3VSBA

Subtilisin carlsberg d-naphthyl-1-acetamido boronic acid inhibitor complex
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
274
structure length
273
Chain Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYARGVVVVAAAGNSGNSGSTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords SUBTILISIN CARLSBERG, TYPE VIII
publication title Differences in binding modes of enantiomers of 1-acetamido boronic acid based protease inhibitors: crystal structures of gamma-chymotrypsin and subtilisin Carlsberg complexes.
pubmed doi rcsb
total genus 88
structure length 273
sequence length 274
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vsbA00
3WHIA 1BH6A 1P7WA 2SBTA 3WQBA 1GNSA 4NE9A 2DP4E 5ARDA 1TO1E 1R64A 3GT4A 1R6VA 1SUDA 2X8JB 5AVKA 1PTKA 3LPAA 2PKCA 1SPBS 2IY9A 2PWBA 2W2OA 1EA7A 3SQOA 3A3NA 2V8BA 3A3OA 2Z56A 3TI9A 1T1GA 1GTG1 2W2MA 1YU6A 4CG0A 2B6NA 4I0WB 2X8JA 1CNMA 3D43A 4DJ5X 1GTL1 4H6WA 4C3VA 4H6VA 1WSDA 3DE6X 3D9QX 4BWGA 1JEAA 1TM3E 1NLUA 1AF4A 4KPGA 5JXIA 2PYZA 4LVOA 3DVSX 3PRKE 1ST3A 3P5BA 1Y4AE 3DE1X 1BE6A 1Y3BE 2HD4A 4JP8A 2W2PA 3DE2X 5JXJA 1NDQA 2E1PA 1S2NA 1TO2E 1IAVA 1V6CA 1Y34E 3CO0S 5SICE 3QMPA 1C3LA 4MZDA 3BPSA 2XTJA 3DVRX 3GCXA 3DW3X 2ID4A 1SCBA 5B1DA 3QTLA 2Z57A 2HPZA 1ST2A 2PWAA 3WIVA 3DWEX 1SVNA 3DE0X 1ZVKA 1SCNE 1OT5A 4DWWA 1WMFA 2DQKA 3LXUX 1DUIA 1TK2A 4ZOQI 4M1ZA 3VV3A 2Z30A 3F49S 4B5LA 1VSBA 2TECE 1AH2A 4AKSA 1AK9A 5JMOA 3Q40A 3DDZX 1PJ8A 1PEKE 3LPCA 2W2QA 3DE3X 1SBCA 4HX2A 3DE4X 1KDYA 1SIBE 1GA6A 3TECE 1MEEA 3GCWA 1T1EA 1IC6A 3DE5X 3BX1A 4WOCA 1WMDA 4AKTA 1C9MA 4K8RB 1EGQA 5K7SA 1SBNE 1MPTA 2Z58A 4OMCA 1YJAA 2W2NA 3AJ8A 3UNXA 1Y9ZA 1BFKA 3F7MA 2QTWB 4H6XA 1Y3DE 1GT91 3I30X 1SUEA 1HT3A 1C9NA 2ZRQA 1KE2A 4ZARA 5AQEA 1SBTA 3QFHA 2Z2XA 1SIUA 1YJBA 2WWTA 1AU9A 3EDYA 4LVNA 4OMDA 4CFYA 3AJ9A 4NE7A 1SUAA 1UBNA 2ST1A 2G4VA 1TM7E 2PQ2A 1CSEE 1P8JA 4J94A 4Z2AA 1DBIA 1A2QA 2XRMA 1GA4A 3ZXXA 1BFUA 2WV7A 1SUCA 3LPDA 5FBZA 1SH7A 1SCAA 1TM1E 2ZWOA 2SECE 1BE8A 1LW6E 1SUPA 1TM4E 3WIUA 1WVMA 5JXHA 3L1KA 1OYOA 5ARBA 2WUVA 3CNQS 4HVLA 1SCJA 4GI3A 4WOBA 5JXGA 1T1IA 3AFGA 3DE7X 3VYVA 2ID8A 1TMGE 2PRKA 5I9SA 3EE6A 3PTLA 4FONA 1BJRE 3T41A 3HJRA 1WMEA 1TECE 2SICE 2SNIE 1YJCA 5B1EA 2P4EA 1KDZA 1XF1A 2GKOA 1PFGA 2IXTA 3H42B 1Y3CE 3VHQA 1Y3FE 3A3PA 3I34X 5AMXA 1THMA 2ZWPA 1AV7A 3F7OA 1P7VA 3TI7A 3DVQX 5ARCA 3EIFA 1SIOA 3OSZA 3I37X 3ZXYA 1SCDA 1Y4DE 4KB5A 5CW1A 1NDUA 2Z2YA 1Y48E 2WUWE 1SN7A 1Y33E 5FFNA 1KE1A 4YN3A 5FAXA 1V5IA 3I2YX 2DUJA 3VSBA 3GT3A 3BGOS 1SELA 1SBHA 1GNVA 1GCIA 4KG7A 1R0RE 1AVTA 1Y1KE 4DZTA 1SBIA 4C3UA 4RYDA 5AVJA 2Z2ZA 3VTAA 1KDVA 1OYVA 3DYBA 4CFZA 3Q5GA 1AQNA 1C9JA 1S01A 2PMWB 1GA1A 1GTJ1 4NMXB 1S02A 1ZVJA 3DW1X 4OV6B 3SICE 1SUBA 3VV2A 1TM5E 1Q5PA
chains in the Genus database with same CATH superfamily
2O0JA 3I4LA 1ZR4A 1RFGE 4UM7A 1PQ4A 2WT8A 4EL5A 5HZGA 2ZBQA 3Q8KA 3DO6A 4V0ME 1QX3A 2V6GA 2HA5A 4I1OA 4U39A 3THWA 4FYMA 3OBIA 3PQ2A 2QAGA 4GYKA 4EHBA 2XRZA 3AONB 1CZNA 3C48A 1ACMA 2X1HA 3BWYA 3GT4A 1C0LA 3PUXA 2FPWA 2A57A 3O5AA 4AI6A 2PLFA 4Q48A 1TYAE 3AR2A 4PZCA 1LD3A 4RV4A 1EB9A 1FVHA 2WFLB 5K3AA 3EEQA 2V6JA 3K4QA 1T8RA 2NO4A 1W4ZA 1Q7GA 2HPHA 2PMFA 4NYMQ 1U6JA 3KXPA 5BYBA 1AQLA 3QFRA 2KLBA 5TF4A 4DANA 4DCNA 1Z63A 1U0LA 2WU8A 2IPMA 4ZHQB 3HY3A 5HS6A 1K4YA 1U8XX 2EFGA 2YXPX 2YINC 4ZVTA 4LJKA 1YZYA 5MHTA 1PD1A 1EHIA 1ZOOA 1QF9A 2OD2A 2RJ3A 3Q9LA 2FN7A 3W5IA 4MS4B 2ZGVA 3C3DA 1PZMA 4MP3A 3NORA 3PUIA 1E9AA 3ON5A 4TMKA 3TZBA 4ALIA 4ZC1A 1IB0A 3P1JA 5NULA 4LRYA 1J2EA 3UBTA 2AFHE 4NBWA 2CD9A 5KC9A 4N3GA 3GT7A 4RPHA 1V1MB 3KD2A 1BXZA 3GDHA 3BD8A 3GNSA 4S35A 1F3OA 4F3KA 4LF5B 1GXSB 3I6IA 1D7AA 2WFLA 3GLRA 5DBHX 2EG5A 1U6KA 1P4RA 3PQEA 2RH4A 4OOEA 4AJ1A 2FPUA 2IX9A 3TINA 3QNUA 2NU8B 1TLFA 1WSDA 2IBTA 2YZMA 2A1IA 3IUMA 3NVKI 4JLNA 3N8NA 2XGSA 1PNOA 4CM7A 4ID3A 3OLYA 2BTQB 4LE1A 1Y6QA 4C4AA 4YUZA 5ALYA 2G80A 2C7PA 1XOIA 4JLKA 3VTZA 5FTLA 2M6LA 2CXTA 4IHJF 4CMIB 2X6QA 3VDRA 2DKFA 3ZGXA 1PKEA 1VBFA 4KR9A 1IHXA 1QLHA 1L1RA 2P8JA 3F46A 1MB0A 3TOCA 3WI7A 1CQPA 1UDBA 2YY6A 4RZ2A 5CNIA 5J59A 4WPGA 3SLKA 5CD9A 1V3VA 1DG1G 1QDEA 1RKBA 1V1MA 2AR0A 4I6GA 5ADUS 4Y9SA 2COUA 3FVTA 1K66A 2BSAA 3G8AA 1S2IA 1W47A 2WAYA 1X7WA 4MVXA 4MTLA 5JASA 1IN6A 1QVAA 4FFVA 5KYKA 4BTLA 4R9NA 5KBYA 2IUFA 3CRNA 3M1LA 3ICQB 1ONPA 2WTEA 3Q3JB 3BCRA 2NU8A 1NT4A 3NASA 1C3VA 1DJPA 2VUTA 3RNLA 3DXXA 3K1ZA 5C4MA 1E4VA 1NMZA 2BTQA 1GUAA 1RXCA 5DM0A 3Q9NA 4P22A 4QRIA 1EE2A 4LNUB 4XLZA 5GOZA 4Z7QB 2XNSA 1H2BA 3D6VA 1VJ0A 3E48A 4GM1A 4CMIA 4BQSA 3IUNA 4TMTA 5CIYA 3HO1A 1XDBA 1ZU4A 2QSZA 3QOWA 1PP4A 1JH8A 1SRQA 4XFJA 3LQQA 5BRAA 4OL9A 1JLRA 5CLGA 2NQ2C 4YPFA 3AEQB 2HY7A 4N0DA 4MHOA 4B0PA 2OBMA 2Q1XA 2PX6A 1ISIA 5SICE 1FFCA 3H84A 3DMNA 3QTTA 4LI0A 4YRQA 1OYWA 2P69A 2Q3HA 3GJSA 5TGTA 2B21A 1R1DA 3JQDA 4K87A 4ER5A 4DDUA 1C7QA 2W58A 1YCHA 4YGXB 3WL8A 2PYDA 4MWDA 4AT1A 1E7MA 3PB3A 1FU7A 2X8LA 4FMCB 3UG7A 5BSFA 3MTEA 3IQFA 3ZLTA 1RJDA 4FYHA 4DUYB 1QSGA 2OENG 2AQIA 3GCXA 3IUQA 5AM2A 3OEED 3GLTA 1H66A 1FYFA 4FUQA 4R7GA 3RODA 5FLXA 4LNUA 1XD2B 3EWNA 1Z62A 4GHWA 3WRYC 4BO8A 1IUOA 2Q3LA 3EFOB 1JYFA 1D2EA 4GE3A 3T7KA 3ZQ6A 4LZLA 4HQKA 2I6FA 1ZAYA 5C80A 1PR0A 1SB8A 3JWHA 4Z8YA 3LKZA 3AEQA 4E4TA 3WGUA 4M76B 1F9AA 3P96A 3K53A 1PJ4A 1QO7A 1B8UA 4R0MA 1AUPA 1Q21A 1ML3A 3OOHA 4RQAA 1JZSA 3RS7A 2N47A 3BB4A 3RC3A 3SEZA 2FHPA 1WLYA 2R8PA 2O20A 2Z30A 1JTEA 1TVEA 3F49S 3FUCA 2JD2A 3TTYA 3WA6A 1U2DC 1VSBA 4GR9A 4UBLA 4BNWA 2QEQA 1RPJA 1J2JA 3N0VA 3EVDA 4IUDS 3IYLW 4IAOA 1AK9A 3MRVA 4Q47A 5DLDA 1XD2A 4JU8A 2WYUA 5KJFA 4GNKA 3JVVA 3EFOA 1QR6A 3DKVA 621PA 2QUJA 1RZRD 1Z7YA 3K9NA 2A30A 2IS6A 4OBBA 4UNPA 5ADHA 1UKBA 1NV8A 3K9QO 4BNNA 2D54A 4CV0A 4BO0A 3A9RA 5JIBA 4URVR 1ZLXA 1NKSA 3VYTB 1IN1A 4L07A 3WGKA 2ZIUB 1JXOA 2V7WA 1OUMA 2UUAB 4KHZA 5AK3A 1XZQA 3I9JA 5KVSA 2PZFA 3DZIA 3IA2A 4HEHA 4KVZA 3KLNA 3LZCA 1ECPA 1IDN1 4MV4A 3WB9A 3ZGLA 3L3BA 1N5JA 1SVKA 5A4MS 2ZSIA 3CUWA 1A5TA 3FPBA 3L7AA 5E6SB 4MVJP 1T1EA 1Q0ZA 4EW6A 1N6NA 4QBGB 1MIHA 2ZBUA 3CPSA 3OAAA 4NQZA 4F9TA 4Q00A 4EHDA 1SQ6A 2Z95A 4K8RB 1U11A 4WCFC 3HWSA 1L4BA 4KK4A 3BTVA 2GOYA 5L4LA 1Q0LA 5JHGB 1KGSA 1U3GA 2XVYA 2DCMA 1NUQA 3VKVA 1GUZA 1N0WA 4MMYB 2CNNA 2BGKA 1HE5A 2BIFA 2WWVD 3HL4A 1S6YA 1OIWA 1YMVA 4JSYA 1KH2A 1TZMA 3V97A 4ZJYA 1ZY2A 2TSYB 3EUFA 2X2PA 4G8JA 1PO7A 2EKPA 1QQ5A 4OMUA 4RSRA 3V7NA 4L9SA 3T9AA 3QQPA 4PGGA 1KGDA 1NFQA 3TKAA 3MJRA 2RHJA 4Q1AA 1TNDA 1KZGB 5E6SA 4RTNA 1YB2A 2YWGA 2CLHB 2XRYA 3GFSA 5CAEB 5CIQA 4FD3A 3ZWYA 1QMPA 1U7DA 4ZEXA 3JTMA 3WBFA 1K2WA 5C8YB 4HWKA 6NULA 3SYNA 1XLVA 2POCA 2HDOA 1SWWA 2NTEA 4CMBA 4ZARA 1KEZA 3TLGB 4CN9A 1CFZA 2E2WA 4HRAA 1SKMA 4XASA 5AQEA 3ZZNA 1NVMB 2A35A 2WJ4A 4C30A 4PO1A 1WZIA 3BHNA 4FNMA 1EUZA 4HRXA 2ARKA 5C3UA 2GXQA 5EUBA 1XZCA 2HC9A 3GLHB 1XZJA 5AW4A 4RFVA 2QT1A 3LT4A 1JQBA 5HHTA 1Z0AA 5F51A 3VR0A 1Q2UA 5AXBA 4Y0NA 4XCQA 3LX4A 3SDBA 5MFZA 3MJDA 4UDNA 2ALJA 2JZCA 4HH3C 4WK2B 3FI0A 5CAEA 3BE5A 3R74A 3I6ZA 2WVGA 3PPVA 3WDKA 1NVGA 4GDMA 3NCHA 5C8YA 5CNKA 2VRNA 4JT4A 4DDWA 5B2ZA 1DG3A 1GGEA 1OZ0A 3IT2A 4JHXA 3QE2A 2IZ7A 1G0NA 3TLGA 1FSSA 4C4TA 2WQZA 2QN7A 4B7UA 3SXUB 1HI9A 1P7CA 4N9QA 5AW1A 2J3QA 4G24A 4MIEA 4M9UA 1DAEA 1XTUA 2J0VA 2JFFA 3CISA 4GYWA 4PO9A 5ULLA 4EPYA 4UPVA 3V1TC 4N01A 5BVHB 3RABA 1Z4IA 3GLHA 1NYLA 2HKIA 4YJHB 3AL0C 1JG2A 1TYBE 4CDRA 1L7VC 3KZ1E 3GWGA 4POAA 3LBHA 3HZOA 3F9CA 2HK8A 3O03A 4N3NA 5L3SA 3TTXA 2QRUA 4B45A 4RK4A 4LOJA 5BMVB 2INGX 3LBAA 3C1AA 5EPUA 1B1AA 4FGJA 1Q50A 2HNAA 1L5HB 2TMYA 2AF3C 2HSZA 3EAQA 4LA4A 4F7WA 2KPOA 1UFQA 3QLEA 4CL2A 3H5TA 3ONVA 1C7EA 5F1YA 1B43A 4NCIA 1BMDA 1M6WA 2WFZA 2J45A 1UJCA 2CEAA 3H11B 4CGYA 3IE2A 5DDIP 1M1ZA 3UT5B 3AUJB 3B2NA 4TZTA 4UDYX 5EXDA 1DKMA 4WK0B 4CIWA 5K2MA 3QUCA 3SXUA 2BF7A 3PS9A 3MF4A 4NOLA 3TZHA 1YB5A 2RHWA 3EIUA 3HU5A 3V1NA 1Y6FA 1AUVA 1SXJE 4IOLA 2V4MA 4PRZA 4YJHA 4WXEA 3ESYA 3QXXA 5K6AC 4U2KA 2ZBEA 1CR6A 1VCHA 4XEHA 2WSSD 4NCBA 2BTEA 1H3NA 1UFKA 1ENPA 1VPLA 1ZIXA 2WWGA 4P6VF 4BZXA 5BMVA 2HU7A 1QKIA 1DV2A 4IQFA 3TTSA 5JAQA 2J32A 2V6FA 5CW2A 4Z53A 5K03A 1ML4A 2KLHA 3GXOA 1UJ5A 3UXHA 5EHZA 4UC0A 5E7IA 3GH1A 2SNIE 3H11A 2WSYB 3VSCA 1RWPA 4WECA 4JJFA 1UDAA 1V11B 3JU3A 3UT5A 4QHSA 2ET6A 4ZIRB 1MJFA 1LUAA 1YSCA 4I66A 4AXBA 3QUTA 3QE0A 3EWIA 2AT1A 3WSTA 1ZP6A 4QYXA 1XF1A 3UMGA 2P0YA 5JANA 4HFMA 2H7VA 1MAHA 4X20B 2EL7A 3DHNA 1FSPA 4I50B 3WNCA 1KH1A 5EKSA 3QHPA 4GM0A 2Q3JA 1W5BA 1Z68A 4QULA 3UFXA 1J56A 1J2RA 5FADA 3ZE0B 4DV5B 5ALKA 1JX6A 3BF7A 2RKWA 2R62A 3EIHA 4FI3F 1R9NA 4RNDB 4ER3A 4F0JA 2WHRA 3NHYA 1QAOA 3IVGA 1P19A 1RCFA 1VKOA 2CLFB 1UIRA 4J91A 3TRIA 4DA6A 4ZZ3A 3L8YA 1R16A 4KITB 5ESDA 2B5OA 3LQ2A 3P9RA 4YGYA 1SOMA 4QXOA 4UUMA 4ZMRA 1E77A 1P74A 4C2TA 3K0BA 2BGUA 1DBRA 4ZIRA 1SXPA 1HZZA 3MGBA 1A27A 3AR8A 3RT7A 1J9EA 1NXQA 1WB5A 3INGA 3IVAA 4DR3B 3FHOA 5F2OA 1SK8A 2WAOA 4JKIA 1N5MA 3WK7A 4X20A 2PT5A 4JLSA 1KAMA 4I50A 3G2MA 3LXMA 1TQ4A 4WLNA 1M2VB 3UAWA 2C1ZA 4MGZR 1LU9A 2PS1A 5ALHA 1YRHA 1W0KD 2VWHA 2C97A 3FPFA 3GEHA 3HNOA 2HEGA 1RWOA 3W04A 1NBMD 2VHCA 1F2VA 1BN6A 2RGCA 5FKJA 1FFYA 3Q6NA 5HZKA 2GPJA 3E9CA 1IY9A 3UMSA 2VNIA 3Q88A 3B1FA 3HB4X 5GINE 1YIAA 2ACVA 2P9CA 4L02A 1YS9A 3QIVA 3IUSA 2XUJA 3TJRA 4TN1A 2PUAA 1JSLA 2OVBA 4NYIQ 5IDWA 2IEZA 3A6DA 4LC1A 5GJWC 2GXSA 1UPFA 3NH9A 2ZE5A 4K8OA 4KIFA 3AZOA 3HYSA 4MV6A 1Q0HA 5BWCA 4MQEB 3GYGA 3RF6A 2IGBA 3SZLA 5KSZA 4DIEA 2P2LA 2GS9A 1OIXA 2ZJOA 2BEVB 1GPH1 3ZK7A 1VRVA 2E4YA 1GCIA 1M2VA 4DIBA 1UBRS 1H2ZA 3LDFA 1L7PA 4G4JA 1A9ZA 7GPBA 4FZJA 1U7OA 3ORHA 4ON9A 4ILKA 4BLRA 2VJAA 3M6FA 2QTGA 2H7XA 4QXQA 1UBGA 4TKMA 1G3QA 3U7FB 3MTBA 2C2GA 2OESA 2NYAA 2XQIA 4F96A 1RZ3A 2A58A 9ABPA 2KQUA 5CDSA 1XI2A 1F5NA 5AXCA 3F5MA 4LOAA 4K9PA 2P4UA 2JS7A 1G7TA 3QVUA 1LJLA 1UQRA 1H93A 2OV2A 4GBMA 4O4HB 5IW8A 1POXA 2QRVB 3URKA 2FCRA 1DO8A 1A2KC 2WUGA 3PGA1 4JWKA 1GAQA 4MQEA 4QUAA 4EZIA 4KXVA 5L45A 3QPWA 2C4WA 4YAEA 2VUIB 2Q5HA 4QYWA 3T61A 2NOAA 2QMQA 3OIVA 4REMA 3UB4A 3MS2A 2OYSA 2VBCA 3ZK9A 5DTRA 4A7PA 4YAGA 3QVMA 3JXEA 1FX1A 3OMXA 4LXXA 2VYVA 5KHAA 4CHGA 5KWVA 1ZM4A 5K05A 3K92A 4H3KB 4NH0A 3A6ZA 2WSLA 3K1TA 5F5LA 3PNVA 3QVWA 5FV7A 1K8YB 4QREA 4U7TB 1CIPA 3LCRA 2DH6A 1GG8A 3HUUA 1FE8A 1TKBA 4OHXA 1P7YA 2JFGA 2OUIA 3IOYA 3E18A 4O4HA 2R4UA 3DMYA 5TDHA 3T5MA 1N9GB 2QRVA 3FLAA 4NCXA 3JQRA 4MWSA 3F9RA 3IVRA 2IY7A 3VGJA 3G8BA 3MWFA 4N5LA 3W8EA 2V74B 2ZRFA 2WZDA 3ABZA 1E5LA 1RTKA 3HDHA 3X1WA 4AJNA 1WZNA 1U28A 3E70C 2R6CA 3KHTA 2IHVA 2HGZA 4WACA 3LFTA 2RGEA 4XWYA 1EVZA 1G4AE 2RG7A 3ABQB 3D0KA 4RO0A 1J49A 2SBTA 4FPXA 3WBJA 4JJEA 3HB7A 4H9GA 1XKLA 4A5SA 2GPYA 3VO1A 3T3HA 2I2DA 1EH5A 3K9GA 2DFNA 4L4XA 4DLBA 4KAXA 3PF8A 3PE6A 1NSYA 3AWDA 3B5EA 3PJEA 4PAWA 1V9SA 5CPFA 3RTDA 3I0ZA 1FJXA 1R64A 2GZHA 2A9JA 3RUCA 1D6SA 2HBZA 3NT5A 4YIKA 4L50A 5T41A 5AOBA 2A9KA 1A8QA 4I2VA 4J0GA 4R01A 1A4RA 1PTKA 1N9GA 3A11A 1U8EA 3C5VA 1NNI1 1A7AA 3DJYA 1NUUA 3ROFA 1E3TA 3S81A 4KGVA 3R7FA 4FM9A 4AS1A 2R48A 3BGWA 3NHAA 3BCHA 1IWOA 5AKLA 1RS0A 2NUPB 1JEQB 1OILA 1WLSA 1YGYA 2GO1A 3GVIA 4NYMR 1WTAA 5B58T 3RGWS 5U9CA 1SQ5A 2CUKA 1Q1ZA 1Q16A 4PLGA 4QUEA 4NEGA 3PC6A 3ETGA 4WKGA 4UAUA 1PHPA 3PFBA 3UA3A 3GLHE 4Q3KA 3EDCA 4QFDA 3UUEA 3ZUGA 4EKNB 3JZMA 1RKVA 1CYDA 4KWEA 3Q85A 2Z1MA 4FHCA 4WASA 3RSOA 1LTKA 4A6XA 3RUDA 4CE6A 5FWAA 4US2R 4OIMA 3AQ4A 4I36A 4F4UA 5I8PA 3KQUA 4ZQGA 4XYMA 3I64A 1YDMA 3ZI0A 3PQ5A 1V6SA 3QQ5A 4OHBA 1O94A 2GAIA 3ESQA 3HADA 3KS9A 4GU5A 3KUCA 3L4JA 3UGQA 1E1CB 2FOXA 2MSWA 2YCLA 3IJRA 3HCPA 4UOZA 1CB7A 4FOSA 5COQA 3AFHA 4C3VA 2FGJA 2RAUA 3OCVA 1ZOSA 4WRRA 1KEEB 1U0NA 4DMMA 1TCVA 3D9QX 1WPGA 2NUPA 3GELA 1JEQA 1GQ2A 1BXKA 2DU8A 4UHKA 4XWGA 5G0UA 3RUAA 3GUUA 4BGUA 1ADBA 3GVCA 1ORWA 4I4TF 4E14A 2A59A 1Q3HA 2O1SA 2ZRJA 2VUUA 4ODIA 4RD4A 2PYZA 1U0TA 4G1EB 4MWZA 4PX3A 4UULA 1J8QA 4QDJA 1JLKA 2QU7A 3IVXA 3R0QA 4DLRA 3CRW1 1Z82A 2G63A 3M34A 2Q2QA 5H68A 5TEWA 1Q1EA 3FJOA 4A0RA 1EGHA 4F91B 2QUIA 5TQ0B 16PKA 4HQLA 4DFDA 1KHTA 1D2RA 5DISB 2ZZKA 4BGDA 1B26A 1FQWA 3PJGA 2AUMA 3ILVA 3DDNA 4MQ5A 5B57C 1X8LA 2IRWA 1E1CA 2ZUDA 2YN2A 1OF1A 2G0NA 2WINI 4B44A 3K1YA 2BH9A 2LKDA 5GOTA 3AC0A 1YJ5A 5I8ZA 1SOWA 2EP7A 3LX6A 5KJ1A 1KEEA 5DLYA 4WXHA 4GF5A 4L3OA 2ZR9A 2KE5A 3HYTA 3W05A 3KPYA 4CTMA 1ZJWA 2GAAA 4JITA 4BFCA 2Q5IA 2HI0A 3NONA 1NQAO 3OEHA 3BL5A 1RBQA 3WGQA 5CFQA 4PE5B 4R1LA 3HVIA 3LYLA 4MPRA 4RC9A 1AG9A 2ZAYA 2ZJ5A 2IEAA 2OFWA 1OWOA 2ZJ7A 3D8BA 1GL3A 3KT0A 3QE4A 4F7DA 5I48A 1Y34E 1ISJA 2HX1A 2JI7A 5TQ0A 3ZEIA 5AJUA 1KMQA 2Q1WA 1VB3A 3BULA 3K6SB 4I6JA 3UQZA 1ZX1A 2DWOA 1TC1A 3MELA 3PFCA 3V1UA 3WGHA 3RTAA 1UL1X 3MPUA 2XH8A 2WB4A 2HGSA 2P79A 3H05A 3SYMA 4I1RA 3M9WA 5BW4A 3S3TA 3IELA 4JZYA 2GESA 4HQ6A 4KLCA 3O38A 2LIPA 3F5DA 5EXSA 4ESVA 1YJXA 1W6RA 3MSCA 4RGVA 1IM8A 3DVRX 4R2HA 5DLEA 2RC5A 4CLDA 1P9WA 1SR8A 1NLYA 1M33A 4UCFA 4A1OA 3U7HB 3H2GA 2PL3A 2J4CA 3TM5A 4B33A 3AVYA 4YV7A 2WNSA 1CEQA 3ASYA 4G2NA 2WE8A 2YDXA 1QP4A 1U4SA 2O1EA 3O3OB 5CVVA 1ZCAA 5ES3A 4JNKA 5IJXA 3HZRA 5B3JC 3B3QA 1AXRA 2HHCA 3DBHA 5HFAA 2CXQA 4U8HA 5ES4B 1E60A 4X8HA 1Y9AA 4DDVA 3FLEA 1RWNA 3UAXA 4L5YA 2FE4A 2LBPA 1JT2A 1OVMA 4CT5A 5B55A 4JJAA 4RX1A 3E7WA 4ZCMA 1EDBA 3MUEA 3V7UA 4CQLB 5LFAA 1E9EA 4BMVA 2XD4A 1K7YA 3ISTA 3DLHA 3FYTA 5KC8A 4G1UC 1WCYA 4NXMB 1PWXA 3AIOA 1SGWA 1Y1SA 2ILTA 2FEXA 2YDYA 3BJMA 2BGJA 4E4RA 1V5EA 2PGDA 1ZOPA 4BPRA 1EB8A 1NU8A 1AH2A 1GQQA 2PEYA 3DHYA 3FOZA 4JDUA 4LJ4A 4EELA 2DY1A 5D86A 1NUPA 2WKSA 3CEMA 5C1IA 2O7QA 3UJCA 5KPDA 2A4KA 3HCDA 1G20B 1X9IA 1PG0A 3CRZA 4YHHB 4GWGA 5KJ6A 3ER9A 2DYKA 2P9BA 5HFNA 2I3ZA 5EG5A 2W71A 4RCVA 2GT1A 2HDNB 3RD5A 3GLSA 3UEOA 4JT8A 1ZUD1 3DE4X 2HOQA 3JX9A 4CQLA 1VLMA 1A8UA 1TQDA 2AX4A 2B92A 4JVMA 1G1MA 3OCXA 1JPVA 4QIHA 1KH3A 3NEPX 2JCVA 2P3QA 3CG0A 4M36A 5FUBA 2NVUB 2JLXA 2D3TA 2Y6VA 3GBVA 1FZQA 2A8YA 2C78A 3PT5A 1COWD 1FMFA 2CD7A 1GPLA 2KS6A 2HMVA 3LVQE 4YQFA 2HEIA 3CFYA 3BDVA 3D4PA 3F71A 3O1HB 4ROSA 4M87A 4WOCA 5JVDB 4IGFA 1FU8A 1Q1QA 2XTMA 2XQGA 5C1OA 1WZ2A 2QN2A 1C9MA 3W2HA 1G20A 3GAMA 3GLUA 1GGHA 1YFZA 5CX4A 4HRVA 4URFA 2GZ1A 2PXAA 2AXNA 5KTSA 1B23P 5K7SA 3IEPA 2GEDA 5JCPA 2QD4A 2ADOA 2P30A 1CDDA 2PCJA 3ZGZA 4TZ6A 2Y93A 1BFDA 2CJFA 3U3RA 1X0XA 4HL6A 1H1DA 4DRZA 1RYBA 2X5NA 3ETLA 5E4JA 3NOQA 3PEVA 3KOMA 4BX3A 5I45A 1ONBA 2FUKA 3GJRA 1QYIA 3GUZA 1FIUA 1M6VB 2CLEB 2NVUA 3EUEA 1QR2A 2QLLA 3PX2A 4IRXA 3VPGA 4DNOA 4BXOB 1BZYA 1XZEA 4DDHA 2AYYA 2Q27A 1G8PA 2QGFA 3OC6A 3N2EA 3STUA 3R0VA 3CC8A 4C0AC 4E5MA 7ABPA 1YBMA 2QX7A 4OM8A 4UUPA 3CT6A 4ZKEA 1WY7A 1KC3A 1X7ZB 3B6IA 2GCPA 4JI5B 3TQRA 2C0PA 2OSBA 1Q22A 1ZD3A 5AM1A 1WXWA 2FWRA 3U13A 1XMXA 2HJSA 2ZRQA 4KDCA 4AWXA 1JQEA 2XX3A 4PR0A 4DR7B 3A1DA 1JR6A 4XD7A 2BWJA 3PBKA 2H4JA 3WLHA 2OP1A 3B89A 3J81k 3P2EA 4BJ1A 1B2LA 3SI7A 2WD9A 4MWBA 1OQAA 2I54A 1SIUA 3KT3A 3OPYB 1RPAA 2XNJA 1ZH6A 1DRUA 4DDMA 1ZIDA 1M6VA 1NP3A 2PK3A 5IJAA 3QX7A 4D9MA 2MSEB 4DILA 3LCMA 2ZSUA 2IDZA 1NZDA 4LCEA 2C0CA 1DXHA 4JOSA 2ZTMA 1G291 1PGNA 2FW8A 1YDHA 3Q5EA 3IMCA 4LGVA 2LCQA 4LN1A 4MK4A 5IZCA 5CITA 1JILA 1SY7A 4EJSB 2C4VA 1KSGA 1R37A 4C0KA 3PHBE 5MDHA 3B3GA 3V2IA 4DMGA 4QEDA 1Z4NA 4RHUA 3MQ2A 2BRUA 3KSAC 5M5BA 4OGLA 2H6EA 4GQIA 4IH9A 3ZJTA 2Q29A 3VZDA 3AHJA 5IP5A 1IXSB 2ZSBA 4FDAA 4OLAA 1J06A 4E2WA 3H1TA 3L8CA 3OPYA 2FQYA 1UBUS 4MEJA 2DHDA 1DBIA 2C2ZA 2OPBA 1Z0JA 3JD3A 3IEXA 5F1OA 4B6PA 3WLLA 3ZXXA 4JFAA 4V0SA 3ILHA 2WNHA 2Q9CA 1SUCA 4J4TA 5TPZA 4GPAA 3E84A 1UDXA 2B1IA 2EW8A 1A98A 1TM1E 1UEIA 1X1QA 3BHIA 4QOJA 3EIEA 3INYA 1Z0UA 3N2YA 3KQOA 4LBZA 4ZOEA 5DHAA 2YFKA 2ZRHA 4ZRMA 1M6EX 5A0VA 1YUBA 1XHFA 1I36A 4FFRA 5DHTA 2QR5A 5JXHA 1RM5A 4KN8A 2JRCA 4LHYA 1KOLA 1GQRA 3ZV5A 2LIVA 5E3JA 4ZVUA 1GG2A 1BGXT 4A0HA 2JJYA 3F8SA 2R1TB 1OH8A 4XB2A 2AWNA 4RH3A 1KP3A 3M1IA 1DB3A 4U2GA 4TLDA 3AR5A 1DRWA 3ZWVA 2BY4A 1T0UA 1T1IA 2IYVA 5HKKA 4HDOB 2W8BB 2YJ4A 2NP6A 4RNCA 5BWMA 5JYEA 1FMLA 3EZFA 2PX8A 3Q0TA 2C5BA 1FUEA 1GU1A 1Q0QA 2Q4DA 1FQJA 5C3MA 4M89A 4D3SA 3PFNA 1JHZA 5LP6A 2C7OA 3KOUA 4L5BA 2GXAA 3E1KA 2Z6VA 1KAGA 3Q6MA 4LG1A 5DRTA 4DG5A 3OQVA 5BR1A 3EMDA 1ZIPA 3M3PA 1E1QA 4D8YA 3S8MA 2FLKA 2VDJA 3NQ41 2HA3A 4RTPA 3E8SA 4J0DA 2XGOA 2EKQA 3RAEC 1T25A 3BD7A 2XITA 3KUXA 1TYDE 4OHUA 4PBSA 4F85A 1ZXXA 2O23A 3PI7A 4DMLA 3MG9A 4YTEA 4QBIA 5KYTA 1PR3A 3OY2A 1Z8FA 2R1TA 2QUZA 4A27A 2VJMB 3HZHA 4J3NA 2BGNA 3D4LA 2VUSA 3PQFA 4CMKA 2D2FA 3WDLA 3BWVA 2ZSJA 4EEXA 2JCYA 1QVRA 1OFIA 2I6TA 1CQIB 1ES9A 3RVKA 2W8BA 4CQJA 3L4KA 1RHUA 4I4NA 2QPOA 4LWOA 2K2QB 1FXUA 1WHSB 4TVKA 3W77A 2J09A 4MOWA 1NJ1A 2G5TA 3S4YA 3M3DA 2PE5A 4QPDA 4KXUA 1LY1A 3NKVA 2GBLA 4WA7A 1RRPA 3BGDA 4QODA 4OAOA 4I4LA 3ZLVA 4CUKA 4FEEA 4CI0B 2CV0A 3D4IA 3F5SA 3LQRA 3WGNA 4MXDA 2WTNA 1C5KA 4CEJB 1ZSYA 1MXFA 5ITSA 4GL4A 1ZUWA 4PO8A 4G8CA 4OGWA 1IPHA 1RDFA 2EQAA 2PRSA 3JR7A 3NC4A 5GPBA 4UXIA 4KTVE 4BQNA 2VJMA 2H2AA 2HJVA 1XZHA 3NHSA 2Q6KA 3L6DA 2ATXA 1MC4A 2CXOA 1HORA 3OCJA 2Q45A 4O5OA 5JJ5A 1CQIA 5LPNA 1I2MA 4PCLA 1WHSA 4BX9A 4G0MA 1H6CA 1BWQA 4EF6A 1KOFA 3N5CA 4L6CA 1E2NA 2H4YA 4YEDA 3L0CA 2IS1A 4ZU3A 2XMDA 3KQVA 4B09A 3I72A 1VJCA 5BWNA 4OFZA 2P6MA 3IAHA 3OZXA 1BROA 3SFZA 3AFIA 3WLNA 2GLUA 1P73A 3MT7A 1XMJA 3ZIAD 1D07A 1J22A 3L5OA 3ONFA 4PPQA 4CEJA 1U9ZA 5J40A 5DX1A 2PT6A 3B6EA 4D3ZA 5AUOB 5FAXA 3ADKA 1I51A 2C0QA 1H2AS 5KTTA 1E79D 2H7YA 3DF9A 3TZ6A 5CFOA 3F6SA 4WBNB 1VSTA 2QV7A 3TLXA 1XPRA 3EVBA 2F55A 2GD2A 5CH8A 2I2AA 2AYZA 1P17A 4HQ0A 3LAWA 3HEAA 2A0WA 1A5BB 4AZTA 1MRZA 4MCJA 4QGAA 4IS3A 1K7EB 1QIDA 3LTNC 1YZFA 5AUPB 2R0QC 3D81A 2HWKA 4QPPA 1Z6PA 5JS1A 1X15A 1BKYA 5BSGA 5EMNA 3U1BA 4FIZA 3AB7A 2B36A 2ZBVA 4Q3LA 2JH8A 4DJDC 4C7KA 1P2VA 4E30A 4UM9D 4DAEA 4YAIA 2HT1A 1NY5A 2C9DA 1T8TA 2FQ1A 4GX2A 2R1VB 2X9NA 3TOVA 1SXQA 1C1DB 4YUWA 1UP4A 3QWFA 1G20E 3CN7A 1XLTC 3UJHA 2PGLA 2BELA 5H4GA 2V1XA 1QH0A 1E3DA 1ZVMA 4WBNA 2PD6A 4NQRA 3GV0A 2IUYA 1NURA 1AQUA 5FX2A 1PFWA 4JUAA 1KSHA 4AMVA 5EIBC 5D5HA 1LRKA 4NNOA 3LG2A 4HB0A 4RAOA 1HMYA 4LFCB 3SHOA 4QVIA 2N42A 5GIPE 4C4YA 4M98A 2HQRA 2R11A 2TYSB 1U1FA 1WOYA 1G4HA 1Z47A 4J3JA 3B1VA 1E9DA 5I3ZA 5JPDA 2F8SA 1YQGA 2ZATA 2IHJA 1DZ3A 4CV2A 1GTJ1 2F1OA 5D1HA 3UUGA 4NIMA 4ENTA 1P9OA 1M2OB 1ZVJA 3P26A 1FS5A 2ZI7A 4Z3KA 1C1DA 4M7WA 2BHRA 1U3WA 1PTJC 3AUFA 4NICA 3IOMA 4I1IA 5K0ZA 2BFPA 1TM5E 4KWTA 1PU2A 3G2JA 4E88A 1JB9A 2ACKA 4MWEA 2OCYC 2EKLA 1VSVA 3W9YA 1TXGA 1F1BA 1LPSA 5DO9A 3WQBA 2IGTA 1XNGA 4RA6A 4B7XA 4TOIA 1HH4A 4F2GA 2B5WA 4IVNA 4FD2A 3IOEA 4RL4A 3WYNA 5DGCA 3H5IA 1VL0A 3PNMA 2FN3A 3A0RB 3LHDA 5G41A 2JIZA 1AKRA 3KJXA 4MLPA 1N1EA 3KJZA 5B3LA 4Q9HA 1U02A 2ZIEA 2J5BA 1I10A 4MDHA 1FNCA 1M2OA 5ESRA 3IKJA 1I4LD 4GUAA 2I2XB 5FXMA 4ZDWA 5KHOC 5LDDC 3Q8XB 3RBAA 3GFTA 2BBWA 3ROXA 1D9XA 2ECOA 2G36A 3A6EA 3NBYC 3PQCA 2XI4A 2Y1FA 2QW1A 3HN6A 1O6BA 5FHRA 1FYWA 4J0IA 1JFLA 3OF5A 3OJ0A 4C7VA 1L3BA 4D8UA 4F86A 4IL5A 1CDOA 3L01A 1DCTA 1HG0A 1XCGB 4N0PA 1QRTA 2QMUA 4LYDA 3OHMA 1W46A 2QRGA 4S24A 2IYOA 3BUSA 4D6XA 3IRVA 1N2IA 3V7WA 2YWHA 3NJRA 3OM0A 4CF4A 5LZ9A 1L5ZA 1E2HA 1TJ4A 4HNAB 4EMUA 4MRAA 3L4EA 1U0FA 4GBGA 2PVSA 2DT5A 4CLXA 1HEYA 2QAGC 4KXYA 4MLDA 1P61B 3HB1A 3L8MA 3V9AA 4DJ5X 3SS9X 5JNUA 4X84A 1SULA 3KDAA 4B85A 1LGYA 4M1YA 4PLFA 1JKFA 1WF6A 1XEFA 4GQBA 5FOXA 4TYYA 3DULA 1E0AA 4N6GA 5E0OA 1IBSA 3WNVA 2H57A 3SZRA 3DHEA 2I7TA 1AGNA 1JEAA 2J3DA 3JVIA 5ECYA 2R1UA 4HGYA 3U0VA 1I5OA 3UJBA 1JP7A 3U7RA 4MVYA 1PLLA 2G0TA 3DDCA 4M9ZA 3KEQA 4MDEA 2PS3A 3HR7A 3LYUA 4AN4A 3F0TA 2DUNA 2FPPB 4RS4A 1NE2A 1PZHA 4UMDA 1GFIA 2BZSA 1U1EA 2RDMA 2XUGA 3ONWA 3EJWA 4NK5A 2YWJA 4HNAA 1XZKA 2H8KA 2AN3A 4LWPA 4P84A 2IYFA 5ETJA 1U63A 2ZU0C 1RQ2A 1N5OX 2CK3D 2FN4A 2IHYA 2VDOB 3DCNA 4WXRA 3P27A 5I9LA 1UZMA 4B1FA 4YCSA 5DNYB 3H1AA 3NGLA 1FDRA 5L3ZA 3ZXIA 4PAMA 1X1RA 1U3UA 4WN3A 2KWIA 1JSZA 2PZKA 1XA3A 3ADDA 3NDBB 4I2NA 5JTTA 1H65A 4DABA 1OAOA 3HO6A 3TAHA 3UIEA 1T1RA 3G02A 4HRYA 1E2BA 1SO8A 2E1PA 3LF1A 2QN3A 4OK3A 2FPPA 4W8GA 2G1UA 3GLGB 1JMKC 4HNUA 1XNQB 1Y1RA 3V46A 2I8AA 2XA9A 1SEPA 4P4GA 4DA7A 5AVXA 3AR9A 5JUWA 1KMMA 1XTIA 4HPXB 1JKXA 3JYPA 4ND4A 1B1CA 5ICGA 3C6ZA 3FKJA 2K87A 2DPYA 1RI2A 3LKDA 4RMNA 2YR0A 1XZMA 1ZM7A 3GFFA 5FNVF 2X5JO 4AP6A 3O8RA 5EMKA 1FQOA 3I9KA 1JJAA 2Z4RA 4PX2A 3T9BA 1VTKA 4OJMX 4J0CA 4ZT5A 3GD7A 2IQIA 1QHNA 3ETCA 3NBFA 4R6WA 3SCZA 3TRHA 3WRWA 4DOMA 5A4AA 5EJ9A 1X39A 2QTVB 5FA8A 1SXJC 3N0TA 5KDLA 1WKVA 3WYGA 3LC1O 2JGJA 1QAMA 3PHIA 3RV3A 1IAQA 3NYRA 3PCXA 1ZD2P 2L2QA 4C3OB 3ZQJA 1DWPA 1SCKA 3HMKA 2DBQA 1YR1A 5FUXA 1PVVA 3GLGA 5JATA 3CGGA 2NP7A 6ADHA 3AR3A 3DWEX 1DZIA 2VFAA 3SSMA 3TVTA 3V8NA 2XUDA 3PHJA 1ZJ5A 4XOIA 5LWQA 1D2NA 2AOXA 4HFRA 1P5RA 3CT4A 4KQKA 2NSYA 4MX8A 5CB0A 2EKBA 4DF3A 2ZR0A 3L7JA 4DWWA 2JJ2A 4C78A 2HHLA 1S2DA 1TB4A 5CR9A 1KYTA 3SM3A 4DAOA 2I8LA 4EHIA 1G8HA 5JDCC 4S0XA 5BORA 4FR2A 2WAAA 4PYOA 2BKVA 1L9KA 2QTVA 4ZOQI 1I0LA 2PXCA 2G1AA 4FNGA 4DV3B 3JQEA 2VPWA 2G5CA 4ZHQF 4LMBA 1ABBA 4M1MA 1RM0A 3NVAA 5IMSA 3HFJA 3CH6A 3PVSA 3EWAA 3KX2A 1TM2A 3GGDA 4GVXA 2AJ8A 4TSKA 1PNTA 1P4SA 1UQTA 1CUIA 4UUBA 4RY8A 5J2TF 5ENDA 2CLIB 1WXDA 2WZCA 3NDRA 2XKJE 1ZG3A 3T5GA 4P86A 3B2EA 2PFSA 3TVYA 4FYWA 5CXSA 1PEAA 2CDRA 2IEYA 3FTDA 1DFGA 4HX2A 5AKYA 1BAPA 2I2CA 1K9SA 2XT6A 5KOYA 4IMJB 1KO4A 4XTCS 3NV9A 3SMVA 4RVCA 4YH1A 5J23A 2OV4A 4BWYA 4EUEA 3A9CA 1Q11A 3O6VA 3T54A 1UWKA 1YRWA 2V7EA 4F5EA 2P6UA 4XX0A 5JHHB 1I5EA 3NDIA 2B1QA 4FZVA 3G13A 1XMSA 3RYHB 2W11A 2ZETA 1OA1A 4X6LA 3L82B 1LPPA 4GAEA 4AULA 3AG5A 2HWXA 5KNDA 3H9EO 3WL5A 4LF4B 2I3DA 2EJVA 1C9KA 1BWPA 1BQEA 1DQSA 4G86A 3M6WA 3DEZA 4PTZA 1LI4A 1PKXA 1NFFA 2ES4A 2HIHA 4IVQA 4JVLA 5I8WA 5CT8A 4BVLA 1Y7PA 1QUEA 2DBYA 3GAZA 4G36A 5EE1A 4I1VA 1HRDA 3ACCA 4Y9UA 5EESA 5EJAA 5H1YA 1EINA 1K06A 1SBNE 4CIVA 4GVPA 2O57A 1T10A 3C3MA 4G67A 4OHPA 5HBRA 2XECA 2F6RA 3IIMA 3W2EA 2B3DA 3CH7A 4UZEA 1T4GA 4YJ3B 3U17A 1J42A 3TR5A 3P97A 2F2TA 1NAHA 3VJKA 4EZBA 3EG9B 2QYOA 5BN5A 4KXLA 1R27A 5CXQA 1U9JA 3RASA 4XB6B 1WSAA 4KAAA 1U90A 3OX1A 2NT3A 1UDWA 3ZH9B 3I30X 3OFNA 4W5WA 2R8BA 2RAFA 1SUEA 2RG1A 4DA0A 1FNBA 1AHIA 3ER6A 3SF8B 2VPYA 3PNKA 4JJKA 5JMWA 2XSZA 4U6QA 4BUJA 3MLAA 3H2ZA 4BRZA 1J7JA 3WADA 5ALVA 4XIIA 3ZU2A 4E3ZA 5TE9A 4ARIA 1P60A 1KBZA 3PWKA 1RRGA 1JDVA 2CFIA 2VXBA 3FTCA 3GX1A 3SS8A 4Z5XA 2O52A 4JOCA 4KK3A 4HTAA 4RWEA 5HCNA 1YD7A 1YZVA 1LPAB 3ND8A 4I81A 4ZGWA 3JARB 1XCBA 1JG3A 2CJYA 5DULA 2X0RA 3SP1A 3QKSB 4YJ3A 2C58A 4LAFA 3WAJA 4BMXA 3FIJA 1QNFA 3AP2A 3EG9A 4KSYA 3WMGA 1HDIA 1G8FA 2JAXA 3RI3A 5FTKA 1OU4A 3QUAA 5H4HA 2ZW9A 1DARA 3RS4A 3X1XA 2Z3WA 4BBAA 2YXNA 1ORDA 3IBTA 3C3EA 2ZCUA 3GEGA 3T4EA 3B6ZA 3AO0B 3F67A 1LWOA 1EQ2A 3SF8A 4D0RA 3AJEA 3TVDA 2ZVDA 5AJYA 4PGMA 4ECAA 4CMCA 1UKAA 1GN9A 1DOZA 1OFHA 4G89A 5LMUB 1YQWA 4GRAA 4DIFA 3N58A 1I4EB 1NF9A 3ABRB 3WMFA 3Q3IA 4FOOA 1Y4UA 2ZS7A 5TY0A 1NRIA 3D0RA 4WAUA 1B0AA 1CZLA 4KW7A 3M2PA 2YWCA 4LGMA 2GPAA 3MT0A 3QKSA 2CLMB 1FTWA 1PUXA 1V3TA 1XCLA 2G9ZA 2J0UB 2YZ7A 3HVJA 4BO6A 2BEJA 1K2VN 1U31A 3BAZA 3DEYX 4WJLA 1Q0TA 1NX9A 1CRWG 2OXIA 4LQDA 5ECWA 1OHHA 1JDJA 4P5EA 1BDBA 4HQFA 4H0NA 1H2HA 4JC5A 2ETVA 4EG4A 2XUIA 3TUZC 4I1YA 3T4UA 1AMOA 2EXXA 4Q34A 3C3WA 3UJAA 3G17A 4H0CA 2E4VA 4S1NA 1U2RA 1YACA 2FFAA 2MR5A 1E1YA 3EQ6A 5T3YA 1JVNA 2GJ8A 1KEUA 3CRVA 3ND6A 4MRNA 4RE6A 2JIOA 4U5XA 5AVYA 5I7SA 1YTLA 2QORA 1T5DX 1OXKB 5JAMA 2C8KA 3CO5A 3R5FA 5JZOA 2CW5A 3RVDA 2NM0A 2GFIA 4UPDA 4AIRA 2MMCA 2X3FA 4V24A 1W5SA 1DAPA 1QHSA 3L8GA 5LXTF 1W30A 4M54A 4UU0A 1X8JA 3ZHYA 3UZUA 3COSA 2O4CA 3FFWA 4PG5A 2Y77A 3B9PA 3EMBA 4WV3A 4ZK2A 1Z08A 2WM3A 3NHKA 1LFDB 2OG2A 3EQ8A 2ILVA 3IXMA 3KJFA 5GP1A 3PQ3A 2J0UA 4BQPA 3NRCA 4NFLA 1VYHA 2WUFA 3WE7A 3MS7A 4LJ5A 2JEYA 4M53A 3C6XA 4NOJA 5F33A 3AKZA 1NVEA 2A4MA 4OHKA 2FI1A 3AL3A 5A3VA 2ZSAA 3I5MA 3GAFA 3WHKA 2JARA 1BCSB 1V8ZA 3FBTA 3ZI4A 1EAMA 1N33B 4YUXA 3GT0A 3N75A 1ZD5A 4PC1A 4AJJA 4WXYB 3VPDA 2JC3A 1LWNA 4MVJI 3DV0B 2YV5A 4DQVA 4PPGA 5CEFA 3IB6A 2O05A 3O7WA 2C2MA 1EZ4A 1HL7A 1HZJA 2VYNA 2Z09A 3EEBA 3SBDA 1JZQA 4JU9A 3VX3A 5AK5A 4EG6A 3QYJA 1EFDN 2IU4A 2WJ3A 3L5KA 1TAQA 4PLCA 3MK31 2YICA 4CCYB 3ET5A 1KIFA 3HJGA 4ZO7A 4R0NA 3O90A 3ZG6A 1J33A 1QP7A 5L6LB 3CJQA 1YQQA 2W2TA 1I1NA 2BDUA 3V42A 5LMZA 4QX6A 4ZO6A 4N7RA 3VHLB 1ZNWA 4DL9A 1BCSA 2B5VA 3ASUA 3JYQA 3QXSA 5D3MB 5ILOA 1KWKA 1ISPA 5GV7A 1QIEA 2FOIA 3QPUA 4TMXA 2ZWPA 4NCHA 5ITVA 4RPLA 1O5IA 1YB7A 4UVDA 3IUJA 2G06A 2CDBA 3RS2A 3DV0A 3ZQUA 2O59A 4MEAA 4DA8A 2DFDA 2QD3A 2CVOA 2PFKA 3AR6A 3C6KA 1GZSA 2AKAB 3GLGE 3WYEA 5A5FA 2XADA 1RWVA 2FWIA 2G25A 2C03A 3PICA 3K4HA 3E81A 4FMBB 4YDRA 5DTQA 4BEBA 2PZEA 4AM8A 1FYEA 2BFNA 3S40A 4CCYA 2O7RA 5AKEA 1IZ8A 1NULA 2BJVA 2NUBA 4RS3A 2QT0A 4U2FA 4HFJA 1ESZA 1U2QA 1SA0B 2HBQA 1V8OA 2XUPA 2NMVA 5TX7A 2JLBA 4YACA 4IDGA 1E4OA 3KFLA 3U4AA 3VZBA 4BU0A 5KNCH 4IIEA 1PW5A 3MXOA 1BMFA 3QE3A 4IBOA 1NW3A 4P82A 4EG1A 3K0CA 3P4XA 3PWTA 5D3MA 3FYSA 2HL6A 3WWZA 3OKCA 1G59A 5A7HA 4JUFA 5KHLB 2GARA 5AESA 4UJ3A 1NFRA 1TCCA 4ALMA 2RK3A 3KU1A 2AZDA 4KO2S 4YJFB 2WIFA 2X13A 3DOHA 3FLMA 1Q0SA 3NXKA 4KUHA 1CIJA 4Q7MB 3P9YA 4UNQA 1VHJA 5KQLA 3LT1A 1MDBA 1IEQA 3UV3A 3DMFA 4FSHA 2IL1A 3IP6A 3EEYA 2SKCA 5EIBD 3L6EA 5B1HA 3ZCPA 4XE5A 1IY1A 1AKNA 2IF2A 3LCUA 1SA0A 3OCWA 1HZZC 4HX9A 1ZHOA 3ETHA 4J7AA 3TLCA 5GM2A 3ENZA 2JCGA 2DFKB 2Y1XA 1W73A 5G4LA 4Q3CA 5T4FA 4TMYA 2X2EA 4AJ9A 5KAPA 1EEHA 1A97A 2GUWA 3SSOA 1Q19A 4D81A 5BT9A 4KQ1A 4YX9A 1G3UA 4RSHA 3W5SA 1H2WA 5IBCA 1P6XA 4WT7A 1HEIA 4DZTA 1C50A 1VIDA 5EKUA 5HQ3B 2BGLA 2FDCA 2IYRA 3ET4A 4YJFA 3VH3A 3X1DA 3UK1A 2NT4A 3A28A 3CCFA 4FHGA 2MMGA 4MO9A 2AX3A 3U26A 3EZ7A 3UJ3X 3IP1A 5F2NA 3AP1A 5THXA 3OE5A 3F1KA 1K7XB 4Y8VA 3THOA 2BFBA 4OXRA 4L4SA 4M1KA 4QPNA 6YASA 2EZ8A 3WDMA 3OFSA 1YE5A 2VNJA 2GRUA 3Q5GA 4XXHA 2I9KA 2GUGA 1K3TA 2QTTA 4IRUB 1S3FA 4MUJA 3RLIA 4P92A 3ZDFA 4DIOA 1ZK2A 4M4SA 3BJIC 5F5XA 4HVCA 1IB6A 2FDXA 3QUBA 1CBUA 5AOCA 5TARA 5JD5A 2FK7A 1JAHA 5IN4A 3DJFA 1GDHA 1U2SA 3PHLA 1O9GA 4HD8A 2YVKA 4MYTA 4ZVQA 1F20A 2RGGA 3N8DA 5HQ3A 4DV1B 1XVLA 1S9DA 1G7RA 3FOWA 3NHJA 1K6JA 4HBZA 1HA3A 5A3RA 4KV7A 4RKEA 1P1CA 1PAUA 1PZEA 1ELOA 1UXOA 3BORA 4KCGA 4RJTA 1GRRA 1MO2A 1K97A 3S8YA 4V02A 5E9WA 1LK7A 4I6EA 1PNVA 1GZDA 1RMTA 5FTJA 1LTHR 1GR0A 3R6TA 1YR6A 3GN1A 1LDYA 2WSIA 4LFAB 2QVGA 2VAMA 2FPLA 2D0OB 1ZGJA 3DAPA 3TCXB 2PL1A 3EZ6A 3X1JA 3G5MA 5HOEA 3ORFA 3RRMA 2BFFB 2AG1A 2QT9A 3KQWA 1GNSA 1SHJA 2PGAA 3KL2A 2VQDA 2FZLA 2WOOA 4WBSA 3UV6A 4DW8A 1EGMB 3RRJA 5GONF 3ORSA 3RK1A 3D6MA 3HGQA 1YDEA 1W93A 3P2YA 2WE7A 2GR9A 3FPEA 1ETHA 3NNSA 4HNTA 5KSWB 2O6LA 5AK6A 5DU2A 5AVKA 3LUKA 4U7GA 4V1CB 2V7XA 3OQPA 5CJ2A 3L7MA 3AIIA 4DYVA 4F8JA 5ITZB 1SKAA 3WLAA 2XQJA 4ACAA 2EV9A 4YMIA 3PUYA 3FIUA 1EXVA 3HJTA 2GI4A 1GR1A 4ZCQA 3SOPA 2VF4X 4N9WA 3GJ6A 2DECA 1VSUA 1CF4A 1QIJA 1I5RA 1GNQA 2BFFA 1CY4A 4MP6A 4MUHA 1WB9A 1U28C 3A3OA 4JL6A 2OO5C 4FT2A 4M9XA 1ZSVA 1DIOB 1N2CB 3FVRA 4LHSA 2CLLB 2Q6IA 4E7OA 5IM5A 4GQAA 4GPD1 4U5QA 1THGA 2R6DA 2HA7A 3JD4A 1AUOA 4DLTA 1FF9A 3JATB 3QFCA 1YU9A 2BHTA 2P40A 2Y99A 4DQ0A 4H1VA 5BSKA 3VYWA 1GNRA 2UYGA 3UW1A 3R41A 1P4AA 3Q7TA 4IJKA 3HACA 4MJLA 4ZOCA 5ITZA 1XCPA 5KVVA 4WERA 4Y0AA 1QJCA 4HOYA 3U4GA 5AXDA 3D4NA 1Z5OA 1D7OA 1Y7LA 2F7SA 4AC9A 1GTL1 1AC5A 2QTCA 4INAA 2XXJA 5FI5A 2ZLBA 3KXLA 2DPGA 1U9YA 3HVHA 2O8BB 3F7TA 5SZIA 1ADYA 2NZYA 2GK7A 4N82A 1ZIYA 4F2HA 4HAIA 5C8VA 4BB6A 3NOOA 4EP1A 1W4CA 4DR5B 3K94A 3PNLA 1N8NA 3OPXA 1N2CA 4LMPA 3CUUA 1XK6A 1YL6A 2QLFA 1KTIA 1TCAA 1L6IA 2LTAA 3DLAA 2HRQA 3OQ1A 3VVLA 4KI7A 5EJ7A 3MBOA 3JATA 2IX3A 4IIVA 1MB4A 2R2AA 3CF2A 1Z8HA 4HLNA 4Q4AB 1N8TA 3PC7A 2VH1A 4I1SA 4HZGA 1NNSA 1SXJD 1KVQA 1SVOA 2WWWA 3DWFA 3FUTA 1DFHA 2R97A 1MKYA 3BJZA 3JQPA 3LDHA 4G6ZA 3HBFA 4I4TB 4R3WA 4X6YA 3I61A 2VG8A 1HNXB 4TL9A 1GUBA 2O8BA 4KDRA 2A94A 1CUYA 5T57A 4WADA 1SIWA 1WDTA 4UTPA 5I4IA 3B60A 2JI4A 5EPOA 2IEIA 1B0UA 1HE3A 1YRQA 2YVLA 1LBEA 3DQZA 3RIHA 3S8EA 3KJQA 1D03A 4GI1A 3OZBA 5FTMA 4Y2SA 1T2AA 3IBFA 3M81A 3PDJA 3QG1A 1P0QA 1P7PA 1R6BX 1I3OA 3G0OA 3GMIA 4LJ9A 1RWWA 1VLZA 5IBPA 3CW8X 4Q4AA 2P3OA 4UVGA 4X5OA 3G0IA 5B37A 2C9ZA 3O4JA 5JE8A 5EC8A 1LS6A 5JZSA 2WTXA 1F4PA 2JFXA 2WK1A 3UC5A 3W5DA 3CPHA 3F74A 2RE8A 3DR3A 3AW9A 4I4TA 2HXGA 3KSMA 2AEFA 1K4MA 3KDSE 3VKUA 1QKKA 4LV5B 2GHTA 4HNRA 1WSBA 1R6DA 3LHIA 1ND5A 1W0JA 1UWCA 1JKMA 1XJQA 2C9CA 2NZVG 3G9XA 3GVHA 4JR0A 3P45A 3SSNA 5K4GA 3HK2A 1MOSA 4UPEA 1ULBA 1NG1A 3T4PA 1TW3A 5H02A 1XWIA 3KELA 4HDKB 2H51A 1YUNA 5DX0A 4ENWA 2L17A 2K5UA 1YA8A 2JASA 3HCOA 4HO1X 3IQDB 4XIJA 3D1VA 3NHPA 3IPAA 1F8YA 1O7JA 3KWLA 1G41A 1Y6ZA 1XKTA 3LVRE 5JNLA 1OX4A 3LSYA 1T13A 2H4WA 3PXCX 4AG3A 4A6DA 1XDSA 3I1JA 4HGOA 4PSKA 2QYTA 4N3AA 1XMVA 1JT9A 1U7XA 1TTQB 3T0IA 3WNZA 1PJQA 4AUKA 2C8LA 2R6FA 3FSJX 3N87A 4Y1EA 2VDNB 3VV3A 4A82A 2PUVA 4EB6B 1DPGA 2OHVA 5DCYA 5BSMA 2IHBA 4RVNA 5F4ZA 5JALA 2V7TA 2BD0A 4OQYA 4ND8A 2RAPA 2DLNA 2B25A 1KC1A 3PVCA 4IHKA 4BVFA 5HZMA 5LQMA 4GPIB 5IANA 4MCAA 5FOQA 4HDCA 4MWTA 2BFAA 3N74A 1E7QA 4X71A 4DMFA 3TJZA 2LKCA 2CJWB 2FEOA 4MQ6A 3WK8A 2ERCA 1PX2A 1M2WA 3L6OO 1BDJA 2DKOA 3I4CA 5JSZB 2C4TA 1F06A 3WLFA 4M1WA 1Q57A 3IKLA 3L7KA 4IPTA 2XAAA 4XSHA 1I7QB 1QLJA 4E03A 4XKJA 4ZEOA 4JL5A 5JFOA 3KJEA 3O9ZA 1GG9A 3I5AA 2G07A 4Q9IA 4EB6A 1NVVQ 2Y68A 3JASA 3KV3O 3P0JA 4TWIA 3O0TA 5L7WA 2NZWA 3ITKA 1FDSA 2N1MA 5J4YA 5COBA 3R3XA 5TRTA 1AXEA 3C98A 4R68A 2VEDA 4W7IA 1NUHA 5CT6A 4HAWA 5H83A 2W5UA 1RYNA 2N3ZA 1E3MA 2Z3ZA 1W0CA 1Q92A 3OAAD 3KOWA 3OTWA 3NW9A 1OU0A 1EP9A 4QHTA 3TKLA 1XTVA 1XD8A 1QIKA 2CJWA 1LBTA 4QTUB 3EDRA 4GEGA 1ZM9A 2OILA 3HJCA 2DOKA 2FQQA 3UH1A 5C1BA 4BNDB 5JSZA 2Z58A 1L8XA 3IAUA 2IU6A 3N3BC 1OR8A 5EMHA 2WYVA 4FS3A 3B51X 4JB8A 1KR5A 3PEEA 1V4VA 1C0EA 4UHBA 2VSFA 5B2FA 1XCMA 1AGRA 1ISMA 3ECAA 3L0BA 1E6KA 1Q1NA 3SHVA 2R1ZA 3SQWA 4CQMA 3QWIA 4TV9B 5IXSA 3AM5A 1C9DB 1E2QA 2D2IA 3K5PA 3R4CA 3CNHA 2TS1A 5JNVA 1ADCA 5A9SA 4P80A 3H9GA 1JW9B 3SGLA 2HDWA 4N0QA 3VTKA 2WTBA 2CGEA 3MGCA 2CFSA 1WZCA 2WYOA 1R5JA 3MPOA 1WCIA 2ZCVA 4E22A 4DCMA 1TYZA 4BNDA 3RYFA 3SAJA 1W96A 2UYCA 2QM0A 1VGVA 2AA3A 5DX8A 1LF0A 3NETA 1FC0A 2CFOA 1EK0A 4ARAA 4EJ0A 2ISQA 3C85A 1XL0A 4RDIA 2OCDA 2P75A 4BKUA 2AG0A 3VO9A 2VJQA 3BA6A 4TV9A 4AKEA 1V41E 3Q7IA 1ZH8A 1PT8A 2I99A 3H8VA 4X7BA 5CTAA 4FDTA 3ZNNA 2WWYA 1E58A 2WIGA 4QU0A 4R31A 1J97A 1OAAA 4IXNA 3EZGA 3W6PA 2JAWA 3X2EA 4AS3A 3BQMB 3A06A 3MOSA 1SUAA 3AHIA 1M7BA 2HAEA 2QQ0A 3HP1A 3I04A 1T0BA 4PONA 4UU8A 3UT6A 3THXB 4GL2A 2OCXA 4BL5A 5EI5A 4P58A 1ZIOA 2QX4A 3B7WA 3G6WA 3UY4A 2AMLA 2G4VA 1XCOA 4ZI2A 4HG2A 2DBVO 2FMIA 5EMLA 4XGKA 2HNKA 2VK8A 3H2JA 4WA8A 1XMOB 5FPKA 3E58A 1C14A 1ADGA 3FF4A 3IMFA 1UZAA 2I4NA 3P4UA 2W6PA 1WW8A 4IIGA 5GWXA 3V1YA 4ZDJA 3GFRA 1FCJA 3ISJA 1QYRA 3K8OE 3KHUA 4GMFA 4LJYA 3ULKA 4A5OA 3EEOA 1FYDA 3LF2A 4BNMA 4BNFA 1QP0A 1E98A 1GY8A 2YC4C 4F3TA 1A5SB 1NHGA 2VP4A 1UK9A 4JGGA 1NLFA 1P91A 1PFUA 4XH9B 3F3YA 4OQFA 1F8UA 1WXHA 1UINA 2QTBA 2EFCB 2R60A 5ALNA 3Q87B 4J03A 1AT1A 4J76A 2WP0A 4QM6A 4E70A 3MT8A 2IV3A 5IZCC 3THXA 1OFUX 2PRIA 1G5FA 1D2MA 3OF3A 4ZRDA 4HVLA 4X3PA 4B82A 2OQIA 1JDTA 1N2CE 2JIRA 3HBNA 1ESNA 2C29D 4AAYA 1ZAKA 5LD2B 3BSFA 5AI8A 5FPQA 2HNBA 1Y9EA 3HGMA 4IIJF 1AS3A 1MHPA 3L6UA 5AOVA 1X70A 3L6BA 3PU6A 2B9VA 4X6UA 1H4TA 3AZPA 3JSXA 5I3CA 5BOVA 1K8ZB 3AKCA 1QPZA 2E6KA 1KKMA 2XHEA 1KZ4A 3ADBA 1K75A 3BH7A 4B71A 4GPBA 2FG7C 2QVYX 3X2FA 2ORVA 3QMMA 1ZC4A 4EMSA 4M0MA 1SD2A 3HVKA 1M2FA 2C7GA 3O82A 4L73A 3QHQA 3KQTA 1Q0RA 2CYCA 3WO1A 1KZHA 5JQGF 1PZGA 4QUKA 5DTMA 5C4GB 3RK4A 1EIWA 2XWPA 1KDZA 1BJKA 3W7AA 1GYPA 3FAZA 4M83A 3RVBA 2X0JA 4XRGA 3FHTA 2WJ6A 1E99A 3T34A 3UGTA 4RD1A 1M8KA 1PJTA 1RPZA 2ZR8A 1C7JA 1PYDA 1T29A 3DQQA 5EZSA 4JEMA 3OQIB 3VH2A 1JJ7A 3TZEA 1VFNA 4HH0A 2IOHA 4F38A 3VR5H 4PRYA 2GEKA 2OK7A 1ZQ9A 3WGOA 4GLBA 5H81A 2C82A 5C7YA 3HXQA 6ABPA 1NR5A 3RRNA 1P5JA 2AXPA 1C3JA 1GGMA 1THMA 1X7DA 3I9OA 4ZAWA 5LP6C 1U8UA 4KFSA 1U1GA 1G63A 4G0PA 4XJXA 1VLLA 4R5MA 4D79A 3EVNA 3IIJA 5G3ZA 5K0GA 2BKLA 4ND6A 5I4BA 4OI2A 5GAJA 3KVYA 1ZUHA 4I7EA 3I83A 4B83A 2BUAA 5EIFA 4OHCA 4OA5A 3QEOA 5I7OA 2WZBA 4B2LA 2YTZA 2GCEA 3O95A 1NASA 2ZBGA 5D8DA 4QU9A 2GHIA 1JAXA 1WCWA 1FYXA 3CSUA 3DQPA 5E4FA 8OHMA 3K5HA 1N4DA 3OQIA 4B3IA 1Y48E 2GN0A 3NTUA 3PQDA 1B8VA 3QWBA 4WKOA 1Z5UA 1LQ2A 4REOA 4KRXA 1ZN8A 5E38A 5ECDA 4J16C 3ZS9A 2Y2UA 3WGLA 4TS1A 2OHOA 1PQWA 1E61A 2XBUA 1G21B 4FHZA 4PG7A 1FY2A 2FPKA 3U6BA 2QL6A 1ZI8A 2ISSD 1Y7TA 3QA3E 3IR6A 4M8NE 3S28A 1MRSA 2GBLC 3TG2A 1SZDA 4BVJA 1PR2A 4AW9A 3QP9A 5LQSA 1U2GC 3UVEA 2XDYA 3I53A 2Z9BA 3WLJA 4LQLA 3CBQA 1X7HA 3K15A 2XF2A 4OLHA 5K0FA 4QO8A 4A92A 3F97A 4FGZA 3BXPA 5ED4A 2OHGA 1GQFA 5GVSA 4EKEA 3GK3A 1KJIA 1QRRA 2O3QA 4NG5A 2XVXA 2CHEA 1N5LA 5AJTA 4B4UA 1QYWA 4QFBA 3WLQA 1ABEA 4EPWA 4O4IB 1OJLA 2YMPA 4D5GA 1JG7A 3ZDXB 5KMGB 1K7FB 1KETA 3D3WB 2JHFA 1J8DA 4EATA 2PX4A 1G21A 1KZ6A 1JDNA 1NW7A 2YWEA 3I9LA 3M4NA 3V2GA 1LC0A 2WRZA 4AF8A 4YCAA 2B0CA 4LSZA 5I51A 4A2CA 4RAQA 3C39A 3T15A 1EFVB 1P2FA 2CKMA 2O5RA 4L3VA 2WWXA 3WMXA 1ZL0A 1T9ZA 3FHCB 1DVRA 5DKFA 3FMOB 1FTSA 1F0KA 4I9FA 3MQ4A 3O3MB 4Z51A 3KB8A 3QZUA 4FBMA 3W34A 4G9EA 1QWOA 1XVUA 3JV7A 4FCWA 1SD5A 3VKWA 2HO4A 3A7EA 4XAQA 4Y2GA 3AKDA 3MN1A 1CU1A 3D1LA 1OPXA 3C2QA 4B47A 5B3AA 5B4UA 3NAGA 4O4IA 5KMGA 3PUVA 1SXHA 1KS2A 2ECFA 2VYVD 3D3WA 3M4ZA 3A04A 3WV5A 1GA1A 1RQPA 1PGJA 5T5QA 1NMEA 2X4DA 5J2UF 4EZEA 1CF9A 1V8BA 3PPIA 3USCS 1INLA 5KSOA 1O77A 1PJCA 2FR8A 1TK9A 1EFVA 1FUYB 2P78A 1BDIA 2PO5A 4FIDA 1TF5A 2AGVA 1Z5GA 1UC5B 3WLTA 3W5UA 1O1YA 2VP2A 4YRFA 4ZAYA 1AKTA 1FTGA 3WSWA 4PFJA 4R8RA 4PCAA 4B6OA 5BV8A 5C53B 3F3SA 2WF6A 3WHIA 3TKYA 3HXKA 4XM1A 1NHWA 3GMSA 3AGQA 2XNDA 3VDQA 3A4TA 4AY6A 3O91A 2J59A 2ZYRA 3ESRA 2EGGA 3IAXA 4PSUA 3L77A 3GEPA 3G79A 2VO1A 3H2SA 3UGKA 4ND5A 4JQCA 1JDSA 3L6RA 4GICA 2XV1A 1PT7A 2DGDA 3U4DA 4ZVNA 2ZJYA 3OIDA 3TQSA 1W36B 1DC4A 4XX1A 5HQTA 4Q9JA 4G8BA 1OWLA 5IAGA 1NG9A 2QENA 3FRJA 4B3RB 1PFYA 4NJMB 3DLPX 1ZNQO 2DUWA 3C0KA 3DMRA 4NATA 5BUSA 4S12A 1G9XA 5B58C 1LDNA 4RBNA 1YI1A 2IUSA 5HMMA 5JEEA 2PY6A 1JQJC 2RBGA 4EFKA 5E4TA 3MTGA 5TVGA 3BVPA 4INOA 1BVUA 1O5TA 2P2YA 1VP9A 2V8BA 5AI5A 5KO2A 3SEAA 3QXJA 4D8TA 4B4KA 5JQWA 2FSIA 1N8KA 2VDMB 1O5OA 2JK1A 2QG9A 1UKCA 1QQTA 3P0HA 1SVSA 4DCPA 1DTEA 4EBBA 5IWAB 2AD1A 1K3UB 3LE8A 3PQ4A 2X6RA 2ZM6B 3FNBA 2I7VA 3IBSA 1JKIA 4RW0A 3AKEA 3FUXA 2OLEA 4E5DA 4H2DA 4MWCA 3C8MA 1ZHFA 5EIOA 5JI2E 2I6QA 4MITA 3G5UA 4NJMA 1W9HA 3QKWA 2ZJZA 3REGA 1KYQA 3OZUA 4K9SA 3PIIA 2HV8A 2PL9A 2QUHA 1YR9A 5EWLB 1DAGA 3IV6A 4AJKA 1KIMA 1J20A 3R23A 3THRA 2EERA 4H7IA 1XZFA 4PRKA 1LX6A 1VRWA 3OWXA 4V0QA 5CT5A 1GCUA 1RT9A 2GDZA 3KEOA 3D8RA 2EX0A 5JWRA 4RTOA 4Z4QA 3MWYW 5EA2A 1L4GA 5TT1A 1Y3IA 3HUTA 1GRQA 1QQBA 1ST3A 4LXIA 5JLAA 5T67A 1IBKB 4R1SA 2DULA 3D6NB 3WICA 4NAUA 2JFYA 1IK6A 3DE1X 5CHEA 4DSOA 5CCXA 2Z1DA 4N8EA 3K35A 4E46A 2COKA 2VJCA 3BK2A 3KPJA 4ZVOA 1FSFA 2ZIAA 1TVKB 3RRYA 4I1UA 4LDQA 4YRGA 5EIEA 5HKOA 1WM1A 3CZMA 3FR7A 5CVUA 1O96B 3PFWO 3PXBA 4KZKA 1UZNA 5EWLA 4CTNA 1U8YA 4OLBA 4GZLA 2ZI6A 4EY4A 2GBFA 3DAHA 1J2UA 4ZQBA 3HWWA 3ZCUA 3K9LA 5AVVA 3CXRA 3DCYA 3GGOA 4PG4A 1AO3A 1EFPB 2X41A 1KQPA 4HAXA 3OEHD 3AHGA 2I4TA 1C7IA 1AM4D 2AJBA 2I76A 1FP6A 5ER6A 4N65A 4KLZA 4AO8A 2QNRA 3T7DA 2WMDA 1E6CA 2LCFA 4BB0A 2PSSA 1YJQA 3QLVA 3CUKA 2CLOB 1Y5LA 4IJVA 1HK7A 2EQ5A 1VJ5A 1JF8A 2ZIFA 5F73A 1EUCB 1DI0A 3JQQA 5ISMA 4LPKA 4ZAFA 2F48A 3ESAA 1TVKA 4PLZA 1CUZA 1U3VA 3PDUA 1WB4A 3FM9A 4W1QA 3TTWA 3AJRA 3BS4A 5CNJA 4KIJA 1O96A 2Q3BA 3Q6IA 2A0FA 1YVPA 5CRIA 1IMOA 3P94A 3FGZA 1XU9A 4JUDX 1VI2A 4PHCA 3VDNB 2WFAA 2FEPA 2ZZNA 2YY7A 3HLTA 3V4RA 4B6GA 1NX6A 2DSTA 5L95A 3B2QA 1EFPA 5A7FA 1YK0A 1AY0A 2JAQA 1E0DA 2OZVA 2PWAA 3VU8A 2OGZA 2QTHA 4W5HA 1I3CA 3CEJA 5TR9A 5IX8A 3CLUC 4AWBA 2R8XA 4AQ7A 4ETMA 5CBPB 1MO5A 1WS6A 4C0JA 2VQSA 1ZZEA 4M7OA 1P31A 2CL7X 1XDGA 3QIAA 1ZSNA 3OFJA 5DI3B 4ZWNA 4U8GA 4GDFA 5C5CA 2G77B 5KWIA 1Q0PA 3T7TA 5F3WB 4GSKA 3GFVA 2BGIA 1Z39A 2VUHB 3I73A 2OV1A 5EN4A 1EUCA 1I2DA 3QFFA 2HN9A 2XB2A 1Y82A 2D4AA 2REOA 1BE1A 4ZT6A 4WE3A 2D8MA 1I6WA 3KKPA 4UAVA 1EFRA 5DGDA 4K86A 3T6KA 2PA3A 4O29A 5K9ZA 1GPMA 2PO7A 4MAFA 5F98A 3W2IA 4YR9A 2IYWA 1QGYA 2QRLA 3COWA 5KCMA 1V1RB 5IKXA 1RRMA 4ESHA 1CE8B 3SQLA 3HXOA 4I55F 5IWCA 2OCBA 2PUHA 3BFPA 4FINA 3DEAA 3LFHA 3F9IA 3NWPA 3NZEA 4WKNA 1STOA 1DAKA 1NMSA 4BN4A 4TYWA 5KNDH 3IS3A 2HH9A 4MQ4A 2G09A 5DM60 4BGEA 4M8SA 5CBPA 2IS4A 4Y6LA 1PIWA 3U5TA 3OQ6A 3CINA 5DI3A 1GUFA 3L0ZA 3WIEA 3KB1A 1XPJA 1Y5NA 3JQ6A 2R7MA 1G21E 1RCUA 1YHYA 1RYZA 2CEKA 3PV0A 2F8LA 2GBGA 1P1KA 3PP8A 1U81A 2DKNA 2NTJA 4L7VA 2EYQA 4RJ2A 3KR9A 1KDYA 3M83A 3TQHA 5CVDA 1VXRA 3A9UA 3V4PB 3L06A 4PLWA 3GVPA 3H19A 1C8LA 4BLSA 2ZR7A 2VQ6A 5HDBB 1HT1E 5G0VA 5C37A 2XXBA 3GCWA 4GD3Q 2P4QA 2VSQA 4R6XA 1V1RA 3HRIA 4MPTA 5EXPA 1CE8A 2C94A 1NVVR 1CW2B 3GW8A 3EZ2A 1K68A 4LKRA 5TV2A 3KAJA 3KXDA 1JMYA 3G8YA 1M1NB 2V58A 1Z4PX 3DBVO 4J1TA 5PNTA 4DBVO 4LYGA 3S68A 3WB2A 3JAKA 4GZ5A 1O3YA 4HJXA 4MQBA 3JSAA 4CLOB 3JQFA 4NV0A 4UEKA 5MN4A 1N6LA 5CVJA 1E7WA 3IODA 3AT1A 4H7DA 1FFDA 4ZHQA 2H9YA 2ZS9A 2HW8A 3GOHA 5SY6A 4MVCA 3AVTA 4TTRA 1DRJA 3UHFA 2YXDA 4AJ4A 1BVYF 3CZRA 4QU5A 1RNLA 3GBPA 3F7MA 1BO6A 1WXQA 5DSZA 3ETJA 3SM9A 1JTVA 3I4FA 3VSEA 4MPPA 4NTZA 1FTNA 2I6SA 2Q28A 4PSDA 3WBBA 4HADA 3T7IA 2H4HA 1GDTA 2CY0A 4IZ6A 4U7PB 1UPTA 2JFUA 5DM1A 1K5PA 1W2HA 1TW2A 4D6YA 3O26A 2E3JA 3I3OA 4LK3A 1Z3CA 3Q7QA 1U5CA 2BMAA 2I4OA 2JLAA 2QIPA 2R6R1 3OO1A 2PA0A 1OFTA 1VG1A 4ITVA 4MTCA 4O2LA 4C0LA 4JBYA 3ZV7A 5TXGA 4ZYTA 1E2LA 1H0KA 4E1AA 3PD7A 4CLOA 4N8DA 4D5EA 1M67A 3CN9A 3M7IA 1DJNA 1NVBA 4XD7D 5FUQA 1HETA 2GLXA 3MCZA 3P9QA 3UPDA 1QE5A 3FWYA 3N7TA 4KVGA 1DEHA 4WTOA 5IVHA 3OQOA 4PXSA 3RHSA 2P7HA 4N76A 2Z8ZA 3EXHB 3DTVB 4PIVA 3GDGA 1T1SA 4KJXA 3S0JA 1M5TA 3QSGA 2V96A 4EARA 2NO7A 1LZKA 4JC0A 1IJBA 3K16A 1RAGA 1UK6A 2EW1A 2H1SA 3C5CA 1JALA 4DQUA 2BLLA 2V7BA 4KLRA 1FW8A 1S4MA 3OPYI 3TD2A 3HTXA 1UOPA 5CK4A 1MOQA 4IGIA 2Y1EA 1ZMRA 3JW8A 4BO3A 2AZXA 1P5HA 2ST1A 1C81A 1JIIA 3IMGA 3U3ZA 4BFLA 2GEBA 4LXGA 4M46A 5JCOC 1SUIA 3WNBA 4QUBA 3R2JA 1U2ZA 1ZK0A 4AD8A 4KXNA 2BCGY 3CIFA 4AKIA 1EXDA 2HF7A 3OE4A 2RGUA 3ZCTA 4EHJA 2WLTA 1DXYA 1RXEA 3WOHA 4WJKB 4J29A 3EXHA 5B1YA 1GPBA 2BT4A 2GCOA 2XWBF 3DTVA 3PHCA 1IBRA 3OA0A 1NVDA 4P38A 2CL6X 4RK5A 4C08A 4QM7A 5KI6A 4BATA 4Y2YA 4Z0HO 1N34B 4AMYA 5TPZD 3O94A 1C8KA 1YRAA 4EJFA 1WVMA 3M9LA 2Q2VA 2PQMA 3TZQA 5KWEA 4FCTA 2MCFA 4KIUA 1XA0A 5LWHA 3FZEA 4ZCPA 1LLUA 2L69A 3DL2A 4R1NA 2PUCA 3ZVMA 4R1QA 1QH8A 4DSNA 3AF6A 4G84A 4XM0A 1E5XA 1ZITA 2YFHA 3GPLA 1X9GA 3LC0A 4R4JA 3NR2A 5CK5A 4E13A 4MYDA 1ETUA 3WL6A 4JSTA 2Z8YA 5JXGA 3O2QB 3UICA 1LLQA 1FPMA 4YRCA 5HKKD 1KARA 1NF3A 1GZ6A 2ID8A 3MWLA 4F3RA 1NNLA 1QMGA 1P6UA 1TMGE 3AU8A 2B8JA 3E5HA 4FOTA 2QZ9A 4RHEA 3T3NA 1L8QA 1LJUA 2DMRA 1R9MA 1V3QE 2PRKA 3DT9A 3IQGX 4NEQA 4TTIA 1ZN9A 5I9SA 5JD3A 5BQOA 4KFTA 4TPKA 1M3SA 4LBYA 1W75A 1JG4A 3AQIA 3HDTA 4REQB 5I5EA 5JY6A 2VT6A 2D59A 1WQ1R 2HYDA 5TGZA 1E1QD 1L5VA 3GRFA 3R3JA 3IB3A 1Z6AA 5EE3A 2YS6A 1U8FO 3UC9A 3HM2A 4YRKA 4G9BA 1S3SA 1Z6YA 2EKZA 3D31A 2YXEA 3QEKA 4M21A 4RZXA 4R1MA 1WUIS 2RHDA 2XPCA 3H8WA 2VPPA 2ZE6A 4WI1A 3T3MB 3FCXA 1X1DA 4EGCB 4BRUA 3HC7A 3VR4H 4C6HA 4U6SA 1B8NA 2WU0A 4X94A 2IY8A 1JHXA 4FLFA 1D1TA 3RWOA 4K1XA 1SHZA 3B1YA 3MUNA 1MT0A 5BSUA 3GBSA 5F3RA 5K45A 3DAOA 3CLTC 4REQA 2ZPUA 4BMOB 2I4RA 1HLDA 3HSYA 2QZPA 3TIFA 3QVLA 4AX4A 1EFCA 2YZGA 3DVQX 2VSOA 3NKLA 3QBVA 5AK4A 3T3PB 1N0VC 4HJRA 2C7RA 1E3EA 3Q41A 4MRPA 4QG7A 4HMPA 3B5IA 1GSAA 2QYHA 1SC6A 1TUBB 2F3RA 1HYEA 4NBSA 3S2GA 2A86A 1TDJA 1SCDA 3OX4A 2IYZA 1U0RA 3KC2A 1UXHA 4B2YA 2F9MA 3E9QA 4BGIA 4YP9A 3NTRA 4P3YA 1OI7A 1L0BA 5FBKA 2UVPB 2YWXA 2AJLI 2Q0SA 4N3CA 1W19A 1XV5A 1V2GA 5CVCA 4QDUA 1EGAA 5BWBA 8ADHA 3L8FA 1USGA 2C4HA 5KNBA 1MCZA 2C3PA 4JNCA 2R84A 2PUBA 2Y92A 1SN7A 2Z2JA 4LDAA 3GRVA 3GQVA 4BNKA 4DEYA 1P2DA 2EZUA 2I1WA 3RT9A 1GZ3A 2AH5A 4WZZA 2V5AA 1CZUA 2W6CX 1QYXA 3GFBA 4JVNA 3PXDA 4QQFA 2D13A 3ZGNA 4DGQA 3BIOA 4Y1FA 3GFOA 1NW4A 4AROA 2CF5A 1SHUX 2H5EA 2HMSA 2H2GA 3EAFA 4O2BB 4R2KA 1POWA 1Z22A 3RYCB 4HXGA 3ED5A 2DR3A 1GFSA 2XGJA 3CX4A 2RGRA 5HJ2A 4ZGBA 1XNRB 1NQOA 1IQUA 2UVPA 3KB6A 3PNPA 2P68A 3GUHA 4L0MA 4NYJQ 4Q16A 5IT4A 4JYBA 2C1EA 1TL7C 4ZICA 5HX7A 4MLCA 2RGWA 1M0SA 2GJAA 2GNAA 2H65A 1MJGA 2AC2A 3O8OB 4K81B 1Z17A 2JF0A 4TVSA 3P9NA 1M66A 2XUFA 3TJMA 1EI9A 2OHHA 3N6VA 3HN7A 5K3DA 4L0CA 3T3DA 2VSNA 4FMCF 1R6AA 3K0CC 2GPSA 1OX6A 1YKFA 4XYLA 5L53A 3U6KA 1SQGA 1G8KA 1TPZA 1JDBB 1Y1QA 3HUFA 4X1YB 1Y7HA 4KUGA 2B2XA 2QD2A 2CNWA 5I9BA 2VJDA 4F1WA 2PWYA 1Z75A 1L1QA 2CMFA 4O2BA 2CVQA 1A4XA 1ULUA 3I2KA 3IDFA 3RYCA 3DYBA 2JPDA 4RLQA 1L5WA 2OV3A 4CFZA 4YAJA 4EVIA 3FTFA 1QFMA 4D4KA 2B7BA 2KJQA 2ECPA 3H8SA 4QTTB 3WRVA 4TWRA 1WNFA 2HSJA 1E3JA 1F0YA 3AGPA 3NC0C 3HB0A 5I4KA 3CB4A 1R4ZA 3O8OA 4FI3C 5KQSA 3ZJVA 3H86A 4JB2A 3II6X 4X60A 3TL3A 2JLCA 2Y2VA 5CEEA 4HDRB 4FGLA 3R20A 1E2KA 1Z07A 5IK2D 4MI6A 1PNQA 4UBMA 3EH2A 1F8FA 1XJ0A 4KAJA 3ZWXA 4B74A 3LOPA 3DFUA 4ASUA 1V6AA 3PPYA 4X1YA 4C2UA 1NBAA 3DW1X 3L4BA 4D3YA 1H1TA 1SUWA 4C21A 2OAP1 2XYPA 3C3AA 1UQUA 2B8NA 4JZKA 4O63O 2XIJA 1J23A 3KVRA 4IMRA 2C2WA 3P9IA 5TMBA 2W90A 2I3AA 4P7FA 2ZT6A 3RSQA 3ZVLA 4NBKA 1P1IA 4DS3A 5FEMA 1KDRA 2EFHB 4Z9XA 3TZLA 1J2TA 3HA2A 3KQSA 4EB0A 2ZCJA 4HGPA 1YDWA 2V59A 1FFWA 1T4CA 1ZLYA 4ZJZA 1XFDA 1UBTS 3G8DA 3MMZA 3RJ9A 5JH7B 3W5BA 4LW8A 2PT9A 3NHUA 2AJTA 4FEAA 3RVPA 4HDRA 3IE1A 2V54A 1GZ5A