 1CUFA 3NETA 4YAFA 5TS2A 1ZEJA 1K7EB 3NV7A 4FEEA 2PQ2A 4CLDA 3AY0A 3ASUA 1TKAA 2IXFA 3GCGA 3GGCA 3I04M 2QRNA 5DBIA 2JATA 5H80A 1ODSA 4QJ5A 4YNBA 3V8MA 4BMZA 1BMTA 3NJ8A 5I5EA 2O59A 2WSIA 1HEIA 2E48A 3JVVA 1NTRA 1TAGA 3JR7A 4Q4DA 5KOIA 3ZWCA 3JYLA 4J0DA 3DEFA 5A4FS 4MRMB 5FI1B 2GBGA 1SOMA 5EKDA 3NGLA 1P9OA 4NX2A 1SUEA 2AQKA 3CKKA 3DD5A 4LNUB 3LT1A 1PTKA 3DMHA 3UN1A 2PQMA 5D5QA 5DHTA 4DZRA 3RUCA 1KVSA 2RSLA 1LRKA 1PX0A 1SKYB 1JRLA 3BMQB 1W48A 4R2HA 1AV6A 5JY6A 4I55B 2N0SA 1LPMA 2V96A 3MUOA 4G5YA 3ELDA 3L8YA 3RU9A 3B20A 1Y8RA 1QGOA 2AR7A 2OC9A 1P0FA 2PWBA 2R6GA 3PJFA 4N5DA 1LPNA 1L4NA 3QIVA 5U1PA 3VZRA 2A84A 2ZP1A 4GD3Q 4X8MA 2CCKA 1Z6ZA 3IESA 4WWHA 3QU7A 2HHHB 4GX5A 1BVHA 2IDJA 1NE2A 1TKCA 2CCGA 5DM60 4F71A 2DFPA 3GUCA 1C8VB 4NR0A 2NV2B 2IBTA 4KUHA 1P0QA 3IMKA 4RQBA 1O8CA 3SBDA 3H18A 1QKKA 1PO7A 2Q46A 3T4XA 3TIIA 3S28A 4E07A 5JBIA 3WADA 4CMBA 4MLCA 3DE6X 3I53A 3M1IA 1KI7A 3B1WA 4XFKA 2CUTA 1R0XA 3H8WA 3JX9A 5DT9A 3C1OA 3AONB 3CISA 2JGEA 5FL7A 3SYTA 4FFDA 2OXFA 4F9EA 5LDHA 1O9BA 4OK3A 2ZS8A 5IC4A 2QUJA 5AXAA 1LFAA 4G0YA 4JXKA 2PXHA 2EX4A 3BDVA 3CF6R 1TAUA 4CG2A 4JYZA 4HRYA 4S2EA 3E9DA 4TWIA 5E9AA 5I3ZA 1U9CA 4EHKA 4V03A 3DR5A 5CX1B 1E77A 2BFAA 1J56A 1KSFX 2Z95A 1U2EA 4EELA 3J81k 3ZWQA 2AJCA 4GAEA 1X7GA 1TL7C 2H9YA 1SB9A 4UVHA 4JLPA 4IQ8A 1V4NA 2JGLA 4EEXA 4L8YA 2WD7A 3HZHA 4XUCA 4KVFA 5C5IA 1CNMA 1XC7A 3T7AA 4FTWA 1IULA 1IXSB 1Q20A 3JVDA 5A9SB 2O8BA 4UOEA 1GQFA 2PWZA 2O2IA 3AX6A 4IJKA 3WOHA 2Y68A 521PA 1UJNA 3ZCRA 1KQFA 3U6KA 2O6LA 5BOSB 1STOA 2VDWB 4OB6A 4N5HX 4J16A 4PNHA 3M1LA 3SF8A 5ITZA 5LFAA 2XXBA 5A04A 1LJLA 3GRCA 1M2OA 2IRWA 1D2NA 1N9ZA 1P6QA 3N0VA 4MS3B 3BFKA 4G0QA 2I3AA 2PR2A 2AE1A 1I5OA 4L5YA 4ZK6A 3NTUA 3RV3A 1P1FA 5BNTA 3ECAA 2JFYA 4DYHA 2JIRA 4QPPA 4I4LA 3SI7A 3WGQA 4KOEC 1RWPA 4M7OA 4MI6A 1SIUA 3KHUA 3ZCPA 1RRKA 4AN4A 1TJ3A 4KO8A 1J06A 1T15A 2QQFA 1QH0A 3PJEA 4P3XA 4RABA 4JL6A 2C0QA 3RB8A 5KC8A 5LLTA 3TGPA 1YACA 4P0QB 1JDBB 4F3TA 4MARA 4ZOEA 1PS9A 2BTQB 4MGZR 4XIIA 3NRJA 4ZIRA 2PUDA 4YFVA 4MEBA 2YIJA 3MMNA 4C4RA 4HLQB 4RADA 3D7NA 3GZJA 3IQXA 1XQ6A 4UEKA 3MCWA 3O8RA 3A1UA 4AUNA 3H1GA 4JGGA 3MAGA 4LWZA 4HWOA 1YL5A 2F1KA 2AG6A 2VATA 1M2VB 3MERA 5KVCA 4XJVA 3TRJA 4ZV9A 4ZZ2A 4MDYA 4FOTA 2HDNB 3SN6A 3ZIAD 4U2BA 1OI7A 3LRPA 1RLTA 4YJ2F 2C7RA 4BXOA 2B2NA 3BT7A 2A58A 3Q0EA 1A71A 2CF6A 5BNWA 4RY2A 3G79A 2QZPA 2DF8A 2QPTA 3A8TA 2BEWA 1IHOA 4PONA 2W22A 3VOBA 2NV0A 3WIVA 4A1OA 5BRAA 1P77A 1RM4A 4PY2A 3EXHC 4CQMB 3H4IA 3GA7A 4MUKA 4AMGA 2QORA 3OFND 2IK8A 3JQ7A 2IIPA 4TQUS 3WI7A 1IFXA 1R4MA 3VPHA 2RIPA 5AR1A 3S81A 1SZCA 2ZSHA 3P7MA 5D7BA 1I7DA 2I0FA 1NURA 3FI0A 3DFIA 2OEPA 4DXHA 1AC5A 5BW5A 3KYIB 3K7EA 3CUUA 4DLKA 1J9ZA 4W5WA 4IXWA 5IBPA 3VBEA 4Z1OA 2B6NA 4AJPA 2QN9A 1GO2A 1DBIA 2AMYA 2DHDA 5AOAA 3TNYA 3O92A 3LYHA 2ODWA 4YDHB 2YJTD 1L5NA 1W0KA 2X1HA 1XDUA 3C15C 3LUBA 4IV5A 4J7CA 4KJZA 1VJGA 5EHIA 3A6JA 3QGMA 3WIUA 2IT1A 3BB1A 1G3QA 1YXMA 3FY4A 4Z1MD 4QUHA 1MAVA 3UK2A 2D1YA 2F8SA 1L7RA 2BIFA 3SG0A 4PFJA 2G76A 1O95C 1HO3A 3FNQA 3IHTA 2WPDD 4DLBA 1H2AS 4B31A 3WP1B 1JLHA 3AVVA 4OHVA 4LCEA 4MKRA 2HJVA 4L9SA 1WSAA 1R5JA 4HDKB 3KSAC 4DLUA 2C61A 3VR5D 3ZZTA 1C7QA 1OJ7A 3I5UA 4F93B 3L5OA 1HTWA 1E79A 4MWEA 1EU1A 3U13A 3VTZA 3VKHA 1XXLA 2A5JA 3BMCB 2PKCA 3GA5A 1CY2A 1XZ8A 2OAQ1 3BGSA 3IIKA 1N3LA 4FQ5A 1SCKA 4AF7A 3D5EA 3RSFA 4INZA 3AI1A 5BN4B 1TVKB 3L4BA 2ZJZA 4UHDA 3EZGA 2CDRA 1V1RB 1SM4A 1UBJS 3AG6A 4IM7A 5LP6B 5F2NA 4DMFA 2XMPA 4HN4B 3KQKA 2ZAIA 2OCYC 2ACKA 3FG9A 4JSRA 4YJ2A 2O5EA 2W0MA 1JNYA 3WO1A 4ISCA 1JQJC 2O8EA 1GZ4A 3VOSA 4EG6A 4NQZA 2Z9DA 1QUEA 4MUEA 2Q3HA 2X8JB 3GZTB 2I2CA 2XUZA 4G84A 1SXQA 4ENPA 1MJ5A 1JFFB 3BIJA 3FDFA 1U8TA 3NEJA 3OEYA 1HL3A 2EG9A 2G9VA 1Q0HA 3FZEA 4DPKA 3E5RA 4RDXA 1Y0BA 4V0ME 5CJ2A 2CSUA 1P7WA 4V38A 3BRCA 5FJJA 1M76A 4J6EA 4WGFA 4YDSA 3OZWA 1SZPA 3GJRA 5AJHA 1CDEA 5I7EA 2CV1A 2TYSB 5IJ0B 2XODA 1YF3A 2MCFA 4ZYXA 2V8BA 3PNOA 4LOHA 4OOEA 1EXNA 5HF6A 3E15A 2IEDA 4IRXA 3ROFA 2OBFA 3MEQA 4Q9DA 1JLRA 5SY4A 3A1DA 2JLQA 4Y30A 2FPSA 3PDIB 2BF7A 3JAMA 1BWSA 4LE1A 2EKQA 3Q7TA 3VX3A 1HE3A 1QC5A 1D1SA 4ESEA 1LD3A 2CY0A 4PYIA 1NDHA 4QBHA 1IHPA 1W5TA 3FLEA 3K1JA 4HDOB 1CTQA 2C7VA 4OYHA 4NZPA 2V65A 3QTBA 5CT5A 2VP0A 4KN8A 4LJ4A 5GAJA 3KB1A 3T3NA 2I7TA 2FW6A 3AKYA 4HWGA 4GI2A 1D04A 4F8JA 1ZIOA 4OGKA 3G82C 4D43A 2R48A 1NOIA 3L0CA 3X3HA 3UGTA 2FSUA 2GCOB 2QZ9A 5F3DA 2PUBA 1E5QA 1U98A 3TOVA 1HI9A 2Y99A 1RKVA 3T1QA 4B6SA 3EJWA 1T1JA 2BKLA 1GYQA 2QI9F 2ZBUA 3M33A 4RMGA 5AVTA 1J49A 4FLEA 4YAUA 1FFSA 1AKNA 1U90A 2IYYA 3RHTA 8ABPA 3RBVA 5FFNA 1XQ9A 3CRRA 1BDMA 1T2DA 4ZRMA 4QQ8A 4WXHA 5KSWB 2FEWB 4FWTA 1R8SA 4NCAA 1FNCA 2CJWB 2DPHA 1ZK0A 2QUIA 2P2NA 4RMJA 1E1LA 1WP4A 2WWIA 4JEIA 5GIOE 5AW5A 2G28A 2WUDA 4IX9A 2HU2A 3W6ZA 1VIDA 5DLYA 3OVMA 2HRBA 2PKWA 1QK4A 5CDFA 3HFGA 1COZA 1F0PA 4KR0A 2X8AA 2IV2X 4QOHA 2WQ7A 1ZAYA 4UAVA 1L6IA 1NC3A 1K75A 3SQWA 3N7UA 3QVGA 4J1TA 5FIUA 4H7FA 1JHDA 5C7LO 5JYEA 2CZGA 4QNRA 1QS0B 1Y3IA 2Y1OA 1JEOA 1YS4A 4PW0A 4CKYA 1MJHA 3GLQA 2IOFA 2UZIR 1P72A 1JMKC 2G5GX 3R23A 1MB3A 1G0OA 2CK3D 5TPZD 2G09A 1TZBA 3IIMA 3AZOA 3MLEA 4KR6A 3Q2IA 3CB2A 2AQ8A 2O3UA 4DRXB 5HYVA 2Q4BA 1E5TA 1MZVA 1SKQA 2C4TA 3VR2A 2IOHA 2AC4A 5H5JA 3UJDA 1MEOA 1N6NA 1R5OA 3WL4A 4R7TA 3RVJA 1NVMB 3OJ0A 4I1YA 4MUNA 1U5BA 1UK6A 4GYYA 4W9RA 5HDBB 1DOZA 2IU4A 2MR5A 2CDNA 3W90A 5AHXA 2IS1A 2X7XA 3CLRC 4FQ7A 1USIA 4B44A 2DBYA 2RHJA 4HEHA 1XU4A 4ZAXA 4D99A 4X1IB 4GZ5A 1SMKA 1SU8A 2I29A 4WZAA 1ZGGA 1HYQA 1P2TA 2SKCA 3N75A 3MQFA 4O33A 3U60B 1UC9A 3AR5A 3WJ7A 2NACA 5DTIA 5EHZA 4BNMA 4P2GA 4UPVA 3ISJA 1JDSA 2J6BA 1WUKS 3D81A 3LUAA 5IHXA 4OPMA 3IXMA 1TGYA 2OAEA 4KR9A 3DTTA 4H0FA 4P38A 5KINB 3IVRA 2WQ6A 3MTJA 2OL4A 3D7RA 1KS9A 4ZMRA 4GM0A 2E5LB 3FMIA 1BXGA 1U04A 5IJWA 1CVRA 5KIAA 4CEJB 4Z5XA 1UL1X 4RKWA 1DC6A 4MUFA 5BSMA 3TRKA 3WWOA 2VK4A 4TRJA 3OTIA 2VJMA 1AG9A 2NAFA 3REQA 4ETMA 4H4EA 3GGDA 2V4UA 1QONA 4UASA 2NXCA 4Z8YA 3DO6A 3DHEA 2HV8A 2QZSA 2VUUA 2Y05A 3TR0A 1A9YA 3WFJA 1FS6A 1D9ZA 3MHPA 3TD2A 5BN4A 1GV1A 2XUQA 3A70A 1WSDA 4JXJA 4AIIA 4EG1A 2QSJA 4OQLA 5DWDA 3WLMA 2BOVA 5KTOA 1XA3A 2MWMA 3ZLVA 4HUJA 1LV8A 3U40A 3ZKWB 3ESZA 6GPBA 1R00A 2JI9A 4XX0A 2YXNA 3U62A 3NNNA 4ZVQA 1WA5A 5LA6B 2CHEA 4N48A 2CUKA 2NPFA 4P22A 2GA9A 1XO1A 1P44A 3CN9A 4RMNA 3IQHX 1XA0A 2G5CA 3TZEA 1T2NA 4R31A 2YQ5A 4BZQA 4R2MA 1I7PA 4J3JA 3UWKA 3LHSA 3GHHA 1YD7A 1L7AA 2QJRA 3O91A 2A6PA 4NSNA 2W2KB 1NYLA 2EDAA 3EQZA 2JBAA 2YNMA 4C4XA 3ESQA 3SLGA 2XTJA 2IYXA 1JDZA 1EQUA 2WF5A 1SOWA 1KJIA 3AHHA 5KNCA 3KHTA 1IIRA 5KYTA 2D5LA 4HTFA 5C32A 3P19A 2WJWA 3ASVA 5CM9C 4QPNA 1WCWA 2MINA 2AVDA 2WTNA 4P53A 2WR8A 4LFBB 3CZ4A 1Z5ZA 2WRZA 2VHVA 1JEYB 1GTG1 2Q1TA 4P4GA 4DJFC 3QMPA 3FGZA 2AF4C 5LZ5A 2GETA 1BYUA 1FYXA 2PS3A 1SUBA 3O4VA 1LZKA 2ZAOA 1P6XA 1H1LB 3LF2A 4IIJF 4UTXA 4RY0A 3CR7A 3U1TA 4BNTA 1T3SA 8AT1A 1NDUA 4LXUA 4BNDB 3GUUA 1AN0A 2ZM5A 2JH8A 1L8QA 4NBRA 4C7XA 2WAOA 4O4LF 1QLJA 2NT3A 1YB6A 2VDVE 2V0NA 3I9KA 4UW9A 3T1VA 2EHJA 4Q3BA 4GS5A 4QOGA 3U81A 4BVJA 1MTOA 2W9XA 1XE3A 4EOGA 2PXAA 3ZGNA 2EG5A 4BP9A 5KWJA 3WJ1A 4ZOQI 3AVOA 1QGYA 3F5DA 3I42A 3IX7A 1ZRNA 4DV4B 1EFUA 2PKQO 3RC9A 2CLLB 1DIRA 1ZMRA 1ABEA 4R1PA 1T5OA 1BEEA 4Q0MA 2FMIA 3G85A 1A5ZA 5TB5A 1Y34E 1Z7WA 4NK4A 1RMYA 4K26A 3O2QB 4QPZA 4GZLA 2QVCA 1BGXT 2QYTA 1HDEA 1KK3A 1N4AA 1DRWA 1TYDE 2VHUA 4I5DA 3I04A 1LQTA 3CPSA 4E12A 2IHKA 1BXRB 2AI3A 2V9CA 5DF1A 1Y3BE 1Q1EA 2DY0A 3IUPA 3T7JA 3D6NB 4FSDA 3PP8A 1QWSA 3D9QX 3ZU4A 3D5QA 1Q16A 4F6RB 3NMUF 3AJDA 3LDGA 3ZLTA 4XR9A 2ODPA 3I83A 1X7ZA 3H4VA 4QDTA 3JARB 4MX8A 5JAZA 3FHTA 2KBFA 2ZBPA 2D1QA 3ANLA 2IYFA 1HL7A 2OUIA 1T4MA 3UY4A 5LDDC 5K45A 1VXOA 4IIBA 2BJVA 1XQXA 2FZGA 1G5FA 4OMDA 3OLZA 2I1WA 2W8BB 3EC1A 3G0CA 3MINA 2HD4A 3SVZA 2AFHB 1JU4A 1SUDA 3PXDA 3ND9A 3V1LA 2X19A 1DTWB 3CT6A 2OKCA 3KT6A 2VBIA 2EP8A 3OHPA 1KEUA 1K8QA 4KV7A 5A7GA 1NI5A 1X3SA 4KX5A 1MX5A 4DC0A 5KOHA 1A2OA 2VP6A 1YOVA 3KLOA 2JFBA 2BEUA 4G36A 3NHSA 1N25A 4BVBA 2VJBA 1Z0AA 2HQBA 3CCBA 2NM0A 2IUFA 4MRRA 3EPHA 5E7JA 4RTQA 4HB3A 3QEKA 1QRAA 5EQFA 1T9BA 4O4LA 2Y0PA 1RM3A 3KELA 3WLJA 1ZUD1 4ETIA 1Q7GA 3G2HA 2IZZA 4UDOA 5LNK1 1DB3A 1TI7A 1UJ4A 1N5MA 2GJSA 3D2BA 4QKQA 1YDHA 1K5DA 3ESYA 5A4AA 2H8KA 3AEUB 1NX6A 3CLSD 4ANFA 4AF6A 4C22A 5JJCA 5DGIA 1XI2A 3KK0A 3B1XA 2IZ0A 3QXGA 4IGAA 4CW7A 3U4HA 2ZVDA 3AOEA 1Y1QA 5AOBA 2EOAA 1YKSA 2G7MC 3QI7A 4DILA 1EINA 1W19A 3HZZA 2ZXUA 1KEZA 4RTOA 1FVFA 3A36A 1UBCA 1CFJA 1NPDA 2OY0A 2VUIB 4IJUA 5HKKD 3QJYA 3O4IA 4N5LA 3VC3A 2VNHA 3HFJA 3ONEA 4HVTA 4WTOA 2ZB3A 5KI6A 3B70A 1P8JA 3ZD8A 4PX3A 2G5TA 2R8EA 5DMXA 3ULKA 4EY6A 2CMGA 2L2QA 4IKOA 5C52B 1UKBA 1ZICA 5IKMA 4J43A 1ODCA 1CQIB 3MCVA 4ZT3A 2RKOA 5KJCA 2C4WA 3RS4A 3WL7A 1O03A 1QKJA 2H85A 3LGSA 3V2UA 1L5FA 1RQGA 4FYPA 1L4GA 1O0CA 1XAJA 3B1YA 3B7GA 2QQEA 1IY0A 4RKRA 1SUIA 3K9LA 2WWGA 3DV0A 2H48A 1GNRA 3JR3A 2IGTA 1XJWA 3HKCA 3N53A 1NUHA 4IIVA 5JEEA 3FNFA 1PWZA 2IYEA 2ONCA 3HEMA 5B3AA 2DY1A 3GMTA 4L5JA 3V1UA 4HL6A 3WGLA 5BWOA 4KBYA 1R15A 1H0HA 3ZGZA 3B5JA 3M89A 2PMKA 4EUNA 2HSWA 5TGDA 1KKLA 3WSVA 1Z08A 2FPKA 1W0KD 5JI3E 1CYEA 4MUYA 1P1BA 2Q49A 3LLUA 3OZGA 3AW9A 4OUKX 4V0NA 4QOEA 3FWPA 3GJXC 4KO4S 4YAOA 5JZBA 4IDBA 4O4IF 4GE0A 1GG5A 3WMXA 4QNNA 5DSTA 2FUG1 3EQ7A 1A9OA 3GQBB 3IUMA 3FW1A 1C4XA 3C8UA 1R8JA 3UCXA 1FNBA 3L0DA 4R2JA 5DV9A 5EESA 1V1JA 5JSZA 3SQXA 4GSYA 1OV6A 2YHSA 1G6HA 3NDPA 4Z0PA 1L8LA 2VZ8A 3OPMA 4LCBA 1XYYA 4WFIA 5HUQA 2E7ZA 1IDN1 3O1LA 3PUHA 3E53A 4QFMA 2A5YB 1N8NA 1NA5A 1VSUA 3LKVA 1YT5A 3H4MA 2QX6A 4LRXA 4CL8A 4NBUA 2JD0A 3CEMA 1GZ3A 2KM1A 3KWJA 4F1JA 2B4AA 3IP3A 1CW2B 3TL2A 4FLMA 4NU8X 4F4FA 2A9VA 2ZRKA 2VP2A 1ZXXA 2YTZA 3VC2A 3WSTA 2C31A 1SKBA 4CCWA 2CVHA 1YULA 4KDRA 2PNFA 3I45A 4L57A 1NP7A 5ALTA 1U2PA 2R1VA 3MS7A 3KAPA 5JFTA 1NW8A 2PMBA 2PX0A 3P0IA 4P4SA 4RPLA 1ULZA 2M1ZA 2RGEA 2TS1A 3ETEA 2Z1MA 4IGIA 1E9SA 1RAFA 5BSHA 1Y82A 5D8DA 1RJGA 1WZEA 1QTQA 3CTMA 1K27A 1WMEA 4PWYA 2ZULA 3QE3A 4X45A 2C42A 2XUJA 4URWR 2B1IA 2WSMA 4KE8A 3GAFA 4DF3A 3W2IA 1H4VB 2FSFA 2HJSA 5BT9A 1CCWA 1PSDA 4AQYB 1JBQA 2B20A 5D3KA 3B9PA 2XF8A 1XPOA 3ICCA 1GDHA 3LWNA 4I9HA 4BX2A 5CFMA 3VR4H 4DV3B 1TIPA 3S2YA 2WIAA 4RL4A 4UPDA 4M1YA 3NV9A 1BS2A 2F59A 1YBAA 3PC8A 4MO9A 5HP4A 2IZ7A 2D8AA 3UUGA 4AJ4A 2GTPA 1OLUB 1W5AA 3PR1A 4H6XA 4G63A 4ZDJA 2ZU0C 3BTOA 4KXVA 3W5CA 3GIDA 1YO6A 4QUEA 3PDHA 4BO6A 2F4VB 1JSLA 3HJGA 1GN8A 1INLA 1GIAA 2J33A 3OURA 5J2TB 4WK0B 3ZXXA 2EJCA 1ZK4A 4O4IA 3WHKA 1GPJA 2Y1KA 4RYLA 2EHDA 4Q03A 1XDBA 1NZFA 3QTLA 5TQ2B 1JHRA 1ZM4A 2VO1A 1UFOA 3HRKA 1F06A 1TK3A 2QV0A 3D1JA 2DULA 3GVHA 2OCDA 2FEAA 5K99A 2OZKA 1WHSA 3BMNA 2NVUB 5IVKA 1J2YA 4J0FA 2PMFA 4KQWA 2O54A 4ERXA 4US0R 1PT9A 1ZJJA 3EXEA