3VKUA

Penta mutant of lactobacillus casei lactate dehydrogenase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
306
structure length
290
Chain Sequence
KDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFTSPKKIYSAEYSDAKDADLVVITAGAPILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of penta mutant of L-lactate dehydrogenase from Lactobacillus casei
rcsb
source organism Lactobacillus casei
total genus 97
structure length 290
sequence length 306
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3vkuA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3vkuA02
4XQ9A 3ZNOA 1X1EA 3RC7A 5JNLA 1VKOA 3PXXA 5FWNA 3MCVA 4MIEA 4E5KA 1UDCA 2TMGA 4KUGA 3OETA 1JQBA 3UF0A 4OJNA 4CQMB 3L4BC 4QO7A 2CVZA 1SBYA 4R01A 3RBVA 2Q1SA 5IZCC 1LLCA 5K0ZA 3PJGA 1E7SA 3F3SA 2DAPA 3PEFA 3K2EA 1HE3A 2Y1GA 1IPEA 1SZJG 2PZMA 1LDBA 1TLTA 3NTOA 2IE0A 1I8TA 3K96A 3S2EA 3FNEA 4YR9A 2RBEA 1K6XA 1NR1A 3LYLA 1X7DA 4M89A 4AJKA 5KCZA 1DFHA 1I33A 3AY7A 3QWHA 4BMVA 4WCDA 1GQ2A 4UAGA 3D1LA 4N5NA 4FDAA 1B2LA 2AQKA 4YJDA 3AY3A 4JJGA 4DXHA 2ZTVA 2Q46A 2TMDA 4NH4A 2B5VA 3VPFA 3ZWNA 3RI3A 3H7AA 4YJHA 4EJ0A 2EEZA 1LI4A 3H3JA 1BVRA 5F1OA 3L07A 5HRUA 4L4RA 4D0RA 3T4EA 3H5RA 5DP2A 1AXGA 1I10A 2UUOA 4DQUA 3UVEA 5GZ3A 1CEQA 1DAOA 3VAZA 3I9MA 2RH4A 3F6YA 4E2ZA 3CPSA 3F47A 4PLTA 3WLEA 4GKBA 1PS8A 3ZHXA 5JDIC 2NM0A 3LZ6A 3TRIA 1XIVA 3DHNA 4BNFA 4FSHA 5KVCA 4I5GA 3DOCA 1TT7A 2ZTLA 3E9MA 4XDYA 2DPHA 5JC1A 3PZRA 1Z7BA 2HJRA 4J4BA 1LX6A 4WCFB 1OOEA 2VNAA 4BGUA 4PG8A 1U7HA 3RQSA 4W9NA 3Q9NA 3G1UA 1BXKA 2VT3A 1K6JA 3CSDA 1F8GA 4R1TA 3TN7A 1QORA 3LT4A 3A14A 3GRPA 4A10A 3FI9A 1FDTA 2ZB4A 3BZUA 4W82A 4X54A 3ZWAA 4GX1A 4RCVA 2YV2A 1T1SA 3SJ7A 5G4LA 3WX0A 1LEHA 3I9JA 2VQ3A 4XCVA 1N7HA 4WEOA 1UH5A 5IAAA 3N58A 4TMFA 4PZDA 4RVSA 2ZIZA 3OIFA 3JQBC 1YBVA 1WNTA 3AJRA 1IZ9A 1ZK1A 2XPCA 2UYYA 1MXFA 4PG5A 3WGOA 3QLJA 4L74A 2BGLA 3DEYX 4BIIA 4A7PA 5TT1A 2CF5A 1PQPA 3TJRA 1OZAA 1XQ6A 3JQ7A 1XQ1A 3RUDA 3GPIA 4E5MA 4EGFA 2WMDA 5JYDA 4GH5A 2UUPA 1J5PA 2Q1TA 1ZK0A 2JCYA 1JU9A 3QVWA 5ES3A 4KUEA 4RF4A 1H9AA 2BF7A 2XAAA 3ZI0A 4QUKA 2BGMA 1F8FA 2VOEA 3OJLA 4TVOA 4NBVA 4Z3KA 2H1SA 3TDKA 3CMCO 1ENPA 1A27A 1UAGA 2NU8A 4XRRA 3QY9A 2EW2A 3ETEA 1ZSNA 1NFFA 1YWGO 1HEUA 1YB5A 2IZ0A 4RQTA 4IIVA 4TRMA 2X9GA 4KWIA 3EHEA 4LK3A 5KIAA 4PVDA 1ZNQO 2FP4A 1R4NB 3BMOB 1SNYA 1I24A 3VKUA 3V1UA 3H8VA 3QSGA 1BDBA 2B83A 4FN4A 3RIHA 4BVAA 4TZTA 3IL2A 1G0OA 2PGJA 3KYBA 4INAA 4BKUA 4IJKA 3VDQA 4XYBA 1VL6A 3WJ7A 2HQ1A 1Z75A 1BXGB 2ZJ0A 4W6ZA 1UXKA 3PYMA 1S7CA 4DREA 2VRCD 1P1FA 1XG5A 3GUYA 3U9LA 4Z6KA 5JDCA 1KYQA 1NHWA 1YRLA 3DMTA 4K9DA 3AI3A 3SX2A 4AJ1A 5CDGA 3IJRA 4ZQBA 1Z45A 3UCFA 1GYRA 2A92A 2P5YA 2CVOA 3BTOA 4HFNA 3LC1O 1H2HA 2Q2WA 2VOJA 3EK2A 4UEKA 3F5SA 3AUSA 3TSCA 2RAFA 4QSMA 2QHXA 4UVHA 3GC6A 3AUTA 1T26A 2Y99A 5HTOA 1IYZA 4XYLA 4E2XA 3QWBA 2NADA 2ZCVA 2YHIB 2HO5A 4CMBA 5JBIA 3L4SO 4EJ6A 5KJCA 3WGYA 1M75A 4NFHA 4DWVA 4NQZA 4LVUA 4IS3A 2GNAA 3DBVO 2Y1FA 3HQ4O 4I08A 4R1NA 1IOLA 4BKOA 4P22A 3WNQA 3PHJA 4YJGB 5AYVA 4M55A 1H6DA 4EBFA 5CFZA 2IXAA 2IDZA 4H16A 1DPGA 3E5RA 3PWSA 1MV8A 2VRCA 4U7WA 1LSSA 1HTBA 1LSUA 4FD3A 2YFQA 1UAYA 2PTGA 3CINA 5GZ1A 4KMSA 5IFLA 2DQ4A 1GR0A 4FOSA 3BTVA 4YA6A 4UEOA 3MJCA 4FS3A 4GX0A 2EKPA 3H65A 5IJZA 1PJ2A 3S2IA 3X2EA 5IG2A 5COAA 1MFZA 2ZYAA 3PQDA 2VNSA 5A5FA 1CRWG 4OXKA 5IDXA 2GZ2A 1DIAA 1PWZA 3UHAA 1Z82A 4IY1A 1M67A 1VJ1A 5EERA 2J3IA 3U5TA 3GDOA 2YJZA 1JA9A 3C7DB 4NK4A 1MGOA 3ENNA 4D43A 3GLQA 1Q1NA 2JL1A 4MP3A 5DF1A 4BO9A 4YRBA 4FJ1A 4HXYA 1KEWA 1V35A 2NVUB 3AY6A 4FOOA 4UUPA 2HCTA 3GK3A 2Q2QA 4KDFA 5JCXA 3O26A 4XYEA 1UDBA 2I65A 3HFGA 4TRNA 3DBLB 2DPGA 4DYDA 4JBIA 1T24A 2J3HA 1WXDA 3WSVA 3I9OA 3K8ZA 3WGTA 1OC2A 1A72A 2UAGA 1R12A 1UZMA 2W2KB 3BMCA 1PJCA 3G79A 4JBHA 3PHHA 1ADBA 2GUGA 1D3AA 1DIBA 1NX6A 3A9WA 4MP6A 3TZ6A 3F1KA 5KNLA 4L75A 1DFGA 4XB1A 2Q1WA 1PQUA 4URFA 2EGHA 2EP5A 1WZIA 1C1XA 3M1LA 3LK7A 3F46A 2VTEA 3H9GA 4E2YA 2VWPA 3ZWXA 5JO9A 1I32A 2VUUA 4BNVA 4D3DA 2GF2A 1WP4A 3Q0EA 4CM9D 4XGIA 6LDHA 2Y1DA 1E3LA 1GPDG 3I9LA 4Z0HO 4J7XA 4RPKA 3RAJA 2JD0A 4RORA 1FDVA 1H5QA 4CMKA 2NTNA 1HDXA 2I5PO 1ADCA 2O3UA 4NFYA 1JAXA 1IL0A 2ZQYA 1PZEA 4TRRA 1PZGA 4AJ4A 1NM5A 1U4OA 3DAPA 2J3JA 4I5FA 2BH9A 3OH8A 2J5KA 3U4DA 4CM4A 4NZ9A 2VHWA 2AQ8A 3LF2A 4NJOA 2GN8A 3EVNA 3ZWOA 1N92A 1BW9A 3HFSA 5CHEA 3ZWWA 3FTPA 4YAEA 3M1AA 3EVTA 1EBUA 4RVUA 3ANLA 4I9NA 3KEQA 2FOIA 3AUAA 3ZV3A 4RZIA 5FI5A 2RCYA 1P33A 3DTTA 3WWYA 1E3WA 4QEDA 2NSDA 3IUSA 4JROA 4MOWA 4WLVA 5KJ1A 2G5CA 1V6AA 4E12A 2RIRA 4CV1A 4E30A 1GV1A 5DBFA 3WQSB 3HE3A 4M86A 2O23A 3PTZA 4NIMA 3ZV6A 1LNQA 3RUEA 3FR8A 2AW5A 4Z3DA 4J1SA 1AHHA 1FDWA 1D1SA 2V65A 4IQGA 5L40A 4J4HA 1KC3A 3DFUA 3JYNA 3VPHA 3IMFA 3NTRA 4MP8A 3UH1A 4QFDA 1JVBA 3F4BA 3GZNA 1EK5A 1WMAA 2D2IA 2HMTA 4TZKA 4A2CA 1EE9A 1H6BA 4CMHA 3BIOA 4NHEA 3ZHBA 3KXDA 4XGNA 3RC1A 5AXBA 1KBZA 1PS0A 5IDQA 3KV3O 2E37A 4M54A 4BMNA 3ZW9A 3NDJA 3GUCA 3STHA 3AFMA 1U3TA 4CMGA 3COSA 4E3ZA 1PL6A 1RM0A 2XXBA 4QQRA 4E5YA 2X1HA 3WBBA 3D4PA 4JBGA 3DDNA 1YDEA 2VTDA 2GASA 2G82A 3OECA 3DHEA 1VL0A 4D3SA 5DCYA 2B37A 3C7AA 3IOYA 2JCXA 2A4KA 5L95A 1C14A 4I8XA 4P8RA 4U6QA 2WWRA 1I36A 1NQAO 1RWBA 2ZKLA 3F5QA 4PG4A 4UVDA 4UVIA 3UFXA 1EVIA 3ASUA 4RO0A 3W1VA 4OXYA 3UXYA 1E1KA 1N7GA 4ILKA 4NU6A 3FWZA 5L4SA 3BHJA 3OBBA 1Y8QA 4BGIA 3W6ZA 1EFKA 1LSJA 4D42A 3EAGA 2OBYA 2HUNA 4EW6A 1ZVMA 3GGPA 1ZW1A 4R69A 1U5AA 3GDFA 5DN9A 2PR2A 3B1KA 4AJLA 4DIBA 3DBRA 3E48A 4XYGA 2PD4A 4UREA 3OMLA 1DRUA 1ZH8A 2WD7A 2NLOA 1NXQA 3MJSA 4AJJA 5K6AA 1Y8RA 1LDMA 2Y05A 3P5SA 4AJEA 1GQQA 2W8ZA 1YL5A 4U6SA 5IXSA 4LRSB 2X22A 5F1KA 3GFBA 1DDOA 5CG1A 1I3LA 4G2NA 3JYLA 1KC1A 5EQFA 2NNLD 2QRLA 4ALLA 2J6IA 1QYVA 3SBOA 2PD3A 4O6VA 4P4NA 3UW3A 3Q2IA 1LC0A 1Y5RA 2E48A 1O6ZA 3KEOA 5A1TA 1LA2A 2P91A 5ILGA 1EUCA 3DB2A 3V2HA 2ET6A 3JQFA 2QW8A 3BYZA 3ABIA 1SC6A 2OBNA 4K6FA 5KVQA 3AU9A 1VM6A 4Y8VA 3ZU5A 3B70A 3CZMA 4MDHA 4YJHB 1A4UA 2AXQA 2DBQA 2FMUA 4ZGWA 4J7CA 4BNIA 3BMQA 4DA9A 5FF9A 2GD1O 3MJEA 3PHIA 4I5DA 3B20A 4QXMA 4K28A 3L0DA 4HFRA 4E0BA 2BFPA 1QR6A 1LC3A 1N9GB 2ZYGA 4GVLA 3E8XA 1GEEA 2P2SA 5LDHA 3HUDA 3MZ0A 1KEPA 4MJLA 4Y6SA 3ZU4A 3HN7A 1WDMA 4Y9DA 1E1NA 4DPMA 3FWNA 4XQEA 3RBZA 4Q3CA 3SC6A 1E77A 1CYDA 2C29D 4H7PA 1ZEJA 4O5OA 1BVUA 4EUEA 3NKLA 1W73A 1Z73A 1ZXLA 2ZCUA 4Q3NA 4E2WA 1WZEA 2D8AA 4HP8A 5COBA 3JYPA 5ENVA 2B4TO 4CR8A 5EL0A 4GX5A 4PLZA 1DRWA 3UGKA 3OF2A 3NX4A 5EN4A 4W99A 5CEJA 4EEXA 4Z9YA 3RJ5A 1NR7A 1XR3A 3RD5A 3RFVA 1ONOA 3GEGA 4E5PA 2Z5LA 1LTHR 1UR5A 3FNFA 1VRWA 4RL6A 1Q7GA 3KYCA 4DTIA 1GZ3A 3CZRA 3L9XA 3IC5A 4RPJA 5FYDA 3CMMA 1EE2A 4GLOA 1CDOA 4BO2A 4GAEA 3VPXA 2X9NA 1ISHA 3FHLA 4AJOA 1I2CA 5G0VA 3UN1A 5BNFA 3H9UA 3C3XA 3HDYA 3FR7A 2NTVA 3JQ7B 3GG2A 3E6AA 3EGOA 1OMOA 1HKUA 4EYEA 3MOGA 2D59A 4DBVO 1HDGO 2ZB7A 5CPBA 1J6UA 1U7TA 4BV8A 1GTMA 2NWQA 1ISMA 1B26A 3AOGA 1DHRA 3OA0A 4H15A 4RVDA 1B8PA 3ADPA 1ID1A 2O7QA 1B7GO 5TSDA 1SEPA 4YQYA 5G0SA 1P1JA 4IZIA 5BSEA 5L7TA 1A4IA 5U4QA 5DOZA 4O59O 4ONEA 4DRYA 1RM3A 4J1NA 1X7HA 4KUHA 1EMDA 4FW8A 1R37A 3OJFA 4WCFC 3TOZA 3KOUA 1NTOA 3WYEA 4WK6A 4EJMA 1EVZA 1DC3A 1O0SA 4RQUA 3C8MA 5EPOA 5TNXA 2C5AA 2B5WA 1NP3A 1VPDA 3GDGA 4O0LA 4OXNA 5AXCA 3X2FA 3M2TA 4IJUA 4J0FA 1RJWA 1XCBA 3MWDB 4E32A 2X0NA 1SB9A 3GMSA 2YQ4A 3LT0A 3OEYA 3IKTA 1X13A 5I9LA 4MKRA 2X23A 4FC7A 3HG7A 2FR1A 5KOIA 1GPJA 3WGZA 3NGLA 4F46A 1GD1O 3G1TA 4BS9A 1LDNA 3QV1A 2ZYDA 4P4LA 2O48X 4DL9A 1H6AA 2EIHA 2FR8A 4XIJA 1P0CA 4XIYA 1GQYA 2YFHA 2V6MA 3QVSA 2ZJ1A 2QRJA 1TA4A 5T8KA 3S8MA 4CV2A 4XQCA 1X0XA 4DUPA 2J3KA 2V6GA 4CMIA 4U0JA 1K89A 1X14A 3W8DA 3UUWA 4R16A 2AE1A 1QG6A 2DFDA 3KUXA 4R9SA 3P19A 2PGDA 4IIUA 3PJDA 1T2FA 1EK6A 3FNHA 1Y9EA 4WUVA 1T25A 5G0TA 5C5IA 2VWHA 2JD2A 2Q50A 3OICA 5BQFA 5JFOA 1MB4A 2LDBA 3V8BA 1LUAA 1Q0LA 1IULA 3PDUA 1ULSA 5I7EA 1PGJA 4CQLA 2G76A 3KETA 4YJFB 2C20A 3P2YA 4BNYA 4JQCA 1DC6A 4E21A 4B4VA 4U8GA 1Z74A 1I01A 1PQWA 3F1LA 3TL3A 1DLIA 4BNGA 1IUKA 3A28A 1V3UA 1VJ0A 1U4SA 5TC4A 3JYOA 4FJ0A 2G0TA 5BT9A 4ALJA 4LCEA 5JE8A 1O9BA 3CIFA 3R3JA 3ICCA 4YTEA 1D8AA 4TRJA 5TRTA 1YO6A 3ROMA 4ND5A 3EMKA 1HDOA 1LLQA 4OM8A 4F6CA 5C3MA 2Y67A 1FDSA 3GQVA 4CMEC 1R66A 2EHDA 3WYCA 5CDYA 4HNGA 4BQPA 1EBFA 2WYVA 3GR6A 3ZV5A 5JW6A 3I83A 3PFWO 2YQ5A 4M1QA 1PGNA 4NNJA 4BKQA 2O50A 3DAFA 3K92A 1CF2O 1LSOA 1H9BA 3AOEA 3OHSX 3PI7A 1U3UA 4XWYA 3DMYA 4ZN6A 3GY0A 4FFPA 2HMVA 2HRZA 4BHTA 5IDYA 2B36A 5L51A 1DEHA 2FSVA 4KDEA 3JQ9A 3OJ0A 4A27A 3GN1A 4DIOA 5A9SA 1W0CA 2X9VA 4LRTB 1FMCA 1WVGA 3JQEA 3DFZA 3QVTA 1JKIA 4OSPA 2OP1A 4RPHA 1XSEA 3VZSA 3BMCB 2EG9A 3WB9A 1Q2XA 4FFRA 1O5IA 2OL4A 3F4LA 3JQAD 4CM3A 4MINA 4P38A 3D7LA 5TGDA 4CM8A 4KZPA 2EW8A 1C1XB 4LVCA 5ILOA 4L9RA 2OOSA 1TB4A 2XXJA 1OAAA 2FHSA 2X5JO 1PJSA 4A0SA 1QXSA 3DZHA 3JQ6A 1M66A 4FC6A 5DULA 3D0OA 2YY7A 4LISA 1L7DA 3DR3A 4Z0TA 3KYDB 4YXFA 1HXHA 3I4FA 3BA1A 3TFOA 1TEHA 1KEUA 1OC4A 2J5QA 3O8QA 3UCXA 4YAIA 4H3VA 2JFGA 3E82A 2JD1A 3TZQA 1J0XO 1YQDA 1IE3A 1PJQA 1CJCA 2Q2VA 4OO3A 5L7WA 4ESOA 1NQTA 1WWKA 2NU6A 3EDMA 3G3EA 4GWGA 2Y66A 1CQIA 2Y0DA 4F3YA 1H94A 1P1KA 3GGGA 1FJHA 4JP2A 1BW9B 4WEQA 1Q7CA 3WXBA 3IAHA 2X8LA 3I9KA 3PGJA 3PRJA 4J6FA 4NR0A 3S1LA 5KVSA 3JQAA 5I7FA 4FGSA 4L76A 3JQFC 2W2LD 5A5EA 4NJMA 1DSSG 3KSDO 3FNGA 3UKOA 2HMWA 4CUKA 1MP0A 3G17A 3GNQA 1LRJA 1ARZA 4BNKA 3H2ZA 3DO5A 1C1DA 5J23A 2B35A 4DC0A 3JD2A 5IZ4A 3B1FA 3ORFA 5U9CA 3KBOA 2PH3A 3UICA 4J4TA 5F3RA 4I5EA 4CUJA 3GMDA 1U8XX 2PH5A 3GZNB 3NT5A 2DC1A 4Q9NA 1X0VA 1W8DA 1K5HA 3QW2A 4ZQGA 3RC2A 4EEZA 1Q0QA 1TI7A 1EUDA 2JHGA 3OA2A 1E1LA 4DVJA 4CLEA 4BO7A 1LU9A 2QX7A 5JAMA 2SCUA 1RYEA 2UVDA 3CH6A 3KTDA 3WGGA 1P1RA 3RWBA 1AHIA 2X5KO 4PLWA 4RVGA 1BXZA 3GGOA 1ISJA 2Q4BA 3ZHYA 2RHCA 2PD6A 1IHXA 4J16A 2NV6A 3DZJA 1UP7A 2YV3A 4CMCA 1ADFA 3FSRA 2C5EA 1DOHA 4GSKA 2W2LA 3I6IA 4GPD1 4CV3A 1F14A 3ZNPA 3NT4A 1ZK2A 4EDFA 4J90A 4BOYA 1PIWA 5TT0A 4M8SA 4B7CA 5TIIA 1LQUA 1D7OA 4GMFA 2YHUA 4B3JA 5B12A 1T2CA 4B7UA 1LLUA 1P74A 3QWFA 1C0LA 1Y8QB 4MVJF 5I7VA 1UUFA 3K5PA 3K31A 4A5OA 3IP1A 1EZ4A 3NJ8A 3FBGA 3ZCXA 1MC4A 2OXIA 4I9UA 1V8BA 3DBRB 1B3BA 1XKQA 2PKQO 1M6HA 4JCOA 3WBFA 3I23A 3NTQA 1D4FA 2ZB3A 3RU9A 2WD7B 2P9CA 1SB8A 3K9QO 5A3JA 1PX0A 1NFRA 3ETDA 1CIVA 4DIFA 2QZ9A 2FN7A 1Y8RB 3VPSA 4BO3A 1GY8A 5ITVA 4XYMA 2WSBA 3UOGA 4NFSA 1Y7TA 3L6DA 5GY7A 2EKQA 3VOSA 2OP0A 5T67A 4L8VA 3QA9A 3U4IA 3MJVA 1UP4A 5KJFA 3JQ8A 3U4HA 2VHVA 2GDZA 5T6BA 2WJPA 1PTJA 3IKVA 3VDRA 3L9WA 3WIDA 1HZJA 1HSZA 1KVQA 3R6DA 2EJVA 4Q3EA 3RKRA 3ROQA 1FDUA 2IZZA 2C7VA 3ONEA 5JLAA 3D3WB 2PGLA 3IQDB 2OO5A 1TVEA 2BLLA 1G1AA 1UXIA 3PQEA 4EITA 1PGOA 3OP4A 2NU9A 2OUIA 4ITUA 1HETA 1H6CA 4IQ0A 2PZJA 4R1UA 4PIVA 3V2UA 4GWKA 1ZJZA 1ISGA 1YL7A 2O4UX 3BMQB 1B8VA 3QHAA 4WGGA 1E3JA 3T7CA 5C7IO 5G4KB 5DT9A 3NRCA 3MOIA 2C2XA 5KKAA 2BI7A 3ZWVA 3V1TC 1HT0A 3ZWCA 3HWRA 2C2YA 4HV4A 1B0AA 2GR9A 2CDBA 1QYDA 1PL8A 1E0DA 3QIVA 3AW9A 2R00C 1JKJA 3T4XA 2EKLA 3U4CA 4J9VA 2NVWA 1JWAB 1N8KA 2HK7A 2GN9A 3WJAA 3ZWMA 1BHSA 4DYVA 4BO8A 1YH3A 1GL3A 3JD4A 3PFFA 1DC5A 1HE2A 4HY3A 4ID9A 4XKJA 1NASA 5THKA 1LDYA 4WPGA 1PJBA 2VHXA 3WTBA 2QQ5A 2EXXA 2C54A 3SC4A 1BRMA 4KTVE 4QECA 5L4LA 4IDFA 5BSHA 5T57A 3L4BA 2DBRA 1GZ4A 1O95A 1YDWA 3O4RA 3OQ6A 5IZCA 5A05A 4BNWA 2EGGA 2GRAA 2IYOA 3DQPA 4B4WA 4CLXA 4D41A 1N1EA 4D79A 4YT4A 1YQGA 3FRJA 2DTXA 2CZCA 4GL4A 1NPDA 4TWRA 1I3KA 4QT0A 2H9IA 1Y81A 2JHFA 4RZHA 4F6LA 5JCJD 1LQTA 3S2GA 3EC7A 5HS6A 1I30A 4AVYA 4R54A 3TNLA 3WOHA 2VHYA 3DZKA 4W7IA 4ZU3A 2O2YA 3WDSA 1BWSA 2GN6A 5L9AA 4IBOA 3VZRA 1UDAA 1H93A 2C07A 2Z1NA 4CM9A 4YVFA 2FSSA 4MVJI 2PA3A 1VI2A 3DOOA 4GKVA 5DZSA 5B4TA 3EY4A 2G1UA 4PG6A 3A1NA 1E7WA 2GERA 2R2GA 4WOKA 3PLRA 1R0SA 3PGXA 2X5OA 4YDRA 3PQFA 1QP8A 1VJTA 3H4VA 3BHIA 5G2OA 3NYWA 3KLPX 2D3TA 1X7GA 3O38A 1A5ZA 3PP8A 4WLFA 1E3EA 1PZFA 2BELA 2JAHA 5JDIA 5IN5A 2WM3A 1GV0A 2NTJA 2HK9A 3C1TA 4K26A 3GZ4A 1CERA 3AOEC 4CLHA 3TZKA 4WOJA 1EVYA 4W9NC 4YT5A 2AEJA 3AU8A 4TKMA 3HHPA 3GHHA 5F5LA 1O89A 3KSUA 2HLPA 3P7MA 4MVJE 1AXEA 3AK4A 1QLJA 1HWYA 2POQX 2QRKA 3CE6A 1ISIA 1GYPA 3DTYA 4FFLA 3VZQA 1LJ8A 4PLFA 5C7OO 4C7JA 2WYWA 2UV8A 4E4YA 5L53A 2I6TA 2PNFA 2W90A 3AFNA 4PRLA 4ZRNA 2VZ8A 3H9EO 1L7EA 4JGBA 4LSWA 5LC1A 5G0UA 3R3SA 4B79A 4LN1A 1RM5A 5A9TA 3RC9A 3PWZA 2EJWA 1JWBB 3RJ9A 1I2ZA 2GCGA 3GVHA 3JQBA 4J9UE 5I9MA 1YL6A 4D45A 2O3RA 1R0KA 2PZLA 2Q45A 2Q3EA 3GG9A 4AICA 1N5DA 1PGPA 4IDAA 1A9ZA 1KY5A 3I4CA 2FPIA 1U3WA 3DZIA 3NGXA 5F5NA 1KS9A 4C7KA 3DZGA 4CM6A 5BNTA 3BAZA 1XDWA 4JJFA 3SJUA 2WE8A 1D1TA 5DBGA 2I67A 4YT2A 3O9ZA 2DUUA 3PIDA 4IMPA 2GPTA 3GVIA 2VYND 4PLYA 2IEDA 4CQLB 2HU2A 5TF4A 4YT8A 4R4JA 4QO8A 2I99A 1EEHA 1GU7A 1ML3A 2DVMA 4PGFA 1PJ3A 4U5QA 1E3IA 4XJSA 1HRDA 1KVUA 2QZZA 5CP8A 3H5NA 5A04A 4G5HA 3ZWBA 1P9LA 2CUKA 3AI1A 5AXDA 1NVGA 4G65A 4GGPA 4OSOA 1Y1PA 2VWQA 3OQBA 1GFSA 4RDIA 5ER9A 3AWDA 4BKRA 2VZ0A 1UXGA 1ZUD1 3H6KA 2OORA 3LQFA 4IMRA 1E6UA 3F9IA 4OMUA 3QWIA 4E33A 3RFTA 2BFMA 3FTNA 4GGOA 3NJ4A 3VPGA 2B69A 4IDBA 3INTA 2O3QA 3GT0A 2OMEA 2Y68A 4N7RA 4PLGA 3DWFA 2C82A 5JDCC 3O03A 2JFFA 3DMTC 2DTEA 4W4TA 2W2KA 4XJTA 3WGQA 4J91A 4B4UA 4NPCA 4R5HA 4HBGA 3S55A 1BMDA 4AJNA 3IP3A 3PJEA 1AN9A 1DBVO 1KVRA 4IXWA 4OAQA 2E82A 4E31A 4KQXA 2UDPA 1A71A 4B7XA 3D3EA 4CLRA 2Q99A 4BNXA 3FD8A 4HFJA 4D44A 1F0YA 1HF3A 4O63O 1WAMA 1GUZA 4R1SA 2BGKA 5DCUA 3VZPA 4J1TA 1ZCJA 4IQ8A 1GYQA 4ZD6A 5JO0A 1T1RA 2W98A 1M6WA 4ND1A 5I7SA 2I76A 3GVXA 4PZEA 5L7YA 1YGYA 2YUTA 5CDSA 1VE9A 4GSLA 2O7SA 1QLHA 1ZXBA 3A4VA 3KSZO 1YE3A 5F21A 4BO6A 4CM8B 2EP7A 3QP9A 4WLUA 1JKFA 1Y6JA 2IXBA 5HA5A 3WQQA 2P4QA 3WWZA 3E9QA 4DQVA 3DBHA 2IZ1A 4R3NA 3L77A 3C7CB 1OFGA 4XGKA 8ADHA 3SEFA 1P45A 3OM9A 5ER6A 1O94A 2R6JA 5KJEA 3EUWA 3JCZA 2Q1UA 5H82A 3FCOA 4XX0A 3I52A 1HYGA 3G0OA 3I3OA 2Y1CA 5H83A 4M87A 2NU7A 4WKGA 3D4OA 1ZIDA 4E5NA 3N7UA 2ZB8A 4OH1A 4P4GA 2D0IA 4UULA 4JXKA 1U8FO 1XLTA 5TQVA 2IODA 3O8QB 4L73A 5CDUA 1NWHA 4B3HA 4RF5A 1RM4A 3I6QA 1BDMA 5CEEA 1QSGA 5T64A 3DZBA 5K9ZA 1DAPA 1HE4A 3PZBA 4BNNA 2O4CA 4KQWA 1MXHA 4BNUA 4EUHA 4HKTA 3ST7A 1HLDA 3HNPA 1EUZA 3PWKA 4ROSA 4YACA 3ZWPA 4MIYA 3W4JA 1YBMA 3JQAB 4FR5A 4IINA 2AE2A 2D1YA 2YZ7A 4E6PA 1HZZA 1IPFA 3TF5A 3D5TA 3VH4A 4FBGA 3ZHZA 1V0JA 5B4UA 4NJMB 4RF3A 4RLSA 2Y1EA 4MVJG 1MG0A 3ASVA 2P68A 3GNTA 4CL3A 5AQ1A 3VC7A 4BB5A 1XYGA 1G0NA 5ENDA 1C1DB 5LCXA 4EUFA 4UUMA 3KHUA 4MVJD 3EZLA 4E13A 3Q2KA 1V3TA 1B15A 2CSUA 4XQGA 1VLLA 2DKNA 5DOVA 4BKPA 3AM5A 2EWMA 1KEVA 3IUPA 3A06A 4IDEA 4WASA 2D5CA 4A73A 2GYYA 4B3IA 4N5LA 3OFSA 3GOHA 3PYLA 2WDZA 3ZW8A 2HJSA 3NUGA 4PZCA 5COQA 2DFVA 4WLOA 3CTMA 2HMUA 1C0PA 3LT1A 2VN8A 4RLHA 4UUOA 3DXFA 3W6UA 3TPCA 5B4VA 1B8UA 2VWGA 1ZK3A 2DBVO 3AUUA 2B4RO 1KY4A 3H3FA 3SLKA 1E7MA 2HK8A 5CDTA 4L0QA 2AQHA 3LF1A 4N18A 1GZ6A 4PLHA 1JDJA 1UZNA 1DHTA 3I5MA 1J49A 1HDRA 4D0SA 3ANNA 2AHRA 1KOLA 1JW9B 3ICPA 2P9GA 4Q3DA 5U1PA 3EZYA 1NVMB 3LSYA 4CM5A 5A06A 3ON5A 2CDCA 1ZJYA 4DC1A 1PJTA 3C85A 3W4KA 4MVJA 1PSDA 2CDAA 4GLLA 3CKYA 4IZHA 1MLDA 3IIEA 5DBIA 2X0IA 1T2EA 2O3JA 4WECA 2V7PA 1HL3A 4OOFA 1N2SA 3PPIA 4HUJA 3RFXA 1U1IA 2GZ3A 4CMAA 4XRGA 1K0UA 3JQGA 4TKLA 3R1IA 2PK3A 1QV7A 3NV9A 4YWJA 1J4AA 3I1JA 1R16A 3OJOA 4JP3A 4K1LA 3IJPA 5TJ9A 2YDYA 2GSDA 2G17A 4ZICA 3WSWA 4N54A 4RF2A 1DIHA 4BO5A 4PN3A 5ICMA 2OGUA 1ZEMA 3RSHA 3JD1A 3WFJA 3AM3A 2C0CA 4A26A 1XWFA 1X15A 2A94A 3JQ8B 4R41A 1W4ZA 2DLDA 4BV9A 1JLLA 2Y0EA 1ONNA 3PDJA 4FB5A 1PS9A 1QMGA 3ENKA 3RBXA 2VHZA 1N9GA 4IJVA 3CXRA 3RVDA 3RKUA 1NBOA 2AG8A 4OKNA 3OIDA 1A7KA 4DGSA 3IDSA 4MPDA 2Y93A 1H0KA 5C7LO 1QRRA 3WGHA 2VUSA 4PCVA 5EESA 3OSUA 4KOAA 4CLOA 5TLSA 2IYPA 3V2GA 2PKRA 3DC2A 3M2PA 4ZRMA 1SMKA 2PKQP 2V6FA 4DLBA 3TQHA 4KP7A 4AJ2A 4LMPA 3Q1LA 3E5MA 3GEDA 5JY1A 1U28A 4R5MA 4OHUA 2BFOA 1NNUA 2DM6A 3N74A 1C3VA 2ZQZA 4RPLA 4TSKA 5DNAA 1YBAA 2X6TA 2BKAA 2DBZA 1HYEA 1ZBQA 4HNHA 1Y9AA 1GCUA 1M2WA 4ALIA 1ONPA 3M6IA 4RVFA 1YJQA 2IEBA 4II3A 1PGQA 2CVQA 2NUAA 1ULUA 1MFPA 4ALKA 2ZK7A 1PEDA 2NVBA 1GDHA 3AI2A 1U9JA 1A9YA 3EW7A 3NDIA 4PLPA 4JK3A 3ZZNA 7MDHA 3GEMA 3BMNA 4UVGA 4JLWA 3NEPX 3PYXA 5A02A 1F17A 5K6AC 2E4AA 2O3SA 2VRBA 3GNSA 1I0ZA 4FGWA 1T2AA 3MTJA 1PR3A 3G49A 4CM4B 4IXTA 5IDWA 2HKIA 3Q11A 3GF4A 2Y0CA 3V5NA 3OQ1A 1R4MA 4R3WA 3JD3A 3BXXA 1DIGA 1U2GA 4YAJA 4NBRA 1ZSVA 5DP1A 4R51A 2A35A 1MG5A 3Q6IA 1TT5A 2BI8A 3TFQA 1GUFA 1E3WB 4AFNA 5L4NA 1Z7EA 1MA0A 3AM4A 4I9HA 4BMSA 2VZ9A 3DHYA 3HADA 3ZH2A 1UXJA 3ZDFA 2Y1OA 3L6EA 3SVTA 1Y5MA 2BFAA 3RUAA 1JN0A 4CQMD 2ZTMA 1HDCA 1BGVA 1VC2A 3Q9UA 3RROA 4BGEA 4YRDA 3ZU3A 4XR4A 1LXCA 3WS7A 4AJIA 3U0BA 1ADGA 1HYHA 4KTTE 3BTSA 5L45A 4XB2A 3INRA 2E49A 5HM8A 5A9RA 3W8EA 3RU7A 2FPGA 2OHXA 3FN4A 1C0KA 3PLNA 1C0IA 3KLMX 3U49A 4J1QA 5L3ZA 1RYDA 4AJHA 1E7RA 3B1JA 5I8ZA 1SEVA 4OOEA 3L6OO 4BNTA 3LC7O 4IDGA 1EFLA 1ZZEA 1E1MA 3LT2A 2D4AA 1YOVA 1IHYA 1QYXA 4JJIA 5CG2A 1ENYA 3D5QA 1PZHA 2EF1A 5BR7A 4KWHA 4YBZA 1P1IA 1E5LA 4WLEA 3TL2A 1IB6A 1U5CA 2IRWA 2X58A 1NAHA 3HDQA 4W7HA 3SLGA 4RDHA 4ZJUA 5TJHA 4Q3BA 3C1AA 1XHLA 3W4IA 2H63A 4U0KA 3WMXA 4CQMA 4Y6PA 1PU2A 4AJPA 2J8ZA 3KM0A 3BTUA 4K6CA 3JQDA 4OGWA 4CUZA 5ADHA 1B3RA 4UVEA 1O8CA 4IGFA 7ADHA 2AQIA 4BUCA 3WGIA 3WICA 1P1HA 4NI5A 2E6UX 4J0EA 1BSVA 5HWSA 1P0FA 5JC8A 5KJ6A 3ZNQA 1BTOA 1NAIA 1NQ5A 1YS4A 4ZQFA 4EZBA 3Q3CA 4YJFA 4BB6A 1EQ2A 4LCJA 1VSUA 4II2A 3U3XA 1DJNA 4BL5A 2D5AA 5DDIP 2P4HX 1P3DA 5BSFA 1E92A 3GVPA 2I9PA 1NQOA 1PL7A 3MJ4A 1NYTA 5AXAA 1NFQA 4YAGA 1XU7A 4J43A 1SPXA 4FFMA 5IF3A 4MIOA 4G81A 4XR9A 4Y98A 1IZ0A 1I3NA 4IS2A 4OQZA 1B16A 1SO8A 1I5RA 4FJ2A 2EV9A 1PJ4A 4OYRA 1WDLA 2WTBA 5JSFA 4ZQHA 5THQA 1I2BA 2JAPA 1R6DA 2NQTA 3ROKA 5A4DA 4BO1A 4CLDA 3QVXA 5KWEA 4MKXA 2B0JA 3KVOA 4IM7A 1U3VA 4WLNA 2I3GA 4A03A 3D4NA 1HDYA 4CM1A 2X86A 2CF6A 2FPPA 4NU5A 5HBRA 4WCFA 5TX7A 1T2DA 4FQ8A 4XZ3A 1SOWA 2W4QA 2GO1A 3ITKA 4S1VA 5CAEA 1X1TA 2PY6A 5AOVA 1GCOA 1KVTA 4IJWA 2QYSA 4ZHSA 5KTKA 4AG3A 2PFGA 2DU8A 3RUHA 2LDXA 3VH3A 2P5UA 1WPQA 4DBZA 1L1FA 4YEDA 1Q0HA 4BO0A 5ITWA 2I66A 4PFJA 4DMMA 1ENZA 3ADOA 4QTZA 5EQDA 4Z9XA 4DPLA 3GRKA 4BNHA 2Q49A 2CFCA 3HJAA 5AVOA 5T8KC 1MUUA 1JTVA 2VUTA 1ZK4A 4B8ZA 5JY6A 3QE3A 4NDNE 3QJ5A 4DQXA 1E5QA 3FPLA 1KETA 2DTDA 3ONFA 4BNJA 3R0IA 1QYWA 4CLRB 3HN2A 3ZU2A 4TVBA 3ITDA 1ZSYA 2HSDA 1EQUA 3KB6A 4Y67A 2B4QA 3GA0A 1DFIA 3JD0A 4NG5A 4Z9FA 5B37A 2BMAA 5BNIA 1T4DA 4FCCA 4FPXA 1NWCA 2PV7A 2AG5A 4GX2A 3KYDA 1JVSA 2JFHA 2ZATA 1XA0A 1EVJA 3KYCB 3QRWA 4S3MA 4Y6RA 1B14A 4MKZA 3VVCA 2WYUA 4R9RA 3SXPA 1YB1A 1LBEA 5EMHA 4YYZA 5I9NA 1UP6A 4PLCA 3DBHB 4QX6A 3VKVA 5EJ2A 4WE3A 4MO2A 1DC4A 4MVJM 1LRKA 1ZMOA 3GFGA 1HDZA 3OEWA 1HLPA 2VT2A 4NBWA 1LRLA 1ZMTA 1R4NA 3BMOA 3I9NA 1EDOA 3H9JA 5FFFA 5CPFA 4WNIA 1FXSA 3H2SA 3E1KA 4L4SA 3JQCA 4IDCA 4OL9A 1NVTA 2F1KA 2H6EA 3E03A 5JMPA 4CL8A 3C24A 4OQYA 1XGKA 1P77A 1Q7BA 1E3SA 3PIIA 5JXWA 1H2BA 1M76A 4YAKA 4UEJA 1BXGA 4J49A 3QWAA 3WNVA 2J5RA 2NQ8A 1XELA 1OBFO 4M49A 3RUIA 4PLVA 4CMEA 4WJZA 4AL4A 3PVZA 2GGSA 2C7GA 3VHRA 2FZWA 3K6JA 4RV9A 4YPOA 2PZKA 1HSOA 5FEUA 1AE1A 1GUYA 5JYEA 2JJYA 3HSKA 5JCJA 4BQRA 4NMHA 3JQ9C 2AA3A 1F12A 2O2SA 2WEKA 3ETGA 3JSAA 3PHLA 4HX5A 2JCVA 2XOXA 4WNCA 3P2OA 5BSGA 1DB3A 1YJ8A 3H5AA 1ZFNA 1W6UA 1XU9A 3ZV4A 4DLAA 5GZ6A 3IS3A 5IN4A 1XEAA 4IUYA 4JNKA 4CMJA 4GQAA 1KVSA 2Q4EA 2X7HA 3VTZA 2F00A 4BNLA 5JAQA 3TWOA 1ORRA 3VH1A 1VKNA 3FBTA 3VTFA 2YHIA 1N1GA 1FF9A 4BGVA 1T4BA 2WD8A 5JS6A 3WG9A 5JAIA 3LDHA 4UUNA 1NPYA 5ICSA 2AMFA 1RKXA 1GEGA 3U09A 4YJGA 2WE7A 4CMIB 4N5MA 4Q3AA 1YVEI 3K73O 3GAZA 5JAZA 5MDHA 5FI3A 3DONA 1ENOA 3KO8A 3UAGA 1PR9A 2BRUA 4J2HA 2VCYA 1E6EA 3ZNNA 1V9LA 2CY0A 5TS3A 4PRKA 2XF8A 4J3FA 4DPKA 4CR7A 3S2FA 1DO8A 5CEFA 3DZFA 5JMWA 4LGVA 2HAEA 2V6BA 3DL2A 1DJQA 1YXMA 4CV0A 2EERA 2OFPA 2DUWA 1JAYA 2YW9A 3EYWA 4ND4A 2CMDA 4FIZA 1MC5A 3C1OA 3NDRA 3WQRA 4ZA2A 3LLVA 3MJTA 1QKIA 4JX8A 2FRDA 4GVXA 1E7QA 3DAGA 4TQGA 4DMLA 3ULKA 1WLYA 4JN6B 4BNMA 2QG4A 5H81A 2CD9A 4HFMA 3MEQA 2ILTA 2AEMA 3WYBA 1YONA 3FF4A 4CODB 4YQZA 4D3FA 4XEHA 4B4OA 4F45A 1G6KA 1CETA 1AUPA 1DXYA 3GPDG 2HRBA 5I8WA 4BNZA 1CWUA 2NVUA 5MGBA 3LU1A 4XA8A 4Q39A 4ND2A 1VL8A 1LDEA 2X0RA 3JQGB 2GLXA 1IY8A 4IGEA 3WIEA 1R15A 4R68A 3QQPA 3VH2A 3W8FA 3DBLA 2NACA 4NBTA 3D3WA 3TZCA 1S6YA 1DRVA 1GAEO 1RPNA 2FR0A 1K2WA 1QYCA 3HDJA 1LDGA 2Z95A 3NAQA 1YQXA 3ZN2A 3WR5A 5G4KA 3PJFA 2VYNA 4J7UA 5KVVA 5B1YA 4D46A 4LSMA 3OIGA 3U62A 1NHGA 4DLLA 4PG7A 4GI2A 1E6WA 2Z1MA 3HDHA 4IDDA 1ZO8A 5A9SB 1E7YA 2C59A 4BO4A 1SCUA 1MX3A 4MVJP 3RCBA 4CM7A 3HB4X 3FPCA 8LDHA 1A7AA 4CLOB 4XD2A 1LLDA 1R0LA 1SAYA 3RUFA 2ZTUA 3LVFO 2BD0A 2FY8A 4HADA 2I3AA 2YDXA 3PHGA 3E9NA 2JKVA 4C4OA 3DOJA 4CPDA 3MWEB 3WLFA 1K3TA 2FZEA 3GH3A 4IPTA 1VSVA 1DLJA 2RHRA 5EIOA 4ZVVA 2VYVD 1GADO 4NBUA 3KZVA 1PJLA 4I1IA 4XDZA 3GVCA 2DT5A 3WFIA 3V1YA 1F06A 1SOVA 5HS4A 4B8WA 2OZPA 2FWMX 4NK5A 4RVHA 2HDHA 5A03A 1P31A 2X4GA 4RPGA 1UJMA 2BHLA 3GHYA 5JPIA 3UCEA 4ZQEA 3GAFA 3LC2O 1PWXA 3BMNB 3E18A 3RASA 3JTMA 4QFCA 2QIOA 3JV7A 3NT2A 3HZZA 1ISFA 2X0JA 3WMWA 1TXGA 4GBJA 3ONDA 9LDTA 2GN4A 4J2OA 4RGBA 2A9FA 3QVOA 3H9QA 3KRTA 4TROA 1I3MA 5KKCA 4FFOA 3ZWYA 2AEFA 3BHMA 4OKIA 1R4MB 3K2BA 4L4XA 4O1MA 5GMOA 1NPTO 2PLAA 2O3TA 5C37A 1EDZA 3HB5X 1YKFA 1TT5B 3CEAA 4JIGA 3D64A 4YB8A 4PVCA 1UXHA 4OIMA 9LDBA 5G0WA 4EI2A 2CNBA 4D7AA 1BG6A 2P9EA 5LDGA 5T5QA 4RJTA 1U2DA 2VYVA 1ZKMA 3OJEA 4GMGA 3ZGYA 1DIRA 4HWKA 2YV1A 1Z6ZA 4MVJH 4CR6A 3TOXA 4FFNA 3CUKA 1WMBA 3ROPA 4CJXA 5A3VA 3PK0A 6ADHA 1CQJA 1FK8A 5F1PA 4ALNA 3TZHA 2YYYA 3JYQA 4YCAA 1OI7A 3GN2A 3K30A 4ND3A 1P44A 1V3VA 2QYTA 1WDKA 1QV6A 3T7EA 3VVBA 3B6ZA 4LW8A 2GZ1A 1WW8A 1K6IA 3INGA 4Z0PA 3WTCA 1UZLA 1KERA 1KIFA 3MTGA 1YB4A 3LLSA 4YRAA 1AGNA 5EINA 2HMSA 4LMRA 3RUCA 1HE5A 3ANMA 5DCWA 1YOVB 4ALMA 2PWZA 2H5LA 2RH8A 5IXYA 2R00A
chains in the Genus database with same CATH superfamily
4XQ9A 2R85A 3HCOA 1CQZA 3WHLA 1A2OA 1X1EA 3B7WA 1P0IA 4TSFA 3RC7A 3BE4A 4PPGA 3PXXA 1SR8A 3MCVA 2AFRA 1G66A 2EP8A 3IVMA 1QE0A 3RAGA 5FLYA 1UDCA 3EQ7A 3DE3X 4PTYA 2FPXA 3MCWA 2TMGA 5KCMA 4E5SA 4RJLA 1JQBA 3BGIA 4K8OA 1NQVA 2ONKA 3E22A 1O95C 5CJ2A 3RBVA 2A5FA 2P1RA 2QM8A 1LLCA 5IZCC 4BKMA 4IDHA 3PJGA 3W6NA 5K0ZA 3F3SA 1DO2A 2DAPA 3M49A 1UAAA 1EAMA 1RQNA 1IPEA 2Y1GA 1L5NA 1OFTA 1LDBA 1Y1SA 4MNTA 3VKGA 4OHKA 3CR3C 3R9XB 3QKSB 1AKWA 4YR9A 4EL0A 1W93A 3HPRA 4Z7NB 1Y34E 2XNJA 2ODWA 1FRZA 2LCFA 2HQOA 3VR2D 4AP5A 4ISBA 4RLQA 2G09A 3EEYA 1TDJA 3H6HA 3O21A 5FEMA 4TLDA 3MHTA 3O74A 4YUAA 3Q5DA 4BMVA 1PBNA 3UGJA 2FUEA 4IX9A 5IVIA 3X0DA 4YLEA 4RVOA 3EWIA 4Q48A 3UJNA 4N5NA 4FDAA 1OIXA 3B85A 4YJDA 2AQKA 2G0AA 4MAFA 1CEXA 1TLFA 2O5CA 1SKYB 1M2FA 1OHHD 2F3PA 4FE3A 2GBLC 1XPRA 4H6WA 4TTVA 5DBHX 3RE1A 3H7AA 4ZU1X 1JHUA 4EJ0A 1NULA 4RTRA 2OC4A 1NMEA 1ULBA 2XUQA 5HRUA 3GBPA 2IXFA 3T4EA 5JS1A 4HN2A 3T1YB 2B7LA 2CYAA 2H2AA 2FEKA 2UUOA 4MA5A 4UD2A 3R76A 1VCNA 3VAZA 1KJNA 3DEKA 5D86A 2I8LA 4OQDA 2BTOA 3VYUB 2RH4A 2VTBA 5EHIA 3BD9A 3F6YA 1LH0A 4PNZA 3WLEA 4PLTA 821PA 4C1BA 4BX0A 1YUNA 3LKDA 4KBYA 1B0ZA 4ZPXA 3RODA 2I1VB 3FMIA 3DMGA 1EINA 4E7PA 1WUTA 4XDYA 2DPHA 3PQ2A 3PZRA 2X19A 2V9PA 5GV7A 2AUNA 2PS9A 1GPUA 2VJLA 4ED9A 3L1UA 2FPPB 3E9EA 1ZOIA 1EKXA 4BGUA 3L4JA 2BM9A 1EE1A 2PO5A 4FQ5A 5CLHA 521PA 5CAEB 1RWVA 2VT3A 2VJKA 4RX1A 4YI5A 5F9HA 3EGDA 4AY5A 1SUDA 1ZN2A 4EFLA 2ZIXB 1QORA 3EXEA 4E1AA 4MRSA 1V95A 4MRMA 3GD7A 2WU8A 4IJMA 2O0HA 2ACVA 3SYNA 1SJ9A 3WLIA 2PX0A 3LPMA 4DZTA 4W82A 4M0FA 2HIMA 4RCVA 1T6XA 3WB1A 5CH5A 1JQLB 1OFHA 3SJ7A 1R0CA 3W2HA 3I9JA 4EO7A 1U0EA 3B6KA 5KDOA 4YALA 3RNLA 4TMFA 4QZVA 4PZDA 3F9CA 4JOBA 3BULA 4X61A 5LLSA 3ZDQA 3ZGXA 4B3DA 2M98A 1R8YA 1GVNB 5J43A 4YIHA 2ODBA 5BMOA 5EQTA 1FJ2A 1MXFA 1PYGA 1P4HA 3QLJA 1EFUA 4OQ4A 1C50A 5FULA 5FYQA 3V00A 3UMVA 2IQIA 3B2EA 1I4DD 5ECWA 1MEEA 1UKZA 4UCWA 1YR2A 3BRQA 1ZUWA 5FOSA 2BRUC 4B4KA 4M53A 5DB4A 3OLWA 3SD7A 3U3KA 5TT1A 2HPHA 2CF5A 1KMIY 2GUWA 2XAUA 2ZRCA 4KR9A 4TYNA 1PQPA 1ZQ9A 3KQPA 5E3IA 3U7EB 1OZAA 3PJRA 1JBKA 1U0HC 2O1XA 1JA1A 3ISJA 1DKPA 4QJIA 3GPIA 2F8SA 4R9NA 3H0KA 1DKOA 5JYDA 4MRVA 1ZK0A 2JCYA 3FYCA 1L4FA 3A9RA 5ES3A 1I1NA 2WMYA 3PQ8A 4FHEA 3VSEA 1YVPA 2G4LA 2QLFA 1H9AA 1F3LA 1MIOB 2XAAA 3ZI0A 2QVYX 4V0NA 3M5PA 2YRFA 2JARA 1TJPB 2BGMA 1F8FA 4JWKA 3OJLA 3RIEA 1VG8A 4K8RB 3TDKA 1OA0A 1P39A 1AUXA 4HDCA 3NH6A 4HRVA 2B7BA 4D8XA 4EJ2A 1UAGA 5CA0B 4Q6BA 2F64A 2GBGA 1Q3HA 3O82A 1KBQA 2BCEA 1XCGB 4LJSA 2PUDA 4MR8B 4OMDA 1YB5A 13PKA 1D1PA 4TRMA 2X9GA 3X44A 1XVTA 1K92A 4KX3A 3PU6A 4KWIA 3K9FC 1QB8A 4PVDA 2WUGA 1ITZA 3LQ2A 3SIXA 3ECSA 4L72A 2VSXA 2QD2A 3LOPA 3V1UA 1RJDA 5KPJA 1V5FA 2LXNA 3WJ1A 1F48A 3I6ZA 3RIHA 4D81A 3AV0B 5JZ9A 1NVFA 4QKQA 4XJVA 1GGVA 4ANFA 4FP9A 1VFNA 3KYBA 4B6JA 1IY2A 3C98A 3WADA 2Q5OA 4CIDA 1TGVA 2GPYA 3WLAA 1BAPA 2GBFA 3PFCA 3T9FA 2PANA 1EG7A 1L5QA 1VL6A 1MOSA 2Q5CA 4DDVA 2HQ1A 2XB8A 5E6UB 4OG2A 4TWIA 3OC0A 1Z75A 4Q6WA 1KSHA 1X6VA 1UXKA 3G8BA 1GNTA 4FZ3A 3V2UA 1RPAA 4NX2A 3EH1A 3PXUA 4IIJB 4EKIA 3C5CA 3U9LA 5JDCA 1NHWA 4K9DA 4AJ1A 1Z8NA 2VP6A 4JL6A 4JC4A 5CFMA 4OGKA 3K6SA 5CW2A 4ZQBA 3OZUA 1E4EB 4Y2JA 3OZSA 1D4ZA 3ZKAA 1P17A 3L8EA 4AROA 1GYRA 3KCNA 2NG1A 4D80A 3ML1A 5MFZA 2MYNA 3BTOA 4KEAA 1QJ4A 3BVPA 3CRQA 1XZLA 3FRIA 1R6TA 2Q2WA 5FX2A 3E1GA 1KAGA 4G5FA 2QTVB 2COUA 1J22A 3L7YA 4H6PA 4J1TC 4UEKA 4CG0A 1X42A 1KJ8A 2RAFA 4H7DA 4DLYA 3JVEA 4MKIA 3JX9A 4HXGA 1TO1E 1QO9A 1SVSA 1R6VA 2CFSA 1T26A 5HTOA 5F9FA 1I0IA 1IYZA 3REGA 1MO6A 3QWBA 3EXHC 2HO5A 2GZSA 2WIJA 3L4SO 1ZGJA 3KWJA 2BFFB 3O4JA 3OTGA 2HGSA 2VJOA 4FGUA 4FMCB 2CXUA 1W2WB 4DWVA 3AVYA 3SM3A 4BKOA 2GNAA 4AMZA 2Y1FA 4I08A 2R8PA 1IOLA 3FH0A 3KQOA 1XAIA 4P22A 4NOKA 1SCQA 5GOTA 3WNQA 2VNIA 1Z4QA 5CT6A 5G53C 1HOXA 4EBFA 1PFWA 1H6DA 3PG5A 3QFHA 4DQ0A 4G0OA 2IDZA 2WKRA 2O1EA 4H16A 1XKLA 3F2IA 4U7WA 3WLJA 1BWRA 4R2WA 4FI3F 1GZHB 3BHNA 2CLCX 5DX8A 5FPHA 5JNWA 2RGYA 2V7XA 3A3PA 4YP1A 3K09C 2BTEA 4Z2YA 1XI2A 3FLBA 4EQ6B 5GZ1A 1GFWA 4JDUA 1GR0A 2PEYA 1JJVA 1KDOA 4UEOA 4LMBA 4W8OA 1XLTC 4JOQA 4MGZR 5ALOA 3UV7A 3W8DA 5AVSA 1XV5A 5IJZA 2DLNA 2N75A 4L4ZA 1SUIA 4OF4A 3ZWDA 4DNXA 2YIVX 2ACWA 2M1XA 4M1ZA 3B3FA 1ISPA 1FVFA 1G55A 1P3JA 1DC8A 3K0KA 4IY1A 2VLBA 1NR5A 4LNAA 4PTLA 4K3UA 3ETJA 5FNVA 1M67A 1ZA2A 2IYZA 5EXEA 3U5TA 4BVHA 1BKSB 2WKQA 5JSZB 5JH7F 1Y6QA 2YJZA 4IHQA 1Z2NX 4Q19A 1HZZC 1MGOA 3ENNA 4JB2A 1Q1NA 3OT1B 4BXOB 1NP7A 1NUHA 2C2MA 4HXYA 1KEWA 4REMA 4UUPA 5LMZA 3R7BA 3O26A 4IYJA 1KHTA 1UDBA 2P40A 3UV3A 3SHWA 5J3JA 3DBLB 1UBKS 4C7OA 1WD7A 3DCYA 1NW6A 3G2IA 3LYUA 1NRJB 1PK7A 5DN6D 2FPRA 4O4IB 3VR3A 3WSVA 2VP3A 3OD1A 1OC2A 1A72A 5J5VA 2UAGA 3IR7A 2O8DA 5DWDA 5AK4A 1UZMA 2JGNA 1KZ6A 3BMCA 5AVYA 1C30A 4C0LA 1OGYA 5HIIA 1K7FB 1NX6A 1M1XB 4QC2A 5EHNA 2F4VB 2O2EA 4L75A 1DFGA 4XB1A 5K3FA 3SEZA 3ZW7A 5AVWA 1PQUA 3V8VA 2HCRA 4DEVA 3RW9A 1KHHA 4URFA 1ORIA 2EGHA 2ST1A 2PDAA 2G9RA 3FCSB 3JARA 3KYJB 4ZU6X 3L40A 2UVPA 1TU0A 3G6WA 4WZAB 4IXMA 1MJFA 1P6XA 2F1RA 3ZWXA 5JO9A 3O3CA 1TJ4A 4HAZA 3MUEA 5EJ6A 4D3DA 3K5WA 4UHJA 2PV0A 4C21A 3K0HA 5LZ7A 4C22A 2W48A 1AS0A 5I01A 4AU1A 1A8HA 1H0RA 1ZMBA 3DGFC 3F49S 4S0ZA 2Y1DA 3QNWA 2QI9C 1UPBA 1BROA 2H92A 4IP0A 3UQZA 3I6MA 4GC9A 4BMCA 3T4PA 3DZ8A 4D96A 4Z0HO 4YYEA 1Z35A 5DMXA 1RTTA 1A8PA 4NQRA 4RORA 1CUZA 4CMKA 3FPFA 4LI0A 1V25A 3M6WA 3CUYA 2DXIA 4WI1A 2Q3CA 2X40A 2CUTA 4LUCA 1V8ZA 4U63A 1D5CA 1LFAA 1QE5A 2PN1A 1I6MA 1NBMA 2V7VA 3QKUA 4WOBA 1M2OB 1U4OA 1T3LA 2BH9A 4LHSA 1QONA 4OP2A 1WMSA 1NJ6A 5BOVA 2W0MA 1DKUA 2AQ8A 5K09A 3L01A 4QNMA 4WWHA 3SKXA 4JI3B 1SH7A 4ZEMA 1Z36A 1F4LA 3EVNA 4EENA 2IZ5A 2FETA 5HJ2A 5CRIA 4DZZA 3FTPA 3M1AA 2XLCA 3D6MA 3EVTA 3IRUA 4GMHA 4RVUA 4Q66C 2VK1A 3KEQA 3T3EA 2WTUA 3ADCA 3SYRA 1P33A 3RYTC 1CD5A 1E3WA 4MVWA 4QEDA 3GLIA 2CYBA 2I4OA 2NSDA 4JROA 3MTEA 5E8JA 2YWGA 3L7LA 3TD6A 5CA1F 5IKEA 1SKMA 2WSLA 3LQ1A 4DG9A 1NT4A 2G5CA 2IY8A 4E12A 1VBKA 4MW0A 5AKYA 2RIRA 1BU8A 3IPRA 1DQRA 4EY6A 1FMFA 1G20B 2G06A 3OQVA 4NIMA 3HO8A 4NYJQ 1LPNA 3MINA 3CWQA 5B5SA 1YF3A 1XAJA 3V4FA 1BKDR 1GRQA 1KK0A 3H1BA 3RTDA 1FDWA 2V65A 3MGKA 1XQYA 3FDZB 2VIIA 4GM0A 1GTZA 1S96A 1OWPA 4ODIA 1JVBA 3BAFA 1CBUA 1CV2A 2J0EA 4KO8A 5E3JA 5FOTA 2CCKA 4DCTA 1WMAA 3DEIA 1YNOA 5FBHA 2OAQ1 4D02A 1NKSA 1EE9A 5HK8A 4RYDA 3QLUA 2X8JA 3HACA 3ZVKA 2C96A 2JI9A 2XE4A 5BVHB 3IDQA 3LBHA 2Y1KA 4R0VA 2BKUA 2O0MA 1X8XA 4QASA 4N5HX 3VC2A 2B3TA 3EBOA 3C6BA 4J0JA 1U3TA 3EZ6A 1KYWA 1PL6A 2E4VA 4PYQA 5DT2A 2R4UA 3UBMA 5AW1A 3WBBA 1TYAE 3BMXA 5H70A 3GJ4A 4XAQA 3AVQA 3PCXA 5C5CA 2G82A 2YNMD 5BWNA 5KNCD 2MSLA 1P73A 5DCYA 2VTBB 3ADKA 1S01A 3IOYA 3NG1A 4XOIA 2NXJA 2R6HA 2MINB 2IUFA 1JEEA 1Z4PX 5J4HA 5K6TA 1Y7HA 1K68A 2WWRA 3UUFA 1RWBA 3F5QA 1NMYA 1L4NA 3EG9A 2WHXA 4UVDA 4UVIA 1KTIA 1NLYA 1EVIA 1N2EA 4HDRB 3B9RA 3ONNA 4RU1A 1E0KA 4WDQA 4OXYA 4UCFA 3FWYA 5L4SA 4QBFA 2WF9A 3GA5A 4ROTA 2OXTA 1KBOA 3U61B 1EFKA 2BISA 3TRJA 5HJ7A 3F6BX 4M21A 5C0OE 1ZHOA 1FMTA 3E48A 3GH1A 1JR6A 2C97A 2WAXA 4UDXX 4WQMA 5ICCA 4FNMA 5LQDA 2PLRA 1ZH8A 2WD7A 3AR7A 3SE7A 1L7BA 1Z12A 2J4DA 4RC9A 3ZXUB 5KC9A 1NXQA 3X1XA 1M2HA 3D3QA 1QTQA 1LDMA 2EFCB 2ZDQA 4ARAA 2B1RA 2I7TA 4U6SA 4KB5A 1ZUNA 1NU8A 4K46A 4LRSB 1S1CA 1ZMXA 5BYJA 2R68A 4UEWA 5GTDA 3HK2A 2CNNA 5CG1A 1F20A 2XCQA 3JYLA 3CNNA 1Q2UA 2OLJA 1UZUA 3T1TA 5EQFA 5D3MB 2AOXA 4FKZA 2J6IA 5CH3A 4JBWA 4NWIA 4FGZA 4PHHA 1LA2A 4TM7A 1EXWA 1QIEA 4FS8A 3DB2A 4A8JB 3UWOA 3V2HA 4HRAA 3JQFA 2UZ0A 3T54A 3RK4A 2PBFA 3ABIA 1UF9A 3UT6A 4F85A 3C8HA 5EE1A 4K6FA 3AEUA 5AI4A 2VXYA 3HYTA 4L0MA 5KVQA 3TR5A 2COKA 3N8DA 2VK2A 1II8B 3B70A 3CZMA 4Y8VA 4MDHA 5GM1A 3T5CA 1NNLA 1J2UA 3T0FA 2GFQA 2AXQA 4OMCA 4PQGA 4DT1B 1SBNE 2X8BA 2Y1LA 3BMQA 4HNQA 2F62A 1WSWA 3GFOA 5E0OA 2GD1O 4ZVNA 4AB1A 4RA6A 1PYOA 3AIMA 4YP7A 3U7QA 2OXCA 2HO4A 3U4MA 3UC9A 2CWWA 3GDHA 3B20A 1DX9A 3LZDA 4X62B 4E0BA 5FTKA 2XYQA 5LJIA 5DHSA 3ZIUA 1ZGZA 4UMFA 1KR2A 4X1YA 2CNWD 1JT9A 3QELB 4CQNA 1SCBA 3E8XA 1GEEA 1GXSB 2PJDA 4RW0A 4AM8A 2OR3A 3AR4A 4J3NA 4WL0A 5LDHA 1CHDA 3U81A 3V4VB 5DHAA 3ZXYA 4WNYA 4Z5XA 3KKPA 2GILA 4L78A 2G9QA 1NOKA 4K9KA 2J1LA 2CNOA 3IO3A 1X2EA 2YVQA 2JFBA 1HUQA 1M6VA 2WRZA 5C81A 2IBSA 3FWNA 1QNFA 1CYDA 3KU1A 4JWTA 5CURA 5KTMA 4RD2A 4PE5B 2QM3A 5IHPA 4F96A 4XW2A 4Q3NA 5K8TA 4MZXA 5EZYA 4LDNA 3O9MA 2CL6X 3B5IA 2J9YB 2P5SA 2R6AA 2IDKA 3JYHA 4EKDA 4CR8A 2EIXA 5EL0A 5DHTA 4DCGA 1C1YA 4YLGA 3GLGB 4U9IS 4RJ2A 1XN4A 1DKQA 3D1VA 2EKBA 1NRXA 2W0SA 3WWOA 3QEMA 4ZEVA 5I9IA 1W1UA 2D2FA 1UKCA 1CZHA 3HVIA 1ONOA 3GEGA 3FNFA 1LTHR 2L2QA 1NRWA 1D6SA 2REQB 4PPNA 2AZXA 1Q7GA 3RO7A 1KXZA 1MQAA 2O7RA 5ALFA 3CZRA 4L9AA 4TKUA 3CMMA 1EE2A 1W30A 3BD8A 2GAOA 3KP1A 1SVLA 1GTG1 1E6MA 2PJUA 3EQZA 5SYAA 3LHDA 4ZANA 5EEGA 1YI1A 2ANBA 3VPXA 2VK8A 4BFYA 1HDEA 3DFFA 3PE6A 2CWDA 2P9YA 3M7IA 3QMMA 1I2CA 5KYYB 3U6KA 1KPGA 4WD3A 5EKSA 4JVOA 3DAOA 2XCIA 3FR7A 1QVZA 3JWEA 4M4SA 2IPMA 1G17A 4OBWA 4R3UC 2PG3A 3MOGA 4Y2HA 4Z54A 1PN3A 4DBVO 4EKEA 5E9WA 4IYRA 3CVWA 2XHEA 5CPBA 3MWFA 1FE8A 5SZKB 3PFNA 4MB6A 5IVHA 1TQHA 2HF2A 1ISMA 1B26A 3AOGA 3ENWA 2FFBA 4H15A 5FCDA 5AUQA 2B99A 4B6FA 4F60A 1JFFA 1TM1E 4I2VA 4I55A 1WP9A 3BSFA 2QAGC 3K0FA 1ZOSA 4BZZA 1J56A 4LRUA 1F2TA 1M8JA 2LKCA 5K0SA 4WVLA 3LT5A 4V0KA 1RQRA 3M82A 4GMKA 4HSGA 4QUGA 5DE3A 3FUVA 4UM5A 2NU8B 3GWGA 4DRYA 1M73E 5BQ3A 3ROXA 2NZVG 4KUHA 3BJRA 4WCFC 2QBYA 4GOOD 3L7JA 4U7FA 3WYEA 5ADUS 3AHDA 4L51A 2FP4B 1QJCA 3CX3A 4HGNA 5EPOA 3RRJA 3WC4A 1VPDA 4ENRA 2GF9A 4LFCB 3BEDA 4TLBA 3DM5A 4KYIB 1AK2A 2P9QA 3NGMA 3LT0A 2YBDA 2YQ4A 3I53A 4KV9A 4KQGA 3RIYA 1YRYE 3IKTA 3E2PA 1X13A 1ZU4A 3ZC3A 4E5UA 5I9LA 3FETA 1DEKA 2FMXA 3H84A 3SF0A 2X23A 4COOA 2Q5HA 2I3DA 3IEKA 3LUPA 2FE4A 1SVOA 2FR1A 3A6PC 2HNKA 2PYDA 5KOIA 3WGZA 2VKQA 4KGZA 3NGLA 4TT8A 2NPOA 4AIRA 4BMDA 1Z7YA 4JLJA 2PS0A 3FLEA 2X76A 3CC8A 4OY3A 4DL9A 3DDHA 5FA6A 1MO2A 1H6AA 2FR8A 2OG1A 5CDFE 2POCA 1P0CA 1L5OA 2VFAA 1E1RA 3OVMA 2YW2A 3NVMB 5K1ZA 2L17A 3DLCA 4AI6A 1KYTA 1X74A 2Z98A 4C4TA 2QVZX 5T8KA 2KQUA 3VDNB 1X0XA 2EL9A 5KAPA 2ZJAA 1THMA 3SX4A 4EQZA 2BZGA 3PSAA 1T3HA 5K3BA 5AW5A 1NC1A 1T8SA 5D5QA 2CXPA 4CMIA 1P4RA 4IUCS 3LX4A 4ZYUA 5IKPA 4YRZA 4AX4A 4DM3A 3UUWA 1B1CA 4R16A 1N9KA 2AE1A 1URPA 4BYMA 3NLLA 4WXRA 4KOEC 3RIXA 3P19A 3OF5A 2PGDA 4I19A 5CMLA 3DNMA 4PU0A 4B35A 3FNHA 3R09A 1L4KA 1JX6A 1HQYE 4M6WB 1H5UA 3M8KA 4P4SB 4X6LA 5G0TA 2TS1A 5C5IA 1WHSB 2V3VA 3K6RA 4U4AA 1MB4A 2OZEA 2KWIA 3O1IC 4WZ6A 1LUAA 2NMVA 3VHLB 5FORA 1BRTA 3G2QA 1OKKA 1PGJA 3R24A 1GPWB 3BL6A 3MJDA 2Q3FA 3BE5A 3BH7A 3PC8A 3OIUA 5FIUA 1U1CA 3ZE0B 4EWLA 3G59A 5AJZA 3P2YA 1I7SB 4OX9Y 3BFXA 3A1VA 4FQ7A 4TTJA 4BNDB 1UT5A 2OCLA 3R5FA 4JQCA 3UB2A 3BWBA 4U8GA 1PQWA 4KLCA 3CW9A 4S1OA 4BNGA 1KRXA 4G0NA 3OFKA 4DR7B 4NU8X 1KMMA 5TC4A 1U4SA 3F7OA 1FQJA 3F71A 3JYOA 3KNZA 4D9KA 2ZU6A 5EIEA 3OT4A 3TGLA 4ALJA 2KX7A 1OFVA 3KJZA 4Q1DA 3GUZA 3B60A 4M46A 1OA1A 1NN5A 5BUQA 3ROMA 3U7HB 1ZM4A 4OK6A 2WP8J 1SIUA 3G2MA 1CDZA 1U4NA 3K9BA 2X0FA 3GQVA 2HQSA 1S7GA 1TX4B 2XIQA 4BQPA 1EBFA 4XUEA 2BGUA 3CJTA 3A0UA 1HOTA 2MJLA 1T29A 2V8OA 3IO5A 3PGLA 4BJ1A 4CGYA 2O50A 1TMKA 3FFTA 2EBFX 3DAFA 4KO4S 1Z2DA 3PI7A 4Z1MA 4EVRA 1TYDE 3T5TA 3DMYA 1GGHA 4I4TA 4ZI2A 1S0UA 3PKZA 5BSTA 4FFPA 2HRZA 2QYOA 2JCSA 1CY4A 3PT9A 4KDEA 3DVSX 3LECA 5CLQA 3TTXA 4D9MA 4LRTB 1OT3A 2AOUB 4TUYA 2QUHA 2G04A 1CC1S 2A9VA 3JQEA 2C2WA 2Q7OE 5AK6A 3DLBA 1Z2OX 4RSGA 5M29A 2OV6A 1JKIA 4ZKDA 2LUOA 4RPHA 1XSEA 4XD7D 4K9LA 4R8LA 2IPXA 2OCAA 4YAOA 2HPAA 1DEAA 4RKRA 3BFPA 3WRYA 1O5IA 1W0JD 2OL4A 3JQAD 4N03A 3SJAA 3BKWA 3IX7A 5JT1A 1YRAA 1Z22A 2C9CA 1XTIA 3I6BA 4NENB 4B6QA 4CM8A 1Q12A 2ATXA 4KZPA 5KQGA 4LGYA 2EW8A 5BQPA 1C1XB 4LVCA 3I1IA 2IW1A 5BN1A 5ILOA 4DCMA 5BMVA 3MTDA 1PP4A 4FGKA 3P9SA 3VSCA 1FLVA 3K1JA 3S68A 3AF1A 4F3KA 1G291 1PEKE 3L7MA 5CCDA 2RHGB 1VECA 4BEVA 3GJXC 3CLSD 4M0CA 3WXMA 5J1TB 4F8JA 4A0SA 3ZZTA 3SQOA 1QXSA 1W9MA 3JQ6A 1CXZA 4UU8A 1X9IA 3HNOA 4OTZA 5DULA 4BQFA 3ADDA 2RHBA 4LISA 3AESA 1VLJA 2AGVA 4INZA 3DR3A 2QAJA 3EIUA 2WWGA 5F7JA 3ZY3A 1HXHA 1JBQA 1WF6A 3PDIA 4HDSB 3UAVA 5JECA 3T3NA 5IM4F 1ZN7A 4Q03A 2ID9A 1LBTA 2OYSA 1KEUA 4DB4A 1G21E 3ESZA 4AF6A 2Q0QA 4OQNA 5LNK1 5AO9A 4RMJA 2JFGA 4FYHA 3U3DA 3I5AA 4N3NA 5DX0A 1J0XO 4CT5A 2W43A 2IPLA 2Q2VA 4OO3A 1FFCA 2BSQA 3IPYA 4ESOA 2LWIA 3DT6A 2D4HA 1MJHA 2Y66A 1CQIA 2QV7A 3QKRB 4IOJA 4LNUB 2PR7A 4DEXA 4OHPA 1BW9B 1JRLA 1Q7CA 2IXDA 3WK6A 1IVYA 3VR5H 1YTUA 2BIFA 1OASA 4K05A 4NR0A 3S1LA 3RRYA 1UBFA 1IXZA 1VLMA 2JH3A 4BVJA 3FCYA 4LPSA 4KU4A 1M2NA 3EVDA 3LHFA 4DDMA 2CMHA 1CJVC 1FXWF 1X9GA 5A5EA 2ZBFA 4Y30A 2DHEA 2GN1A 1ECJA 1SXJE 2Z8ZA 3FKSD 4JSTA 3SAJA 3L7BA 3FNGA 5CGQB 4RK1A 1GAWA 1OXVA 2IYFA 3QNUA 2J9ZB 3GNQA 1LRJA 3F6PA 3H2ZA 4OH7A 1C1DA 4IUBS 3JD2A 3QIAA 3B1FA 3BGSA 1GAXA 4NP6A 1H9CA 5LB4A 3GEPA 2RCNA 4J4TA 4KV7A 1YFZA 1YIAA 2DP4E 4Z9BA 1MO5A 3CO5A 2J0UA 3L93A 1CX9B 1U8XX 4TZ6A 3ZE1B 2A5JA 4EG3A 2DC1A 1OLXA 2ERCA 4Q9NA 2P2YA 1ABFA 1BE8A 3B6IA 1H05A 2UZ3A 3QW2A 4PQFA 3HP4A 5CX1A 1SC9A 3V7YA 3CJQA 3RVNA 2WB4A 3FPHA 1NSFA 3T5DA 4EEZA 2PAFA 1YS7A 1K8YB 1P9OA 1QCYA 3M81A 1BD3A 5FPKA 3ESXA 2H0QA 1YDHA 2FQWA 2SCUA 5JAPA 5FT9A 4MQFB 4A92A 5TEVA 3T06B 4CF3A 1H65A 3RANA 2WSYB 2X2PA 3WGGA 4HAYA 3M83A 5TGZA 2X5KO 1A95A 3CN9A 4RVGA 1E5DA 3OG9A 3F5FA 1II0A 3KR2A 2PD6A 4IO0A 3DZJA 2ZYTX 4QPJC 4CMCA 3FSRA 1IAVA 2RONA 4HLUC 4PHFA 1AUQA 4PRYA 2FLWA 4HB2A 3ZNPA 3OE7A 5BV2P 4PINA 3MQ2A 1ZK2A 1R8JA 4J90A 2ZUCA 1NF3A 2SHKA 2J0QA 4DHEA 3KTFA 3KB8A 2JZOA 3UXEA 2VSNA 1W4LA 3HKEB 2GEVA 2NT4A 1G64A 2I34A 2J7PD 3WOVA 1X1DA 3VX3A 5B12A 1LLUA 3BB1A 2BGIA 5KMGA 1C0LA 1Y8QB 2WTAA 2VJNA 4MVJF 3AB8A 4K2HA 3K31A 4EI8A 5I7VA 1CUIA 4DV5B 1YRQA 3QLTA 3N3BC 3NJ8A 2FW8A 5NULA 1Y3IA 3L0OA 2GM9A 4JCOA 3RTAA 2Q21A 1EVLA 1QIDA 2GVNA 1SBIA 1W52X 5LDDC 3BX1A 4CIXA 2WWFA 2P9CA 3K9QO 5A3JA 3PNBA 1TK2A 1NFRA 3ETDA 1FRQA 2UUBB 1CIVA 4U2EA 3R0JA 1USVA 4G8CA 1LTQA 4GU5A 4LSZA 4YWHA 3VPSA 1Y8RB 1LPMA 5HHTA 1MDBA 1GY8A 1HV8A 1VPEA 4XYMA 2DHCA 4LV5B 4CDRA 1E60A 4NFSA 4C04A 2CXNA 3ZHTA 4TYQA 1S2GA 2WM2A 4CHTA 3VOSA 4Y2SA 3E0QA 2IEIA 2JIMA 4X44A 2YXBA 3RF6A 3JQ8A 4BEBA 5ANRB 1PTJA 3IKVA 3FSJX 3GWZA 1NG1A 3CURA 1HZJA 3WLRA 2O54A 3BH6A 2EJVA 3ROQA 2AMLA 2JAXA 2AJLI 3EW9A 2C7VA 4QLBA 5TPZA 1KJZA 2X8AA 1BS9A 1D6NA 3W7BA 2XUHA 4MA4A 3A2NA 1TVEA 5HIMA 1YR9A 2BLLA 5AD1A 3BB3A 5LP1A 4K9PA 5GIPE 1PGOA 1MD9A 3GRUA 2C58A 2FNAA 3OP4A 2DZDA 4XX1A 2BFCA 2NXCA 1H6CA 5EWJB 1FTQA 4R1UA 4KXWA 3G2KA 4LJ4A 3TVTA 4TM8A 1ZJZA 5AKXA 1GPYA 3IODA 4WGGA 1KP3A 2WC1A 1J8QA 2ZRBA 3TEMA 3UANA 3COYA 4AK9A 1K8XB 1F8XA 1CE8A 3D6VA 4G63A 2P62A 4LMAA 4TMZA 4F4CA 5DPMA 2CLIB 1CUCA 3Q7SA 1DTWA 1QF9A 2G1PA 2BI7A 4RSHA 3R7WB 1VHQA 3V1TC 5EE9A 1L9XA 4OUDA 2ZT6A 3A27A 1QYDA 5MN5A 3HV0A 3IB3A 4AMUA 2P79A 1E0DA 4M38A 3FMVA 3QIVA 1XN1A 4HNUA 4UPEA 2R00C 1ZRSA 2R11A 2XYHA 4QVKA 3TE7A 2PH1A 3U4CA 3UG7A 4B0PA 1JIQA 1MC8A 3SZRA 2VCEA 1VI6A 2WD9A 3A6FA 2ZSFA 3NDPA 3A11A 1JWAB 1NI3A 2F3TA 5B1SA 3ZPXA 3UA3A 1Z3CA 2OD9A 1CYEA 5EE3A 1YH3A 3JD4A 4BO8A 3A05A 1IZYA 4HH1A 2PYIA 4C1NA 1Y6GA 2WIGA 4H1HA 5THKA 5B6JA 2KI5A 3MCUA 4WPGA 2GPJA 3M3DA 3FHOA 1PJBA 2AYYA 5JHGB 3C45A 3WTBA 2BZ1A 1H8ED 2QQ5A 5KYXA 4KTVE 1PX2A 2OSBA 2Q5FA 4QECA 4XARA 3CHYA 5HR5A 3U6BA 1FSFA 1WXQA 2Y6VA 1EK1A 1J09A 5T57A 1GRVA 1YDWA 3OQ6A 4BAUA 2JLVA 4AKHA 1EP1B 4H77A 1K4KA 1KXJA 1R74A 1N1EA 3INNA 2FX5A 1I3KA 2JBAB 5BWBA 1Y81A 2YV4A 5E2AA 5BWOA 5BYBA 4LS3A 2I8CA 4R40A 2PU5A 3QX7A 4HWPA 5FUVA 3NTVA 4P3OA 1P4AA 2BFEA 1TUGA 2VHYA 3DZKA 4GKAA 2IA5A 4ZU3A 2ZZMA 3IVGA 4Q9KA 1QDUA 4KSBA 4NZNA 5F23A 4P3KA 1H93A 1C3EA 2C07A 2C4UA 3UJAA 3FIJA 4RS3A 1L4YA 1O5TA 3G5MA 5K03A 3GBSA 4GKVA 1SXJD 3EY4A 5K0EA 1V7CA 3AKDA 3FDIA 1ZGCA 4YC7A 4UPVA 4X97A 3WRVA 1U9ZA 1HTTA 1OPRA 3NAMA 3RV3A 3TJZA 4F3NA 5LP6B 2FX2A 1AGYA 3PGXA 1UIRA 5FBRB 1QP8A 3ROZA 4PGAA 3H4VA 3BHIA 3D8UA 4YI3A 3NYWA 1I0LA 3V6LA 5JYBA 4N8DA 4KFSA 5E7MA 2BELA 2Q5LA 4UBOA 1G4UR 2JRCA 5IN5A 3C1TA 2NTJA 4K26A 1CERA 4OLHA 4IIJA 3FE2A 2I2FA 4QTUB 3GJRA 1BEUB 3FYSA 5LA6A 3D2LA 4BX3A 4WXEA 4UOZA 5CT4A 5C1PA 4IWXA 1SRQA 2AEJA 4ZDKA 4TKMA 3HHPA 3MG9A 4FMBB 5F5LA 1DCMA 1O89A 3P7MA 5IKOA 1U0BB 4MVJE 3AK4A 1QLJA 1HWYA 1PR2A 2QRKA 1QQ7A 3KQMA 3LVRE 4O4JF 1T9HA 3QPCA 4URHA 3RHTA 4BUJA 1ECFA 1E62A 4UKDA 4QYIB 2GFIA 4ZVSA 1WSBA 3TIXB 1T8YA 1LJ8A 3GAAA 1DMSA 1NMQA 2AXPA 2B9EA 4KYTA 4MJ3A 1XXHA 2WYWA 5C7OO 2JVKA 2RGRA 3W5JA 4FB4A 2YR0A 2EL7A 1RJGA 1U0SY 3AF2A 4LTDA 2PNFA 1NJGA 3EJ6A 4O2BB 1DT3A 4WDRA 2E0IA 3AFNA 3N8KA 1VIDA 2VZ8A 3H9EO 1L7EA 5FWXA 1H22A 4K9QA 1I4WA 3TGWA 5C8YB 3F7MA 4YCBA 1LVHA 1CULC 2C9OA 2UYQA 1GAQA 4QQNA 4X92A 2BFFA 3HC7A 3SMVA 4LN1A 4H2DA 3R7LA 1A4RA 4QGAA 5DLEA 2ZITA 5IYZB 1JWBB 1R6AA 2GCGA 2FQXA 3JQBA 3H5WA 1KRHA 1RRFA 1M54A 2E4ZA 3LQYA 3O5AA 3QU7A 3ER6A 4NCIA 3G2HA 2ONCA 2R8YA 3DDUA 2A1UB 1ND6A 2O3RA 3I37X 4GQBA 3ZY2A 4B0OA 3KJFA 1LW7A 4BQNA 1CR4A 3WYFA 5I7WA 3EUEA 2ORIA 4C88A 4ZJPA 1N5DA 1HEIA 3DDSA 1KY5A 2HL6A 4ZHQA 1JUDA 1N2ZA 2FPIA 3P2JA 5CFRA 5C9ZA 1D9ZA 1KS9A 3DZGA 1BFKA 4ZOAA 3KAJA 4UJ3A 5LXTF 3ZE2B 1YC2A 4CVNA 1C5KA 3I8XA 5DBGA 1EWYA 5CHYA 5GJCA 2JZNA 2ZR7A 3TRHA 1MENA 4IMPA 5ERXA 2GPTA 2VYND 3PL5A 1L7OA 2CFOA 1N2CB 3HBJA 1Q19A 1B76A 4Q4JB 5TF4A 3TRFA 1D04A 1KJJA 2I99A 1AKMA 1ML3A 4QBTA 1J8MF 2JAUA 1GP2A 5ILQA 5IVPA 4MQ4A 4BX8A 4HNAB 5LYJA 1HRDA 2G5PA 4DLUA 2PGOA 3QX8A 4L50A 5CP8A 3TAHA 1BE6A 4U7JA 1YSCA 4TMXA 2P7IA 4W1QA 2GN2A 2CGEA 4EY4A 1PV4A 4HGZA 4AKTA 5FQNA 1LPBB 1BO6A 2H11A 2OILA 1BH2A 1D1QA 4CG3A 4C76A 4EY5A 1GFZA 2Z5VA 5K0BA 3CLTD 4BZXA 2FQQA 4G0YA 2QTBA 4HD8A 4L5IA 4YBRA 1CQWA 2IIBA 4PCUA 3QWIA 2XUIA 4G41A 2I2WA 3GD5A 3L0SA 1AZSC 3QA3E 4G5YA 4PC3A 4EF4A 2W4MA 3N2IA 1E9AA 2DFPA 3PE3A 4MWDA 1X7XA 4UU7A 3GT0A 2NUPB 5AP9A 2Y68A 1E3QA 1L5GB 3CF2A 5CFNA 4NBSA 3FHCB 5JDCC 3O03A 1J70A 2JFFA 2ZDGA 2REBA 2DTEA 4W4TA 1U65A 3FVWA 4XJTA 4B4UA 2K2WA 1CCWA 3PRKE 3BXZA 3JZDA 5EKTA 3S55A 3B7GA 4UM9B 4NPHA 5LQUA 3RSOA 5HK9A 1M6EX 3EAFA 3IP3A 3IHWA 4EAAA 5GADl 1KVRA 4IXWA 4MR7A 3ZUGA 4E31A 1OCEA 2BR3A 3KUUA 2IF0A 5WRFA 3J7TA 4TKVB 1SHKA 4D4HA 2H1HA 1KIMA 2BJHA 3PC3A 2N47A 4CFSA 1X7WA 5LOVA 4MCJA 3FD8A 4R1QA 4D44A 3LL4A 5EVJA 5ICEA 4O63O 2W9XA 4IDNA 5LU8A 1II9A 2CJPA 3T3OA 4IQ8A 1R8QA 1XZMA 1TJ3A 3JXEA 3WVNA 2IX9A 4W63A 4INPA 4WA8A 2W8BA 2XX3A 3HJUA 1FFAA 3NAZA 3Q8WA 2H08A 2PL3A 2WB2A 3K9NA 3GROA 1KARA 4KR6A 3W5AA 3MJFA 1CJBA 1A7UA 2EP7A 4WLUA 3HXOA 1XYVA 3SYTA 4L8GA 4DQVA 3E9QA 3LGXA 3GFRA 2XODA 1SBTA 3ZJ5A 5LWQA 4OI0A 5JWRA 4XWWA 4HPXB 3DMPA 3C7CB 3FVQA 2VAWA 1X92A 2PSHA 1G38A 4EPWA 2FW6A 4Q21A 4BRUA 2FUG6 1O94A 3OPMA 2Q1UA 3FCOA 4O2AA 1HYGA 3I3OA 3JRXA 4ISCA 3PTAA 2V0GA 3HVHA 1A9QA 4M87A 3SQWA 2ZUBA 3PQ4A 3BC1A 3BORA 3LHKA 2BP7A 3OUZA 3N7UA 1V5EA 3M6FA 4JXKA 2PXXA 1U8FO 1W36D 2VH5R 1MKYA 3O8QB 4L73A 5CDUA 2CB9A 1G20A 3KDPA 3RRZA 4MW5A 5CEEA 5B58C 3WHIA 4NDAA 2ECFA 4PYLA 4A4DA 1V8FA 4B6GA 5I7OA 2QUIA 3DNPA 3L5KA 4GNRA 4KQWA 4BNUA 4BBAA 2FZKA 2B8NA 2EQ5A 2W6MA 3PWKA 4YACA 2EF0A 3ZWPA 3THXA 2O8FB 1YBMA 3N7AA 3L8YA 2YZ7A 2EX4A 5K20A 1MH1A 1M8PA 2FSFA 1XC7A 1UBHS 4PBTA 3D5TA 4MJXA 1PJAA 1V0JA 1RXUA 1GG9A 2PMWB 3EMVA 4NJMB 4YROA 5LIPA 1QK5A 3EEOA 4JFRA 1M1YE 2Y1EA 1K4YA 2EHJA 2OO5C 3KWLA 3MM4A 3PUYA 1YZYA 3VC7A 5ENDA 1PR1A 3B3QA 1GG5A 3GPCA 3HA2A 4WA7A 1EHCA 2P4SA 4MVJD 4UPDA 1XRMA 5BSKA 2JLZA 3WWPA 3HO1A 4K9OA 4Q9IA 4XQGA 5DHRA 3RVRA 4JUCA 5EUCA 2Z6QA 3PQ3A 1CP3A 2WIFA 3DH0A 4UZEA 1RIFA 1N6IA 4WZBA 1FLNA 2J7KA 3SF8A 3IUPA 4F4FA 4IDEA 1U6IA 1JPJA