3WSVA

Crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
312
Chain Sequence
MKKTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb
source organism Enterococcus mundtii
total genus 100
structure length 312
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wsvA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3wsvA02
1JWBB 1ISHA 4BVAA 1H2HA 1JTVA 1N92A 3ZWAA 4EDFA 3OIDA 1ZK0A 2XXJA 1XR3A 5I8WA 1XG5A 4J7CA 3RFVA 1MG0A 2BI7A 1ADBA 3A06A 4ALNA 2SCUA 3DBRB 4B8ZA 3JQ8A 5EIOA 1NHGA 2GN4A 3PDUA 4BNIA 4Z6KA 1CETA 2C5AA 4OXNA 4RCVA 1GZ3A 3GGOA 3HDQA 1R6DA 3JQ6A 2YZ7A 1TT5A 3E5MA 2NQTA 3ZWCA 4UEOA 3ADPA 4UUMA 3CIFA 2C82A 4TRNA 3JD4A 3AOGA 4R1NA 4KDFA 3JYQA 4N5MA 4M89A 5TF4A 3ZW8A 5LC1A 3LDHA 2BFAA 4UAGA 4FFLA 5JDIC 1X1TA 2HMUA 3KV3O 4N5LA 1JVSA 4H15A 3STHA 4BKPA 7ADHA 1HDZA 3WDSA 2GCGA 1T24A 5A5FA 1PSDA 4DRYA 4CM7A 2FZWA 4A27A 2JHGA 3NRCA 4NIMA 1DIGA 3P5SA 1EUDA 1EVYA 2Z95A 1P9LA 3BMOA 3GVCA 1YL7A 1GD1O 1W4ZA 2JD0A 2GRAA 3ONEA 5BT9A 2HJSA 1NPDA 3PZBA 4ZA2A 1DLJA 3FPCA 2E6UX 3C1OA 4X54A 2PH5A 5JE8A 4GVXA 2CFCA 4UREA 1SCUA 2HMVA 1VSVA 4JGBA 2AQKA 5TIIA 3FRJA 1A9ZA 4E2YA 5IJZA 4GSKA 3ICPA 1JLLA 1NX6A 4RVUA 4E2XA 1VI2A 4QTZA 4ESOA 1PGJA 1V6AA 4CLEA 1Q0HA 2WD8A 2VWGA 2YV2A 2XPCA 1BVRA 2W2KA 3D3WA 3E9MA 2JD2A 3KYCA 1A7AA 3JV7A 1CF2O 4Y6SA 1UR5A 5TNXA 4F6CA 5JAZA 3AOEC 4O63O 4XR9A 1T2DA 4L0QA 1T2CA 1X7DA 5TSDA 1HTBA 2YJZA 4BO1A 3AUTA 5LDHA 2HUNA 1KS9A 3UH1A 2DTDA 1UP4A 1LC0A 2HQ1A 3RUIA 1Z45A 4ND1A 1C3VA 4QT0A 2DBVO 1NFRA 1N7HA 2C0CA 1BG6A 2E37A 3KM0A 2E4AA 3QWFA 4CLRB 1ULUA 1VRWA 1O8CA 1Z6ZA 4MVJI 3U62A 1J49A 1BXZA 3ZCXA 3ZU2A 3ETDA 2J5RA 4RF2A 4I1IA 2V6BA 4E32A 3Q2KA 4CQLA 2ZJ1A 1D4FA 1F0YA 3RFTA 2QYSA 4MIYA 4TROA 5TLSA 5DBIA 1DB3A 4CM4A 4GPD1 4CJXA 5DOZA 2D0IA 1IPEA 1VE9A 4PLHA 3VPSA 4M55A 3DMYA 2X8LA 4BO0A 2CDBA 4WKGA 1KEPA 5LCXA 3PRJA 3M2TA 1IHXA 3AUAA 5EJ2A 4PLZA 3E9NA 4ND3A 3W4JA 3ZNOA 4BOYA 3H3FA 4D79A 3BTSA 4PG4A 4WEQA 5COQA 2YV1A 5IDXA 3OA0A 4D45A 3ASVA 4IPTA 3K30A 2W90A 3WWYA 1DJNA 3UICA 1EEHA 4ZN6A 1CYDA 2OZPA 1I3KA 4BV8A 2QG4A 2GO1A 2O3TA 3I9NA 2Q2VA 1M6HA 3W8FA 1V0JA 3FCOA 3Q6IA 1Y9EA 1C1DB 1IZ0A 1JN0A 1GEGA 4KP7A 4YJFB 1WDMA 1ZFNA 3FSRA 4KUEA 4JROA 4YACA 1B8UA 4EZBA 1FJHA 5HA5A 5TC4A 4GWGA 3ZNPA 3GVHA 4XA8A 1HDYA 1HXHA 1VL0A 4XDZA 4XGKA 1XLTA 5A3JA 4NFYA 1NM5A 4BNLA 4CLOA 4RPKA 2AE1A 2BELA 2PGDA 1YRLA 3I6IA 1A4UA 4U0KA 4M86A 3F6YA 1CERA 4OQZA 4Y9DA 4XB2A 4YJHB 1H6BA 1NR1A 1Q7GA 1UUFA 3TRIA 2G17A 1QV7A 4FB5A 4CMCA 4CV2A 4CM5A 2Y0EA 2YW9A 1NVMB 2X23A 3P19A 5COAA 1D1SA 2Y1GA 4Q9NA 2DFDA 2YFQA 1I3NA 1T4DA 3CSDA 3WGOA 1YXMA 4JP3A 3NEPX 1YS4A 4GH5A 4YR9A 4Y8VA 4C7KA 4ROSA 3D5TA 2HRZA 3KTDA 2JFGA 2PTGA 1E92A 1PJLA 4IJVA 5EERA 3SC4A 3F1KA 4HFJA 4WNIA 5K6AC 3MJVA 3QVXA 4FOSA 5L7WA 2EEZA 3GLQA 1KBZA 2DTEA 4IS2A 1LDYA 2OL4A 3PDJA 2PNFA 2ZYDA 2Q3EA 1KEWA 3G17A 4XYBA 3UVEA 2VHYA 1VJ0A 4GMFA 2AEFA 4CR7A 5EQFA 4CMGA 4AJ2A 4J7XA 1K89A 1NQTA 1R15A 2FPGA 3LU1A 4OAQA 4NDNE 2PY6A 1XGKA 4RDIA 3M6IA 2VYVD 1TB4A 3H3JA 1DRWA 5KCZA 4OL9A 1ZO8A 2DT5A 1L1FA 1AE1A 1DRVA 4JQCA 1R4MB 3GDGA 3AY3A 3F5QA 4IMRA 4M54A 1PGNA 1U7HA 4D7AA 3PYLA 2VN8A 1HWYA 4CLDA 5T64A 2HDHA 3L07A 4E13A 3AUUA 4JBGA 2X1HA 1N9GB 1LDEA 1A27A 2O4UX 3EW7A 4DC0A 5IZCC 4J6FA 4DIBA 2DPHA 3GT0A 1YB5A 4FN4A 2HK7A 2XOXA 1NWCA 5I9NA 4HX5A 3CPSA 5JNLA 3WTCA 4LRTB 5IAAA 3IQDB 1JVBA 4B4WA 3L9XA 5H83A 2FP4A 4G2NA 3UCFA 5IN4A 3GAFA 2B69A 4HWKA 4NPCA 3E82A 4E2ZA 3QWAA 1UZLA 1IY8A 1I5RA 2B37A 3RUAA 1A5ZA 3VDQA 1PJ4A 2Q2WA 4EUEA 5DZSA 3WBFA 5TQVA 2VUUA 2B5VA 2ZB8A 3KEQA 4QX6A 4R3WA 1GUYA 4BHTA 4F45A 3MJ4A 4MVJP 5JYEA 1UH5A 4FCCA 4B7XA 5LDGA 2HSDA 1YJQA 2O7QA 1EK6A 2WDZA 3AI3A 1T4BA 1ZMOA 1HT0A 1TEHA 3SVTA 5JAIA 5A9TA 1H6DA 1ZBQA 3ONFA 1LQUA 4LCEA 2IZZA 1QRRA 4CR6A 4DVJA 1ENZA 4Y6PA 4BGUA 4YRBA 3GNQA 5JLAA 4EGFA 1L7EA 4IUYA 1O94A 3O26A 3MTJA 3OQ6A 1OZAA 3AUSA 2C2YA 1S6YA 4J90A 1U4SA 1DHRA 3NTOA 4PZCA 1LQTA 3H2ZA 4BUCA 4PLTA 3H65A 1E7MA 3PIDA 3IL2A 5HM8A 4OKIA 5K6AA 2D1YA 2WWRA 2VYND 3ZV6A 4GGPA 1RM4A 4IINA 3TZ6A 4FR5A 3GEDA 3ROKA 3HB5X 2VRCA 5JCXA 1C0LA 1HDCA 4HNGA 5BR7A 4WOJA 3JQ7B 1C1DA 2EV9A 1GFSA 2E49A 5CG2A 4TVOA 2RAFA 5FYDA 3ABIA 3TF5A 5CEEA 1U5AA 3F4LA 1U2GA 4EJ6A 3B6ZA 5I7EA 5AXAA 4JBIA 4AJKA 1CDOA 4XD2A 1IHYA 3MJEA 1GPJA 1AXEA 3ZNQA 4BNTA 4OXYA 4TKMA 2D4AA 3UN1A 1DC4A 3NT5A 3H9QA 5F5LA 4HFNA 2VOEA 4CV0A 4YJHA 1I2CA 1WLYA 3T7EA 4IDEA 1NP3A 3AY6A 5EPOA 1EDOA 3PQFA 5G0TA 4XB1A 5IZCA 3I9LA 5AVOA 1NBOA 1GZ6A 1ZSVA 4MVJM 3ETEA 2PLAA 4E30A 1MC4A 4YRDA 3PTZA 4F6LA 1LI4A 1E7YA 4YA6A 4CQMA 1Q7CA 1HE2A 1I32A 4PLFA 4FFRA 3NX4A 2WJPA 3ZH2A 3I83A 3KO8A 5HWSA 3I3OA 3EZYA 2HMWA 3K92A 3OP4A 2J6IA 2O2SA 4A03A 1HDRA 3UHAA 3EYWA 2BGMA 3WYBA 2VCYA 3NUGA 3ZHXA 3ORFA 1BDMA 4ZJUA 4EITA 3FR7A 2B5WA 2AG8A 5B37A 3G1TA 2HK9A 4RPGA 1O6ZA 5ICMA 3PYMA 1WMAA 2G5CA 2JFFA 4PVCA 1GADO 1MFZA 1B15A 3T7CA 2R00C 4RLHA 4RDHA 3E8XA 2VT3A 3JQDA 3DQPA 5GY7A 2UAGA 1R4MA 4DYDA 4XQ9A 5DT9A 4DUPA 1ZK2A 4FS3A 1SO8A 2C29D 4DQUA 4IQGA 5KVVA 4KWIA 5IDWA 3DAFA 1NQ5A 5L3ZA 1N9GA 3I4CA 3DWFA 2G0TA 3KUXA 2BLLA 1MB4A 2HMSA 5ER9A 1E3LA 1YGYA 3NAQA 2X5OA 1GCUA 2HK8A 4H7PA 4B3HA 3UCXA 2QZ9A 3WGIA 4CM1A 1VPDA 4K28A 2IRWA 2ZATA 3DEYX 5TJ9A 2FR0A 2BRUA 2CZCA 4B7UA 3WQRA 2JJYA 1PEDA 5C7LO 4MVJA 3AWDA 1C14A 5TX7A 4BO9A 4P4GA 3B20A 2I67A 4WE3A 1KVSA 1E1MA 2O3UA 4WK6A 4EJMA 2OP0A 2RHCA 3WSWA 3QWHA 1Y8QB 2PK3A 4EW6A 3FF4A 1BWSA 3K6JA 4GBJA 1GYPA 5B12A 3QWBA 3CUKA 4NFSA 3W8DA 4CV3A 1DBVO 3ZWWA 1LSSA 4CMAA 3I4FA 5BQFA 3UF0A 3DTYA 2FWMX 3VZSA 1G1AA 1H94A 1FDUA 1JA9A 2W8ZA 3PK0A 1XU9A 4CV1A 2CDCA 4BO6A 4CLHA 4FW8A 2AEJA 3ZV4A 4OJNA 1P1FA 5C7OO 4R4JA 1UXKA 1O0SA 4IDGA 4J1TA 2VHXA 3B1KA 5KKAA 1M66A 3TNLA 5HTOA 2WYVA 2R2GA 4A0SA 3K8ZA 4LSMA 4GX0A 2ZTMA 4OMUA 1YKFA 2G82A 3LT4A 5F21A 1H5QA 3U4HA 1H9BA 3ZI0A 4DQXA 5BNIA 2RHRA 1LC3A 3PXXA 4OQYA 1SC6A 2I3GA 1NWHA 1VSUA 2QIOA 3GUYA 1YQDA 3RC1A 3DFZA 4MIEA 2WYUA 1QSGA 3AY7A 3K31A 4AJLA 2C59A 3JQ7A 5KWEA 3KVOA 1Y9AA 1GDHA 3CMCO 4HADA 3E6AA 3VH3A 3UW3A 3PI7A 1VJTA 2Z5LA 1GQQA 4C4OA 4I9NA 3RVDA 1MP0A 1ONPA 1M2WA 1P31A 5THQA 4B4VA 1XHLA 2X58A 4ZQBA 2UVDA 3I9MA 2X5JO 2CD9A 1ISIA 2VZ9A 2OBNA 4ZQFA 4HUJA 3DDNA 4IIUA 3D4NA 2JCVA 3BHJA 4PG8A 4W7HA 3FNHA 3M1LA 1DFHA 1YBMA 5ES3A 1NAIA 4OKNA 3OA2A 3OHSX 5A04A 2QQ5A 1PJSA 1EE2A 1OMOA 4JXKA 1QXSA 4BMVA 4QSMA 2DBRA 5CDGA 2IEDA 4L76A 4DIFA 2GZ3A 5U4QA 2X6TA 3WLFA 4FDAA 1WP4A 1MC5A 2CMDA 5HRUA 5COBA 1N2SA 4B4OA 2GLXA 3F4BA 1I2ZA 3BMCB 3R3JA 3ZWYA 4DBZA 4GGOA 2OO5A 4YEDA 1EE9A 5BSGA 1B7GO 2JKVA 4RVSA 1QYXA 4INAA 1HEUA 5THKA 3A1NA 5G0SA 1WZEA 3I6QA 1GV0A 3M1AA 5EINA 3PJFA 5I7FA 3ROQA 1K0UA 2ZB3A 5DP1A 1UP7A 1LRLA 3INRA 2UDPA 3DOCA 3I9JA 5CEFA 1BXGB 3ADOA 1NVTA 4LSWA 3ANLA 5JMPA 3R6DA 3KSZO 3WR5A 4I5DA 3E5RA 1D1TA 3H9UA 5G4KB 1HDOA 1ISMA 1KETA 1ZJZA 2NTVA 3PJDA 3RU9A 3FWZA 3FNFA 5JMWA 5KVSA 1I3MA 4MP8A 3GPIA 4IXTA 1CQIA 3G49A 2PD6A 3LF2A 2J5KA 4NBRA 1J6UA 1HZZA 1K6XA 5EESA 3RJ9A 4MINA 3TFQA 2X4GA 5GMOA 2A94A 1E3IA 3O03A 3V5NA 3F46A 4P4LA 4W7IA 4DPKA 3WYCA 2AXQA 3ENNA 3HZZA 1IB6A 1P45A 2O4CA 3GF4A 4OH1A 1UDBA 2OP1A 2NVUA 5DBGA 3AM5A 3AI1A 3HQ4O 3KXDA 1O89A 4PLYA 3AW9A 1P1RA 3VC7A 5K0ZA 3ZWNA 5CAEA 1MX3A 5T5QA 1XYGA 2JFHA 3L6DA 1RWBA 4YPOA 1UXHA 4IDAA 3GHHA 1SNYA 4R3NA 3VPFA 1LSJA 5AQ1A 1ZCJA 1U3WA 1ML3A 1E1NA 1E3WB 3EAGA 3PHJA 4NR0A 1R37A 1FDVA 3PZRA 4OM8A 3AI2A 2A4KA 2VQ3A 3FPLA 3S55A 4TZKA 5B4UA 4XGIA 4BNXA 4DREA 3VTZA 2HCTA 2GGSA 3JSAA 3PHHA 4MIOA 2V6MA 4OSOA 4KMSA 1V3VA 1ZK3A 4ND2A 3BTUA 3LC1O 2VRCD 1FK8A 2J3KA 4NNJA 3KRTA 4J3FA 5JW6A 1PJCA 1GV1A 5T6BA 4ND4A 4IY1A 4R1UA 5KJEA 4I9UA 4L4XA 2PZMA 3TWOA 1ZXLA 1H2BA 1ZZEA 2GNAA 4Z9XA 4P22A 3H8VA 3N58A 4A7PA 4NK5A 1X0VA 4YB8A 1IZ9A 2AQIA 5KVCA 2DQ4A 1KVQA 4D44A 4EYEA 2AW5A 8ADHA 4MPDA 3SX2A 1I2BA 1PQUA 3OJ0A 4YXFA 1Q0LA 4FFNA 4BS9A 1BRMA 2GASA 1B8PA 4J4BA 4JNKA 1T2FA 1T1RA 4Q39A 1WXDA 3GY0A 3H5AA 2EKQA 1K2WA 4Q3EA 1QKIA 3RU7A 4CM8B 1A72A 2V6FA 3M2PA 4GVLA 3ZV5A 3HFGA 4CQMD 3RAJA 3EZLA 4AJOA 1UDCA 4WNCA 5JCJA 1HETA 3PFWO 2Y93A 4K26A 3UUWA 5A9SB 4QEDA 5B4TA 2YV3A 1U3TA 4PZDA 3L6EA 1OBFO 1EZ4A 1CJCA 2I9PA 3E9QA 4JCOA 1KEVA 1BVUA 2QYTA 3PHLA 3PJGA 4RLSA 4B4UA 5I9MA 1EVJA 3K9QO 3ZWPA 1DAOA 4YAIA 3C1AA 4L74A 2RH4A 3OBBA 2Q4BA 3DZJA 1UAYA 1EVIA 2X9NA 2Y1DA 3ZGYA 2NSDA 4TQGA 5HS6A 1LLDA 1M75A 4PG7A 2VNAA 3BMCA 3GG9A 4IZHA 4DPMA 3OFSA 3JD0A 3N74A 1JAXA 4GL4A 3ZN2A 4BO4A 4CUJA 2FRDA 3VKUA 4RPJA 4NMHA 1FF9A 2C07A 1HL3A 5CDTA 5BNTA 1U28A 5CG1A 5JBIA 4OIMA 3GEMA 4LVCA 4RJTA 1PZFA 4IQ0A 2PR2A 4K6CA 3A4VA 2DLDA 4BB5A 1CEQA 2O2YA 2Y1FA 2I76A 3ZZNA 1MA0A 1NTOA 4LMPA 1J5PA 4LW8A 2FHSA 3OIFA 1BXGA 3PGXA 4Q3NA 1DIAA 3AFMA 2WM3A 5IF3A 4XCVA 1GZ4A 4II3A 4CR8A 4MKZA 1UXGA 1SAYA 4AJJA 5G4KA 4BNVA 3OSUA 1P0CA 3OEWA 4ITUA 3RUCA 3WQSB 4LISA 1U8XX 4UEJA 3NTQA 4XGNA 4XYLA 5JY1A 2VUSA 1GEEA 3TL3A 1ZMTA 3R1IA 1PZEA 3W4IA 4HXYA 3JQCA 3B1JA 3QA9A 4BNNA 1ENPA 4PLWA 4PRKA 1EUZA 3ZWBA 2X0JA 4AICA 1E6UA 4U6QA 2GERA 4UUPA 1CIVA 2GN6A 3GC6A 3KSDO 5TGDA 2ZTVA 1DFIA 4PFJA 1XU7A 1ZSYA 4J0FA 4CMKA 4D42A 4AJHA 3LC2O 3OF2A 4KOAA 4JP2A 2DUUA 2AEMA 1HE4A 1LLUA 3ANMA 3QQPA 3WOHA 2J3JA 3ZV3A 3GN1A 3MWEB 4IZIA 1MGOA 2W98A 3I23A 2VHWA 1TA4A 1KVTA 1ZJYA 2W4QA 4Q3CA 1JDJA 3DBRA 3K2EA 1G0NA 3X2EA 6LDHA 3QVWA 1C0PA 1YOVB 1E3WA 1BSVA 5A06A 2I6TA 1U4OA 3JQFA 4WLFA 4M1QA 1H6CA 4BNWA 1XCBA 4I9HA 3A28A 2NU8A 1FXSA 3EK2A 5JC8A 4UEKA 4BMNA 4PLGA 1C0IA 2PA3A 3D4PA 4E33A 4ZHSA 1F14A 1KEUA 2NQ8A 1U7TA 3SXPA 3JD1A 2NADA 4G81A 5CP8A 3AK4A 1B14A 5IXYA 1LLCA 2JCYA 4OYRA 3I9KA 3H2SA 4WUVA 1JU9A 3OH8A 3HWRA 4FJ0A 3RUHA 5TT1A 1AXGA 3G0OA 4DMLA 1EVZA 2FPIA 3CXRA 4FD3A 3V2GA 2NV6A 1N5DA 4BKOA 1M76A 3RBXA 1OC4A 2BHLA 4NQZA 1KVRA 3C7AA 4XEHA 2GSDA 1SEVA 1PR9A 4NBTA 1NNUA 1MXFA 4HP8A 4N7RA 2GDZA 4W6ZA 4MKXA 4N18A 4JX8A 3DHEA 3ZHZA 1BHSA 3C3XA 4KZPA 4NJOA 4R9SA 5KJ1A 4IQ8A 2DAPA 3WB9A 4PIVA 2Y0DA 3BAZA 4G5HA 3BIOA 3NT2A 5G0UA 3IKVA 4RV9A 1I8TA 2B4RO 1D7OA 4PG6A 4CM8A 2DFVA 3VPHA 2IXAA 5J23A 3T4XA 1H9AA 2QX7A 2ZK7A 1YB4A 4R01A 2EKLA 3ZDFA 1U9JA 2VWHA 3F1LA 4BGEA 1ID1A 4YRAA 1HKUA 2YQ5A 5JAMA 4JLWA 3RD5A 4CM9A 3ON5A 5A9SA 3HUDA 2AE2A 2W2LA 3E03A 1PL7A 5JPIA 4FC7A 2PZLA 2ET6A 4LRSB 3WQQA 1GY8A 1SEPA 4NFHA 4E31A 1PIWA 1TT7A 5FFFA 3LF1A 4CLRA 5TS3A 2RH8A 3GGPA 4BNFA 2AQHA 2B35A 4IGEA 1LDBA 4CL8A 3ICCA 1DSSG 2P5UA 2Y67A 2V65A 3IS3A 2GYYA 2P4HX 3C1TA 2YY7A 1PS8A 1PU2A 3QVTA 3EVTA 3RWBA 3JD3A 5KOIA 3GDOA 2PH3A 1J0XO 1RPNA 2EP5A 2HRBA 2X7HA 4YAJA 1BW9B 2B4TO 4L9RA 3MJCA 3VDRA 3BTOA 2UUPA 4H16A 4R51A 3W1VA 3H6KA 1DHTA 3AFNA 3ZWMA 2Q1TA 4RPLA 5A9RA 4W9NC 3EY4A 5IG2A 2HMTA 3HB4X 4XQCA 1W0CA 4CMBA 5B1YA 1LDNA 4IXWA 1JKJA 3TFOA 4IDDA 1LLQA 1T2AA 3MJTA 1R12A 3CZRA 3VKVA 3RASA 4ALLA 1MUUA 4NH4A 2ZJ0A 4W4TA 1YQGA 4YQYA 4O0LA 4BO7A 4E5PA 2IXBA 3P2YA 2RCYA 4NG5A 3TZHA 2LDBA 4FQ8A 4Y67A 4EEZA 4IIVA 3VHRA 2UUOA 4URFA 1QLJA 5DNAA 3LYLA 1ULSA 3TJRA 4YJFA 4KTVE 2Q1UA 3RIHA 2NU7A 3LK7A 4HV4A 1U8FO 1HDGO 2O7SA 5T57A 3I9OA 3BHIA 3K2BA 1YJ8A 1RYEA 1I01A 2P9CA 3P2OA 4HBGA 9LDTA 4CL3A 2OFPA 2QW8A 1V8BA 1F06A 1SBYA 1DOHA 2O48X 4UVGA 1EQ2A 1PJBA 3PIIA 2JHFA 4D41A 5IN5A 3TZCA 3LVFO 1SOVA 3DC2A 1KOLA 3WSVA 1ENOA 4RVFA 4IJUA 3VZRA 1QYCA 1LBEA 1WZIA 3PJEA 4DQVA 4R54A 1V35A 4PZEA 1GQYA 1HYGA 2EF1A 3KYDB 4WOKA 3UAGA 3WGZA 3PFFA 1EDZA 3JQBA 1EBFA 4BNMA 3MJSA 3WMWA 1GPDG 1YOVA 5C5IA 4ALKA 4C7JA 3U0BA 4BB6A 1O5IA 3CZMA 1FMCA 1VM6A 2DKNA 2GN8A 2PD4A 3BHMA 4GX5A 4CMJA 1XIVA 1E0DA 3KSUA 1F17A 1VKOA 3EHEA 4RO0A 2QRLA 3PPIA 2ZTLA 3SC6A 3Q2IA 1T25A 3QWIA 3WGTA 3WX0A 5L4NA 1GUZA 1X1EA 2FR1A 1H0KA 4L4SA 2C20A 2BKAA 3FTNA 3KOUA 3WLEA 1R0LA 5AXDA 4QUKA 2GR9A 1S7CA 4UVIA 4RVHA 3COSA 2IE0A 1D8AA 1PJTA 3O9ZA 3DZBA 3GMSA 3W6ZA 2F1KA 3TL2A 2H6EA 3Q9UA 2CNBA 3HNPA 3JYOA 4FFMA 2J3HA 1C0KA 3RJ5A 4BKRA 4E4YA 1XQ6A 3I1JA 1GQ2A 1H6AA 2VNSA 4PCVA 4HKTA 5JCJD 5BSHA 2JAPA 4A10A 4QECA 4ONEA 2YDYA 5CDSA 5CEJA 1Z74A 4L8VA 1KYQA 4W9NA 3DMTA 1XKQA 4G65A 1VJ1A 2EP7A 3HN7A 2BFOA 3WIEA 1QR6A 1WDKA 2NM0A 3VAZA 2BI8A 3MCVA 4P8RA 3HSKA 2X86A 1R16A 1UXJA 3OQBA 4UUOA 2YHIB 3QW2A 1M6WA 1OC2A 2WD7B 3VVCA 2P2SA 2IYPA 1N7GA 4GMGA 1B3BA 3ROPA 3TSCA 1NQOA 1RJWA 4J0EA 3VH1A 3OIGA 4RF3A 3V1TC 2YFHA 4CM6A 4RZIA 1YO6A 3AU8A 2Q49A 3ZU3A 1TXGA 1F12A 4CMEC 4E0BA 4XYEA 4B3JA 5T8KC 2J8ZA 1U1IA 4R9RA 2O3SA 1BGVA 1QYWA 3BA1A 1B0AA 4TMFA 1D3AA 4Q3AA 4WJZA 5F5NA 4IDCA 1SPXA 4D46A 2EXXA 4QQRA 5GZ3A 1KC3A 5CDUA 1NR7A 4E5KA 3SLKA 2Y66A 3DAGA 1BW9A 2IEBA 4NZ9A 3MWDB 3E1KA 4YQZA 4MP6A 1E6WA 1C1XB 4S1VA 3ITDA 2RBEA 3JQGB 2FMUA 3L4BC 3O8QB 3QVOA 3RC9A 5L45A 4FJ1A 4RQTA 1DC5A 2NTNA 1E1LA 4IS3A 3S8MA 5JDCC 1TI7A 3OQ1A 3W6UA 4Z9FA 5CPFA 4DLAA 4BO5A 3IUPA 4DL9A 2ILTA 2OMEA 1EQUA 2C7VA 1VC2A 2PGLA 5AXBA 3CE6A 1Q0QA 4EUHA 2PGJA 3D1LA 1W73A 2IZ1A 2Q45A 3OETA 2EGGA 4P4NA 1ARZA 3VH2A 1ZVMA 5AYVA 4JIGA 2VZ8A 1PTJA 4ZVVA 3RCBA 5JC1A 1Z7BA 2ZCVA 3FHLA 1E3JA 5A4DA 4BO2A 2IODA 3ZWXA 4J7UA 3IKTA 1QYVA 5DN9A 3H9JA 1LDGA 1M67A 4M87A 3D4OA 3GH3A 4A26A 2VTEA 3DZKA 3DTTA 4ZICA 4BNKA 5BSEA 3CMMA 1VLLA 3FNGA 3QY9A 4GI2A 1XEAA 1ORRA 2YYYA 3ENKA 1E5QA 2JD1A 4I5GA 4XKJA 1I3LA 4YBZA 1OFGA 4B8WA 1ZXBA 1DIRA 1ZSNA 3LLVA 5L95A 4XRGA 2Y0CA 3NJ8A 4GLOA 1H93A 3K96A 1LTHR 5U1PA 1ZW1A 5AXCA 1G0OA 1UP6A 3DZIA 4UVDA 4R1TA 3KYDA 4B79A 3DB2A 1P1IA 3RROA 5KKCA 2B0JA 2LDXA 1Z82A 1PL6A 4KWHA 4XX0A 2I3AA 2VYVA 1ZK4A 3D5QA 1HLPA 2AMFA 2YHUA 3BYZA 1XDWA 2HO5A 4LMRA 1XELA 2NLOA 4HNHA 5B4VA 3IJRA 1NHWA 1ISGA 1P0FA 2VRBA 4YJGB 3L77A 2P5YA 4Q3DA 4ZQHA 1LJ8A 1VKNA 3D0OA 2FZEA 2P91A 3DZHA 5JXWA 1YBVA 3RBVA 3WGQA 5ENVA 2D8AA 3OJFA 3ZW9A 4MP3A 3ASUA 1PGQA 4CMEA 4CODB 2VHZA 4Z3KA 3JQEA 5T8KA 4DMMA 1A9YA 1PZHA 3UOGA 2X0RA 3ETGA 4GWKA 2C7GA 1V3TA 1DFGA 3GZ4A 5DCWA 1E7SA 1E3SA 5BSFA 1E77A 4KQWA 3GNTA 4W99A 1LNQA 4N5NA 1LDMA 4QXMA 3RC7A 1WW8A 3P7MA 5IDQA 3DFUA 4CM9D 1DLIA 2EJWA 1AN9A 4EEXA 2GN9A 3WMXA 2W2LD 3L4BA 2BD0A 1X14A 3RKUA 4F46A 5ILGA 4YYZA 2EG9A 3GGGA 2O3RA 5MDHA 2X22A 2VUTA 5JDCA 1NQAO 3KEOA 1UZNA 3RFXA 3HG7A 2E48A 3NDJA 2WE7A 2FY8A 3OM9A 3ITKA 3PVZA 2YHIA 4BMSA 2YDXA 5H82A 2WD7A 4YAEA 1AUPA 3SEFA 5JFOA 5JO0A 1B16A 3C24A 5CFZA 7MDHA 1PR3A 4DXHA 2AA3A 3ANNA 5ICSA 1WAMA 1JW9B 1OAAA 1ZNQO 3U4IA 1BXKA 2QZZA 1EUCA 4UVHA 4RVGA 1RM3A 4L73A 4YVFA 4XQEA 2VOJA 4II2A 3OJLA 1OOEA 3VPGA 4NU6A 1Y8QA 3D7LA 1TVEA 4JN6B 3AJRA 2JL1A 1LX6A 2OGUA 2TMDA 4ZRMA 9LDBA 1I10A 2NACA 1FDWA 4EBFA 3CH6A 5KTKA 1U5CA 3HDYA 3RBZA 1F8GA 3L6OO 4MKRA 2EW2A 2UYYA 4J2OA 1E5LA 2CDAA 2HJRA 4CUKA 3W4KA 2ZYAA 1P77A 1X13A 3QSGA 4GX2A 3B1FA 3SBOA 3WJAA 1AGNA 4IJWA 3JTMA 1SB9A 1C1XA 4W82A 1LRKA 3LSYA 1E6EA 5L53A 3JQGA 2WEKA 4J9VA 1ZK1A 3O8QA 4B3IA 4IM7A 1DC6A 3GVIA 3KLMX 4FC6A 3DONA 2P4QA 4I8XA 4RF5A 4XWYA 3TQHA 5C37A 1LSOA 5L4LA 4ALIA 2BGKA 2B83A 3H9GA 5I7SA 4HY3A 1NYTA 1O95A 4XIJA 4PLVA 1P1HA 3C8MA 3U9LA 1DIHA 3DZGA 3HFSA 5L40A 3K73O 2POQX 3DL2A 3PEFA 1NFQA 4KUHA 3DOOA 4TRMA 5F3RA 4NI5A 1HE3A 2E82A 4PGFA 2PV7A 4WECA 3BMNB 5EMHA 5F1PA 4FPXA 3FN4A 5CDYA 1F8FA 1Y5MA 1ZH8A 4XJTA 1CQJA 4XJSA 5K9ZA 1DC3A 1PJ3A 5L7TA 2PD3A 2QRJA 3FI9A 4WLUA 3G79A 4OHUA 2XF8A 3KYBA 5HBRA 2VT2A 4J16A 4YTEA 2DU8A 3JQFC 3GEGA 3WG9A 5FF9A 1E7RA 1YONA 4ILKA 4KDEA 3L4SO 4N54A 3ZU4A 5IXSA 2I99A 1ZEJA 4Q3BA 1DXYA 3NGLA 3KZVA 3BXXA 3FTPA 4E3ZA 3ST7A 3WXBA 4UUNA 2H1SA 3GVPA 2Y1OA 5FI3A 3BZUA 1LUAA 3QHAA 3PWSA 4FGSA 4E5MA 4EJ0A 4YDRA 4L75A 2Y05A 3E48A 3JQAB 1YE3A 2Y1EA 3WFJA 1JQBA 5DP2A 1DO8A 4YAGA 3CINA 4ZGWA 1HE5A 1NPYA 3VZQA 4BKUA 1ZKMA 1SMKA 4S3MA 4YJGA 3WGGA 1EK5A 2A9FA 4O1MA 5HS4A 3FNEA 4J4HA 4JJIA 2OOSA 2P68A 4J2HA 4LVUA 2H9IA 4D43A 3A14A 2EJVA 4M8SA 1PWZA 1K6IA 5GZ1A 2FSSA 2PKRA 1L7DA 4OO3A 4GKVA 1PGPA 1KERA 3TZQA 4DTIA 3HADA 2QRKA 4PN3A 3KLPX 2DVMA 3G1UA 4RVDA 1ENYA 5C3MA 4MOWA 3PHIA 4AL4A 5KIAA 5DCUA 1WWKA 3BTVA 2C54A 3HN2A 5FEUA 1X15A 2ZTUA 1PS9A 2ZB4A 4IJKA 2BH9A 4OOFA 4YAKA 5KNLA 1GAEO 3H5RA 4OOEA 4WCFB 2A35A 4YT2A 1Q2XA 3VVBA 3FBTA 2ZB7A 2I5PO 1E1KA 4RF4A 3DXFA 2JCXA 3QRWA 3NT4A 4KUGA 2X9VA 4MVJD 3WNQA 3K5PA 4J43A 3H5NA 2Q46A 3GPDG 4NHEA 5FWNA 4XQGA 4P38A 4QO7A 2NU6A 4EUFA 3L9WA 5F1KA 4A73A 1T26A 4B7CA 5JYDA 4FOOA 5EQDA 3RI3A 2D59A 1AHHA 1P1KA 4LGVA 3ZU5A 3DBLB 4D3FA 2Y1CA 4JK3A 3HE3A 4OSPA 5G0VA 1K3TA 4BNUA 2DUWA 4MVJG 3CTMA 5JDIA 1V9LA 5L51A 3U4CA 3LT1A 2V7PA 4O6VA 1YQXA 5ENDA 1I33A 1LEHA 2EERA 3RC2A 3T4EA 4BKQA 3PQDA 4R68A 3DOJA 3TOZA 4ZQGA 1GYRA 2A92A 2HU2A 3QIVA 1NXQA 3GVXA 3KETA 3EDMA 2CF6A 2IDZA 1NAHA 1PS0A 1KC1A 3JYNA 3ZWVA 2AQ8A 1PJQA 1X7HA 4BQPA 4MVJH 3V2HA 4J1QA 1UXIA 1EFLA 2F00A 1UDAA 3IJPA 4WCFC 4XIYA 5KJFA 4RZHA 1AHIA 1MV8A 1KY5A 2Q1SA 4RORA 5I8ZA 3RKRA 4FGWA 3DBHB 3UKOA 5H81A 2VHVA 1IULA 3C85A 2CUKA 4DWVA 1WMBA 4CLXA 3U49A 1SZJG 4CQMB 3SJ7A 3MOIA 5T67A 2J3IA 4PG5A 1YWGO 4KQXA 2EIHA 4QFDA 1XSEA 3S2EA 2O23A 1HF3A 5F1OA 3AOEA 5DCYA 1QMGA 4Z3DA 1CWUA 3RUEA 1XQ1A 1R66A 1IE3A 2C5EA 3PHGA 4EI2A 3F47A 2Q1WA 3QJ5A 4BGIA 2ZQYA 3BMNA 4NBUA 2CSUA 1PQWA 3IP1A 4K1LA 4NK4A 1HDXA 3GZNB 5G0WA 5A05A 1A7KA 1YL5A 4J1SA 3HDJA 4XYGA 1QP8A 4AJ4A 1Y1PA 4D3SA 4A5OA 2Q99A 3JQBC 3NKLA 2NVWA 3ONDA 4D0SA 4RQUA 3WYEA 3AM3A 4YCAA 3QVSA 4HFMA 4XRRA 4CMHA 5U9CA 3E18A 3LT2A 1R0SA 1QV6A 4R69A 3BMQB 1ONOA 3EC7A 1R4NB 5CHEA 1YDWA 4Y98A 4I08A 3OJOA 4IDFA 1PGOA 4UVEA 5C7IO 1PJ2A 2H63A 3QV1A 3RUFA 1Y8RB 3GK3A 4YJDA 4WASA 2NUAA 3Q0EA 3JQAA 4JBHA 1B26A 3MTGA 2EKPA 4GAEA 3UFXA 2X0NA 4CMIB 2VWQA 4MDHA 4TRRA 5EN4A 1P44A 2UV8A 5I9LA 3VTFA 5IFLA 3IMFA 3ZHBA 1MFPA 2GD1O 3CEAA 2DPGA 3FR8A 3PQEA 4XDYA 4O59O 4R41A 4DA9A 1HSZA 1BTOA 3QLJA 1LXCA 3V1YA 3WS7A 1DAPA 3MZ0A 1MLDA 4LCJA 1ZEMA 1N1EA 4OXKA 4KTTE 1Y5RA 2AG5A 2I66A 3DMTC 4Y6RA 1MG5A 3UCEA 1P74A 1SB8A 3TOXA 3PWZA 2PWZA 4IMPA 5A1TA 4AJ1A 4WLNA 1HYHA 1DJQA 2WE8A 1V3UA 2XXBA 4FJ2A 2H5LA 1Z7EA 4D3DA 4K9DA 2O50A 3QE3A 2P9EA 2GZ1A 2PFGA 4OGWA 4WCFA 3ZHYA 3PYXA 3H9EO 1Y81A 1RM5A 4E6PA 2BF7A 1O9BA 2Z1MA 4R16A 2FPPA 1ISJA 3S2IA 2GUGA 1K5HA 3WTBA 1WVGA 3WGYA 2D2IA 4GKBA 2P9GA 1I0ZA 4IBOA 4GSLA 3IIEA 1IL0A 4MO2A 4BV9A 3DR3A 3DBLA 3QP9A 4FIZA 2EWMA 5G4LA 1LSUA 2Y99A 4DBVO 4XZ3A 2EW8A 1QLHA 1GCOA 2OHXA 5DBFA 1WPQA 4PRLA 3EVNA 5TJHA 3Q11A 1NFFA 3WJ7A 5A02A 2DBQA 4WGGA 4BO8A 1JKIA 3GNSA 2GPTA 2DC1A 4U6SA 1PL8A 4U5QA 4I5FA 1X0XA 3HHPA 3GG2A 2FR8A 2ZKLA 1FDSA 4NU5A 4QO8A 1DDOA 4CUZA 1A4IA 5A03A 5ILOA 2V6GA 3C7DB 1MXHA 8LDHA 2CVQA 1CRWG 2G76A 3AU9A 1B3RA 1T2EA 3GHYA 3H4VA 3DO5A 3PGJA 3R3SA 4QFCA 3UXYA 3VH4A 5I7VA 3LLSA 1P33A 3IOYA 4NJMB 4HFRA 4J49A 3V1UA 4JJFA 4U7WA 1YVEI 1U2DA 2WMDA 2X5KO 1JAYA 5KJCA 3WWZA 1TLTA 5G2OA 3DAPA 2PZJA 1KY4A 2IYOA 4ZU3A 6ADHA 5KVQA 1GUFA 3A9WA 3DBHA 3VPXA 4ZRNA 1JWAB 3WGHA 1FDTA 3JQ9C 3GRPA 3IDSA 4GX1A 3FBGA 4PLPA 1Y6JA 3V8BA 3B70A 3IP3A 1IUKA 2GZ2A 2WSBA 5CPBA 4YT4A 3I52A 5TT0A 1NVGA 3INTA 4ALJA 1IOLA 3VOSA 3U4DA 1ADGA 2PKQP 4J1NA 4ND5A 1A71A 3MEQA 4FFPA 2O3JA 3I5MA 3NTRA 1R0KA 3SJUA 2NNLD 2G1UA 3GZNA 1K6JA 3FD8A 4GQAA 4WPGA 1DPGA 3S2GA 1LU9A 2ZCUA 2OXIA 2BMAA 2CY0A 3PLRA 2YUTA 1DEHA 1WNTA 4IGFA 4LK3A 4LN1A 4AG3A 4MJLA 1YH3A 2R6JA 1HSOA 4WEOA 1ADFA 3LZ6A 4ID9A 1B8VA 4ZQEA 4XYMA 2I65A 5DOVA 5JSFA 1PWXA 3DHYA 4TWRA 2AHRA 4J91A 4R5MA 3BMQA 4DYVA 1R4NA 2D5AA 3JD2A 5GZ6A 5L4SA 1XA0A 1NPTO 1ZUD1 3PLNA 3IC5A 3L0DA 1Y8RA 3W8EA 5L9AA 1W6UA 4WLVA 3UGKA 3GN2A 1YB1A 4GLLA 4UULA 4BQRA 2NVBA 4CM3A 1W8DA 3GRKA 1HRDA 1IPFA 2ZIZA 2NVUB 3EUWA 3FWNA 1QG6A 1P3DA 4CMIA 3NYWA 3PP8A 3IAHA 5JS6A 1DIBA 4D0RA 4DIOA 2HLPA 1LRJA 1JKFA 1GL3A 2YQ4A 1DRUA 1E3EA 5L7YA 3GA0A 4AJIA 3O4RA 3JYPA 2FN7A 3EMKA 3HJAA 4WLOA 1ISFA 1Z75A 2TMGA 3U3XA 4AFNA 2O3QA 3JQ8B 4PVDA 3OICA 4R5HA 2Q50A 2X9GA 4Z9YA 3R0IA 1N8KA 4AJEA 5ITWA 4PLCA 3ULKA 3EGOA 2RIRA 2Y68A 5ER6A 1TT5B 3NDRA 4TZTA 1GYQA 5JO9A 1LA2A 3PWKA 5DF1A 4NBWA 4BNYA 4WCDA 2CVOA 4F3YA 3GR6A 5A3VA 4BNZA 3KB6A 3DBVO 2WYWA 3JCZA 3GQVA 3TZKA 4L4RA 1BDBA 1IYZA 2NWQA 5BNFA 1OI7A 2J5QA 1ZIDA 4CPDA 4DLLA 4BGVA 3IUSA 1HLDA 3TN7A 3F3SA 2DBZA 3JQ9A 3CKYA 3C7CB 1Q1NA 4DC1A 1U3VA 1E7WA 3D3EA 3BMOB 3KBOA 3N7UA 4ALMA 4A2CA 4I5EA 2BGLA 4DPLA 4BL5A 4RL6A 5FI5A 1WDLA 2WTBA 4RPHA 1GTMA 2D3TA 4NBVA 4YT8A 3ROMA 2DM6A 3VZPA 4BIIA 1QYDA 3KHUA 1PZGA 4E12A 1YL6A 3GOHA 4E2WA 2XAAA 1SOWA 3DZFA 3F9IA 4FBGA 2GF2A 1YBAA 4O5OA 3WBBA 3OECA 1ADCA 2C2XA 1U3UA 2CVZA 3WNVA 2FOIA 1I36A 2OBYA 1EBUA 3LT0A 2DTXA 4MVJE 4DGSA 4R1SA 1J4AA 1QORA 3X2FA 2PZKA 2R00A 3HDHA 1YDEA 2Q2QA 3SLGA 2W2KB 4AJNA 3D3WB 3KYCB 3LC7O 1EMDA 3GMDA 3NV9A 4NJMA 1B2LA 4E5NA 4TRJA 3OJEA 3V2UA 4Z0HO 1GR0A 1RKXA 2ZQZA 4J9UE 3GFBA 1KVUA 3INGA 3Q1LA 4FSHA 2X0IA 4WLEA 3OMLA 5ITVA 3H7AA 3TDKA 3F5SA 4AVYA 3AM4A 5TRTA 4TKLA 2VTDA 1I30A 2ZYGA 4BNHA 4BNGA 1PQPA 3GAZA 5IDYA 3WFIA 2D5CA 2FSVA 3ZWOA 4IDBA 2Q4EA 1RM0A 3U5TA 4J4TA 1BMDA 1Q7BA 1UAGA 3LQFA 4JJGA 4CQLB 2EGHA 2HAEA 1EFKA 1I24A 4DLBA 3NGXA 2BFPA 3G3EA 4CM4B 1UJMA 2NU9A 5DULA 2OORA 5A5EA 1X7GA 4TSKA 1UZMA 4YWJA 5IZ4A 4M49A 4BO3A 3Q9NA 4BNJA 1E7QA 3D64A 1Y7TA 1N1GA 5DDIP 4MVJF 3MOGA 1KIFA 1ONNA 1VL6A 4Z0PA 2PKQO 4FFOA 2QHXA 1G6KA 2BFMA 3NDIA 1T1SA 3NJ4A 3JQAD 2NTJA 4RGBA 5AOVA 3ZNNA 3OEYA 1GU7A 3O38A 2EHDA 3GUCA 4K6FA 1HZJA 4TVBA 2VWPA 1PX0A 1Z73A 5JAQA 3WIDA 5EL0A 4U8GA 4U0JA 4XR4A 1NASA 3JYLA 4Z0TA 3S1LA 5KJ6A 2Z1NA 2OUIA 3U09A 4E21A 1RYDA 3GFGA 3RSHA 3GDFA 4YT5A 4ZD6A 3WICA 1VL8A 4AJPA 3RQSA 2VZ0A 3RUDA 3Q3CA 2B36A 3TPCA 5JY6A 4E5YA 1HYEA 3S2FA 3DHNA 5ADHA 4CLOB 2B4QA 1XWFA 2HKIA 1P1JA 2IZ0A 4H3VA 5MGBA 2VYNA 2CF5A 2JAHA
chains in the Genus database with same CATH superfamily
3HV2A 5CXUA 2FWJA 4IIXA 2ZJ2A 4QVGA 3TX2A 3ZWAA 2XNCA 1PSWA 3IUJA 3K3PA 4PYJA 2LVBA 3N1UA 2XXJA 4Z4HA 4G8CA 2FPUA 4LHXA 4B7AA 1OXVA 2DLNA 2CZGA 3DVRX 5I8WA 5IABA 2ZGVA 3B53X 3V8MA 2H2GA 1IRIA 2QG9A 3PGVA 4IUDS 2BI7A 3DC7A 2O1EA 5A3QA 2HV8A 2V0CA 4B8ZA 3T34A 4KJXA 4HEJA 3JQ8A 4NULA 4CIAA 5EHNA 5K8LA 4Z6KA 1L7BA 5D3MB 1CETA 3TGLA 1FPQA 4X71A 5BQPA 4OHBA 3MB8A 3HDQA 2DQKA 1K92A 3GT3A 1C3EA 5HIMA 2NSLA 3S99A 1SCKA 3KC2A 1NY5A 1P0MA 2M6RA 3QUBA 4QUEA 4TRNA 1ESNA 3R44A 4ERXA 1UQUA 3AOGA 4R1NA 4F84A 1ULZA 4N5MA 3KQYA 4M89A 4M36A 1U0JA 3ZW8A 1O9GA 1KOGA 4GKJB 3CR8A 2BFAA 3PQ4A 3TLZA 4HRXA 2BKUA 2ZR9A 3PUKA 4GR5A 4DLXA 4XARA 3GIWA 4MUEA 5AVZA 4RIFA 5AJZA 5FFMA 1JDUA 1HDZA 1IEXA 3NH9A 4TT8A 1GPYA 1PSDA 4Q37A 4YN3A 1PV4A 1QOQB 1STOA 4N76A 4Q01A 1Z7GA 5DI9A 2VG8A 3TDMA 3NRCA 3QEAZ 1EUDA 2XYHA 2XCUA 2Q6VA 3CLSD 3KHTA 4LA4A 4ZI3A 3D3KA 3DCIA 1XLTC 1GD1O 1W4ZA 3VKWA 2H7XA 5JSZA 4AKIA 2JD0A 2GRAA 5BT9A 1RWNA 2FFJA 1SUSA 2E4VA 2YYAA 4I3FA 3SKXA 3FPCA 4L3VA 1IXSB 2YBDA 3HA2A 4S12A 1VOTA 4WFIA 4R1PA 1JSRA 2E6KA 2R5NA 4XGQA 4EHNA 1M2OB 2FX2A 2PKXA 2ZBRA 1VSVA 3W5AA 3F9RA 2AQKA 2YZNA 3MGKA 4IV8A 4M9UA 4JP5A 4E2YA 3G7NA 2XXAA 1NX6A 2F43B 1VI2A 4QTZA 1VLMA 1ZD4A 1EP2B 2P3LA 3PNYA 4KQKA 5JNTA 5B3JC 1LFDB 2I1WA 1X74A 5K0SA 1Y7LA 1Q0HA 2ATXA 2HU5A 2ZRBA 3IGFA 4EABA 3HWSA 4UMVA 3K1ZA 2PG3A 2WD8A 5AVQA 5I7OA 2ZIUB 1JLRA 1L4GA 2O6HA 4MCAA 3KWJA 4M83A 2ZRNA 3TLEA 1ZUHA 3KT0A 4GEGA 1LS1A 2JFUA 4JI8B 5K09A 3A6FA 1A1VA 3AJ9A 4Q1BA 3ES9A 4L0QA 1IXKA 1EGHA 1HTBA 4ZHQF 2IXTA 5LDHA 5GGXA 1GZSA 3JX9A 1YZNA 5DGIA 1XQWA 4B80A 4JNCA 3LUDA 1G5QA 2DBVO 3ND5A 1RJEA 3ZDEA 1DAGA 4INPA 5K01A 4QOSA 2E4AA 2W83A 2IUSA 3QWFA 1ULUA 4YUWA 3KJIA 3HBNA 1O8CA 1Z6ZA 1E8DA 2NSHA 4HDAA 4MVJI 4MQBA 4RH0A 1SHJA 3BCSA 3FPGA 1TC2A 1U7ZA 4JDUA 5LPNA 3I1IA 3MBOA 4C20A 3H83A 3MS2A 3TMYA 3TQRA 3UWMA 4ZI2A 1CZKA 4RW0A 3F9CA 3LZDA 2K2WA 1JB1A 1N2CE 1F0YA 2M32A 2Q5IA 2BCEA 4MIYA 5JU6A 3FAKA 5TLSA 2XNKA 2Y4OA 5EJ5A 1E3MA 2OY0A 4GPD1 4GBGA 3QX8A 4CJXA 5DOZA 3MFYA 5FT9A 4EVIA 1VE9A 1QHXA 4DV3B 3VPSA 5HCIA 4M55A 1BIFA 1RC0A 2FN3A 2HHAA 2ZIXB 3B2QA 3JVEA 5CFPA 2X8LA 1IQ0A 4JSRA 3LBAA 4ZOLF 4HGZA 3ZZMA 4BO0A 1NQUA 1FRQA 4DCTA 2H2AA 4JHLA 1IHXA 1YDGA 3AUAA 3AR8A 4QREA 4NJEA 4MDYA 3O82A 4GZMA 4D79A 4PG4A 1UBOS 2HNBA 5IDXA 4FGJA 1ZC3A 4D45A 1IFXA 4N5HX 1OLUA 4EPTA 2CXOA 3CX4A 3K30A 4MKFA 5IBRA 5LSAA 1DJNA 3CURA 1EEHA 3ORYA 2PFSA 2ZUCA 3UICA 3BC1A 4BLPA 3MUNA 1I3KA 4JQZA 2Q2VA 3O8BA 1V0JA 3GJ4A 3IIKA 5DLPA 2ZBUA 3RTCA 1C1DB 3C7TA 2FW9A 1GEGA 4TLMB 2XGOA 4DARA 4I3GA 1WF3A 3A58B 4CCWA 3KG2A 4JROA 4HLDA 4GU5A 4ZMSA 2XAUA 1FXWA 3KOWA 4GWGA 3ZNPA 5GJVC 1YZYA 2NXNA 3VGJA 4XGKA 3BGDA 4HX9A 3FYUB 3Q8KA 3CCBA 3KR9A 5JAOA 4H6WA 1NM5A 3AEKB 3QMMA 2HLDA 2BELA 2PGDA 4JJEA 3WE7A 4LF5B 1FNBA 5IP5A 1HM5A 1A4UA 1QV9A 3G0GA 1AGXA 1I7LA 2AJ8A 2CUZA 2H3HA 2WF6A 3BZBA 1W35A 1FQOA 2VBIA 1A88A 1X2EA 4XB2A 2R68A 3EIUA 3LX5A 4BMZA 1WA5A 5BV8A 4QM6A 1G7RA 1Y5LA 3NG1A 16PKA 1EM6A 1QHHB 1QHGA 1UUFA 1XZBA 2X9LA 2ZSAA 4N6NA 3AVVA 3O90A 2G17A 1O97D 3EEOA 2JLRA 3AHHA 2YW9A 2X23A 1KAQA 2YJ6A 1ZQ9A 1KA9H 1TA0A 3PVCA 3T6KA 4B8YA 4Q9NA 4OAPA 2Q0QA 5A4AA 5LL6P 5I48A 2QYOA 1T4DA 3COZA 3TQQA 1YS4A 4WBNA 2YHAA 3HBMA 5DTQA 4DMHA 3L8HA 5FPQA 4ZCQA 3ACDA 4BCBA 4GH5A 5JFGA 1YGPA 4LHSA 1NU6A 3T5BA 1QF7A 3KTDA 1E92A 1PJLA 1NGSA 1R9MA 2I71A 4IJVA 3HYNA 4HFJA 5C1IA 3MJVA 4OBBA 3MCWA 3L6CA 4TOIA 3UJDA 2ZWPA 3I72A 4HQLA 4MUAA 4IS2A 5CXSA 3A6HA 1IN4A 1VJ5A 5PNTA 2KWIA 2PNFA 3G17A 2ONZA 3N07A 1FVFA 2GRJA 4XYBA 3D7NA 1YRAA 2OFOA 1V4NA 1VJ0A 2G36A 3NVAA 4IZOA 5D2CA 4EYSA 3B36A 2O0LA 4J7XA 4WACA 1JSLA 2G8NA 3A70A 2D2FA 2VDOB 4LTNA 1QDEA 4PFKA 3U7FB 2R8RA 2PY6A 1U1FA 1NI5A 1X7WB 5HPYB 2H2FA 3ZYZA 1GPH1 3DT8A 1DRWA 1FFSA 1E2HA 4ZGBA 1KNQA 2EDCA 1JFFB 1ZO8A 3R8CA 2BONA 2DT5A 1Y8AA 5EKDA 1AE1A 4C6HA 2JG3A 3WGNA 1HL7A 5BW5A 1K2VN 1NDUA 4IMRA 4M54A 4LGYA 3ZCVA 3GXBA 3KTFA 4WZBE 2GX6A 5T64A 1UDRA 2HDHA 1A8SA 3AUUA 3MXTA 2ZRQA 4JBGA 2OQ2A 2X1HA 2R97A 3P71T 4K9QA 1C8LA 4TMYA 2FXIA 4TQAA 4UFNA 2VXYA 1A27A 3SEAA 4D9BA 4E07A 4CTNA 1PT8A 2ZG6A 4J6FA 3GT0A 2JZCA 3W7BA 4A82A 1DQZA 1JFLA 4JKOA 4R8LA 2QMQA 4LQDA 4ZO7A 1Y98A 1J90A 2AN3A 2IHKA 4BZWA 5P8WA 5I9NA 1Y9ZA 2C3YA 3QTBA 4EWLA 4HX5A 1Q84A 5AWFC 3T9CA 4PYOA 1A95A 1WMSA 4LRTB 2G5GX 2VJBA 4UDYX 1JVBA 3T8YA 3FNRA 3JALB 5E6RA 5H83A 5IN4A 5YASA 2QW0X 4KR7A 2A8YA 2PSDA 4OHWA 3FSGA 3EXHC 2XCLA 1KWGA 4C78A 5ICEA 2R1VA 4OI4A 1PJ4A 3T7AA 1VCHA 2OK8A 2DSTA 5CJJA 5TQVA 4QX6A 2ZB8A 2IVZA 1THZA 3ANTA 4HSGA 1RBYA 3MJ4A 5FNVF 5FBWB 2Z4RA 4R9NA 1QFJA 3W1EA 4FCCA 4B7XA 3HKDA 3DQZA 3G8DA 5LB4A 4XXHA 3M81A 3NBUA 4OP1A 1YJQA 3ZGZA 1PI3A 4AY5A 4WJLA 2LRHA 1KXJA 2EL7A 2JGEA 3AI3A 2B20A 5ALYA 2GCPA 3I9V6 1QC5B 3KD3A 1KP3A 4IJ5A 3RS0A 5TR9A 3S0JA 3ZGOA 4ZVMA 4BFVA 2OXTA 3H1GA 3NLLA 3UWOA 1EU1A 4DVJA 4RQBA 1TM4E 4TT3D 4Y6PA 4BGUA 5HXAA 1CJUC 1ZH0A 4YRBA 2OV1A 2FDCA 4IMIB 5JLAA 2E5FA 1L7EA 4IUYA 1O94A 1OX5A 2ZANA 2ZJ6A 3IIJA 5CVCA 1I0LA 4HLQB 2KBEA 3OQ6A 4FT2A 3M6AA 2WQZA 2VPXA 4UDNA 4U2KA 1U4SA 4RKWA 3NTOA 3LQKA 3IELA 1LQTA 2JIBA 3QG5A 1AV7A 1P0IA 3DNMA 3PIDA 2J0EA 4FNMA 3VR4D 3PC4A 4Q18A 3PXUA 1VJCA 3KFXA 4FR5A 4HH0A 3IESA 1L4FA 3LIIA 4FDVA 1LFAA 2BHSA 4M88A 4MCIA 4EKIA 4H2DA 5AVYA 5BR7A 2I03A 4WOJA 3B8EA 2EV9A 3O2JA 5DM2A 1GFSA 4IH4A 2I6XA 5HCNA 5J63A 2RAFA 3C70A 4F04A 1RCTE 4MYRA 4EFDA 4EB8A 5TXGA 1M6YA 1F4PA 4Q1AA 4F2WA 1QIFA 1XRSB 4DDMA 1L5GB 2I22A 3SXUA 1FB5A 4IICA 4A8HA 3JVDA 4QG3A 2RGNA 1IZ8A 1J09A 4JLSA 4EO7A 4XD2A 4ADSG 1IHYA 1GPJA 1FSGA 1FQWA 2JFYA 3V1KA 3WDKA 1S1CA 4BNTA 1RRCA 2VHEA 3NT5A 3NWOA 3O3MB 1O5OA 3B5EA 4YQFA 4W8OA 2PX0A 2HF8A 4RY8A 3B60A 3SYNA 3CVXA 1G2PA 1Z8HA 4IGIA 1CHNA 1EDOA 3TIFA 3C4VA 1HLGA 3LP5A 3N86A 3P9CA 1QHFA 1Z22A 1DVRA 3GLGB 3CNOA 3D0RA 3I9LA 4M1ZA 4XB1A 5IZCA 4JOCA 4H31A 2G80A 4AQDA 2PLAA 3A37A 2IKSA 4AMYA 1T4CB 2AUTA 1YCDA 2X0KA 3RSLA 4FFRA 3ZHQA 5KUTA 3NX4A 2DGDA 3B9QA 1T5BA 3ZH2A 5HWSA 3LPNA 3R7SA 1WY7A 2RBGA 4KX3A 5DNCA 5J4LA 2BTQA 3N8IA 4DIUA 3LPMA 4LWOA 1NU8A 3LPLA 3OOJA 2J6IA 4J0DA 4FCWA 1JHVA 3UHAA 5C51B 3EYWA 2EHJA 4DT1B 5L7TA 2JC3A 3WYBA 2ZBQA 3NUGA 3ZHXA 4ZJUA 3OZWA 4C5AA 3CCFA 1Z0SA 2VYFA 5EJIA 3P9NA 4NENA 2WJHA 4L8GA 1XX6A 3KOXA 1SQ0A 3G2NA 2Q4OA 5TDHA 1O6ZA 2BFFB 1TX4B 1Z39A 2H17A 2ZS8A 3L0CA 3LM8A 4MI6A 1ILEA 5HMLA 4PVCA 1GADO 4KN9S 4M8NE 5ALNA 3DMDA 1B1AA 2CKMA 1JDTA 2O57A 3O3OB 5JXWA 4B3GA 4ZHQB 1T6NA 2C42A 2BBOA 4RDHA 2FPKA 3EQ2A 4X3OA 3JQDA 5AI6A 3RFFA 3W8NA 1ZRNA 5MFPA 2PLRA 3OD5A 1OH8A 1TJ3A 4DYDA 4XQ9A 1NBMD 3M89A 1BQ4A 1VI6A 1UBHS 3HJFA 3HY6A 3PPYA 4LYJA 5IDWA 4MI9A 1T4GA 1NQ5A 2JLXA 1XF9A 5L3ZA 1RBMA 5DM1A 1N9GA 3VISA 1H5UA 3MXOA 1I7PA 4R1MA 2BLLA 5I4IA 5ER9A 4BRZA 1E3LA 1YGYA 4BZZA 2XIJA 4HB2A 2X5OA 1GCUA 3F8WA 4Y7DA 4B3HA 2JAWA 1X7YB 3E3NA 3FFTA 4CM1A 1MO5A 4FILA 2I4IA 2R11A 1AG9A 2VBGA 3STXA 3TE7A 4HVTA 1P2BA 2DFKB 3DEYX 3W90A 1QMPA 4BC0A 1FVXA 1ODCA 5GWXA 1YKSA 2EQ5A 2XADA 3BRCA 4GKAA 2JJYA 4CL0A 1P7VA 2ZE5A 4YCNA 4ZOLB 3I2JA 5C7LO 3N2GA 3UMMA 4O5AA 3HTXA 3VR3D 3GCGA 5JSHA 3PCRB 4NICA 3W2TA 2OP0A 3H99A 1IEQA 5AK0A 3LQ1A 3VPBA 1RWVA 2ZPUA 3OTQA 2IE8A 3NVKI 1XVVA 1Z38A 2CE2X 1EINA 2MMCA 2PK3A 1T5OA 1IJFA 5DNVA 5IBCA 2DP4E 4F97A 1MPTA 1FRZA 2I29A 1BWSA 1Q1EA 5K8JB 4B5LA 3W8DA 4CV3A 5F2KA 3OURA 3I4FA 5AK3A 3TMAA 2CYCA 1AQUA 1SXJD 4KE6A 4OCZA 1DCFA 4NCNA 1SUWA 4YAFA 3UF0A 1C7JA 2PLWA 5JQWA 2FWMX 3AB8A 1H94A 1Y7HA 3K0CC 1H3EA 1FDUA 1JA9A 1C8VB 3GWZA 3HWX1 4RK4A 4F4DA 5CXQA 3PK0A 3I92A 4CV1A 3SQLA 5HF8A 3FZNA 1NV8A 4MAMA 4ZEOA 4C9BA 2I6UA 5ICFA 3C7KA 4PINA 4MPJA 1NN5A 1CQXA 2P0AA 2ODBA 3TCXB 4B7ZA 1TUGA 2GYUA 3UPDA 1N2CB 1L5ZA 4BNDB 1PHPA 5IU6A 2VHXA 1E6MA 4N65A 5EIWA 3VUFA 4MV8A 2R2GA 1TQ6A 2OSVA 3K8ZA 1KJYA 2QTHA 4RC9A 5CBPA 1T9KA 1VLJA 4ZV7A 1YZVA 5K3SA 7ADHA 3QVGA 2ZUFA 1EBBA 1YKFA 3G59A 2QENA 2VNJA 2VJKA 5CTJA 5F21A 3B5IA 4UEWA 5HFNA 2I8LA 2JFBA 2C7RA 1LC3A 4HLUC 4OQYA 4UHDA 1SC6A 1NWHA 2OHFA 2BFEA 4RJKA 1YQDA 1TQ2A 4XFJA 1QP4A 4UNQA 2BMFA 4B83A 1RAGA 3LW7A 3AY7A 5E4FA 3TG2A 4QUBA 3IHTA 3B1VA 3JQ7A 3KVOA 2OCXA 3GJ3A 1NRXA 4NC9A 4XOIA 4FKMA 3WLTA 1M74A 1TVMA 3E6AA 3EJWA 5BNWA 2CXHA 3VH3A 3UW3A 3U7GA 5J40A 3HFRA 5GADl 5EAIA 1GQQA 2RH5A 3QE0A 4GBMA 3SHOA 1ONPA 1J7JA 2BMJA 2GM9A 4O2LA 5C9ZA 3KD2A 4JD5A 3KIPA 3OJCA 1S3GA 5KI6A 5I7AA 1BS2A 1AVTA 3I9MA 2X5JO 3QMVA 3TSWA 4BN4A 5AUNB 1SVWA 5CA1F 2XVXA 1D7AA 1C4OA 1M8GA 3A1SA 4KLNA 821PA 4IIUA 4M21A 1T5SA 2JCVA 1GGHA 2ZU6A 4W7HA 1YBMA 4D80A 3ETCA 4I50A 3H11B 3OHSX 2FN8A 4C30A 3AYZB 2EJTA 5FPHA 3AVTA 4LRXA 5C1DA 3CNHA 1PZXA 4YCJA 3VC1A 1UKCA 2AJLI 2IEDA 5K0EA 1K97A 1UM9A 3MHPA 3RVLA 3BK1A 3BD9A 4N3NA 5U4QA 4CVNA 3U44A 1Z2EA 4OHFA 3L79A 2Q27A 4Q9LA 2FEKA 2WUFA 4GPAA 3F4BA 3FCCA 4DBZA 1XZEA 5D1NA 3L4JA 4GGOA 4HZIA 2OO5A 4N7MA 3NBZC 4YEDA 1EE9A 3UUFA 4QT4A 4LBZA 4U00A 4LX0A 4DUYB 3UK0A 1QYXA 4INAA 1HEUA 2PUCA 4A6XA 5K5EA 5I7FA 5B1HA 1K0UA 3EGDB 4LY0A 4IFIA 2BFNA 2Z6VA 5FUXA 3VZCA 3KPYA 4F6RB 2DWCA 2HQRA 2PJZA 2GZDA 1DX6A 2VSNA 3O8OB 4DSOA 3DOCA 1ZI9A 5JQGF 4JMLA 4CTKA 1ZD5A 3DMFA 5AW7A 2VHUA 5CEFA 1BXGB 2XWPA 3ADOA 3G5MA 2WIDA 1CR0A 2NMVA 5B58C 2QJWA 3H84A 4ZTBA 3KSZO 3WR5A 5EIEA 2BGWA 1NVAA 1O54A 4I5DA 4ZVRA 4CIDA 3SR0A 2A9PA 4TQ9A 6REQB 4GRDA 1A4XA 1KETA 1QWOA 1USKA 3PFHA 3PJDA 3FWZA 3S29A 1VL1A 4CYMA 2OYCA 5KVSA 1ZP6A 2Q3JA 3GPIA 4P31A 1M7HA 3UBTA 2V9ZA 2AYYA 3LF2A 4QNMA 3ROFA 2A7XA 5LUBA 1XPJA 4H6XA 1ZR2A 2O2XA 1VJDA 4NBRA 2IDJA 5FL3A 1K6XA 2FK8A 2HA7A 5A5GA 2X4GA 4OP2A 1KEZA 1TW3A 4RJ2A 2G9QA 4HGQA 3O03A 1JFSA 5FNVB 3V5NA 5ICCA 3F46A 4W7IA 2NU6B 4DPKA 4RFSB 2AXQA 3FI0A 1XMSA 3DD5A 3HXKA 4TVKA 2O4CA 3GF4A 2Z8YA 3D8TA 4WZBB 3WJ2A 1NC1A 3AM5A 5EGSA 3IDAA 4C04A 2EWWA 3TB4A 2A5YB 2PFKA 3BGSA 3ZQUA 3F8SA 2PEZA 1P1RA 1PLJA 2FRDC 4HUQB 3T52A 1CULC 3D6TB 1PAUA 1QZTA 3I39X 3KU4A 5K0ZA 3KQVA 1VG8A 1VYUA 1MX3A 3PPWA 4IIFA 4EVQA 3L6DA 2CK3A 1QCYA 1DG1G 5CAEA 3AVPA 1UZAA 1WKVA 2WJ3A 3ZW7A 4L2IB 1O96B 4IDAA 3VZRA 3GHHA 3H19A 1V4VA 3PX3A 3AL2A 4R0NA 1XNRB 1V2GA 2EQAA 2BSAA 4RD0A 4QXRA 3DCJA 3EAGA 2WABA 1JB9A 3ESCA 5TB5A 3PZRA 4ILEA 4OM8A 3AI2A 4CIVA 1WDWB 2P90A 4KXYA 4DHWA 4Y2SA 3AG6A 4TZKA 5B4UA 4XGIA 2C1ZA 4B6GA 2BCGY 4Y2UA 4DREA 3KSBC 1RVV1 3C6BA 4PTZA 4QHTA 2NU8B 4B3CA 4XLLA 4ZVLA 1GG9A 1GN9A 1M7BA 1UKYA 4X41A 3BL6A 5DLDA 2H1IA 4HZGA 1RP1A 4OSOA 4WY2A 5CD1A 2ZSJA 3NCTA 1FFHA 1T5DX 5GVRA 4QPDA 3RTAA 4X62B 4HDOB 1R8XA 3R2JA 4KACA 1S9HA 3UMBA 2E87A 1WOMA 1IHOA 4YAUA 1QANA 2VRCD 3H5TA 3PQ2A 1NSYA 3IE2A 4NNJA 1X7ZA 1E4YA 5JW6A 1SD2A 4ND4A 4IY1A 2GBPA 3CIOA 4UQOA 1V6SA 1WSDA 3LCVB 4P3PA 4Y30A 3BH7A 2QRUA 3TWOA 5DM0A 1V96A 3EIWA 2FPIB 1P2TA 2ORYA 2H8GA 4NCAA 5FCDA 3SBEA 2OV6A 1SM4A 5KOHB 5FWYB 3K4HA 5EXXA 3KEFA 2VS1A 4Y2JA 1SD1A 4A23A 1ZN7A 2IIBA 1IZ9A 4YB8A 3VDNB 4DRZA 3P45A 5KVCA 1YJCA 3HGTA 3OLYA 1THGA 1NY6A 4BVHA 2ETVA 3KB8A 8ADHA 1BN6A 4MPDA 4KO4S 2W2QA 3ENQA 4QOIA 3G7UA 3IEKA 4YXFA 5AHRA 5K3BA 5KWJA 1LY1A 2C2ZA 1V1MA 1XMXA 2ZW9A 4LJ9A 3FW1A 1B8PA 1G21E 2HZBA 3Q7IA 1T2FA 1PYGA 1T1RA 4Q39A 5MHTA 5KNCA 1LTKA 3ZLJA 3GY0A 4WN9B 1CY1A 1G98A 3B6KA 1K2WA 4GMXA 3NBMA 2VH5R 2OXEA 4AD8A 2V6FA 3OLCX 1R2QA 3QV2A 3R3HA 2Y6VA 4B43A 3IA2A 1TD1A 3B78A 1RXUA 4EYGA 5JRJA 5B2ZA 5D87A 4MZDA 4EY6A 1S3SA 1SRRA 4NOKA 1YIAA 4YFYA 2QG6A 3X1WA 2O05A 1II9A 4JI7B 4TXNA 4YJ3F 5JCJA 1HG1A 1L1EA 1XHFA 2Y1LA 2OZKA 4HAYA 1Y5IA 2Y93A 4MW9A 4KJZA 4WW0A 4ASUD 1KMCA 1U3TA 3MQ2A 3ZE9A 4AP5A 1ETHA 2QYTA 1BVUA 4GPZA 4GE0A 3MS7A 2PX5A 4QQFA 2PRSA 3D54D 2XUHA 3PJGA 5DXJA 5IM5A 3K9QO 4NEQA 3ZWPA 5K0BA 5LQRA 1YZKA 2JANA 1IIRA 4A6PA 4L74A 1G6OA 4KLAA 3DZJA 4C6RA 2FQWA 2VPZA 3NTXA 3IP8A 1U9ZA 2NSDA 4TQGA 5HS6A 2GI4A 3HYRA 2QBYB 3LW8A 3EIEA 4DNPA 1GNTA 1JMYA 3GG9A 1P7WA 1RJ9B 4DPMA 5KU7A 1KYTA 3N74A 3NEYA 3W7AA 3DBIA 4EYQA 3B7WA 3IMGA 3RWOA 2C07A 2ZAIA 1C8BA 1Y3AA 3U3ZA 1QTQA 1U28A 3WYNA 4BBJA 4RJTA 1A7JA 4PPGA 1RQ7A 2YYSA 3EH1A 1WBBA 2YCBA 4L5BA 4IIBA 1LPPA 2P3SA 3VYRB 2PR2A 3DTVB 4Y1RB 4I9FA 4DZTA 4BB5A 1CEQA 3TM5A 2OE2A 1UWKA 1E96A 1UBEA 1MA0A 1VQ1A 4LMPA 5JMOA 2FHSA 3NP7A 3VSCA 1J0DA 1JGTA 4C4YA 5IF3A 1ZD9A 3ND8A 1UPBA 3E8SA 4U3JB 3ZU6A 3EFOA 3SIRA 1JKJB 4AJJA 5G4KA 1W4RA 2FWPA 2QVGA 4IJQA 4N5DA 3K4PA 2PT6A 1R9GA 1JXOA 1P0CA 1V2HE 2X8AA 3PNOA 4LV5B 1SURA 4UARA 5EIFA 4CDMA 1FNMA 1JZSA 3WQSB 1WSAA 3A4TA 1DWOA 4BLVA 3MQ4A 4XYLA 2HY7A 1XVIA 2WJWA 4V0NA 1L5NA 1UANA 1ZMTA 4A16A 5HIAA 4E3WA 5KSZA 1R8YA 4L28A 1CFZA 4IUBS 1OVGA 5BUQA 3NHMA 1SCJA 3Q41A 2FA9A 4KWTA 2A57A 1Z3IX 2VJMB 3QU5A 2X0JA 3LHIA 3QJYA 1L4BA 4Y2GA 5IAKA 5M5BA 2HGZA 3DMNA 3U16A 3A4MA 1WHTB 2PUEA 2G28A 1HFKA 3FCUB 2GN6A 2NUPA 3GC6A 4JC4A 4R8RA 1IN1A 3EVZA 3SZGA 1KK0A 4J0FA 3ZWKA 3BD6A 1ZH4A 1ZUWA 2OWEA 4Q82A 3EQ7A 3VHXB 3OF2A 4KOAA 3G85A 1DQSA 4BTEA 5FR1A 3QOWA 2HJHA 2QPAA 3MK31 2QX9A 3FDIA 3QQPA 3WOHA 1BFUA 2IOQA 5FHQA 4ZCRA 2RIPA 3ZV3A 3HBJA 2C96A 2JLZA 3GN1A 1E2NA 2EFYA 1Z4LA 3BRWD 2WP0A 3H3XA 4Q4AB 3ELBA 1C4XA 1G41A 1NW7A 2GEBA 2WKWA 3BXGA 2Q9AA 2VHWA 3I23A 3M7IA 5CTAA 5SZHB 1G0NA 3GOQA 1AMOA 1C0PA 2FCAA 3TW0A 1OQAA 4M1QA 2XVMA 2ZT8A 2HHLA 5F2NA 4L4UA 5EXDA 3D7KA 1Z62A 2QQGA 4Q16A 4CHGA 1W44A 3EK2A 5CM2Z 3U80A 2CHUA 2BHRA 5B3LA 2HSWA 5B57C 4ZHSA 1T8RA 1F14A 4M3NA 1U7TA 2C0QA 3S81A 3IMKA 5FOXA 1NBAA 1KJJA 2NADA 3AHJA 3INYA 4V2UA 5CP8A 3PPVA 4UNSA 5FBLB 3TAHA 4F7WA 1LD3A 3O31A 2JCYA 4G24A 4BVKA 4WUVA 2H1VA 3OT1B 3ROEA 3QPUA 2QVYX 5FBQB 4RY0A 1XNJA 2ZFUA 3RUHA 1QP7A 5AVXA 1ESDA 3ENWA 4DMLA 2Q3HA 1EVZA 2ZZKA 3QEKA 3AIIA 1X9GA 1C7FA 1U2GC 1AZTA 1P1CA 4QPPA 2NV6A 1N5DA 3KUDA 2IU3A 3KJNA 1AGRA 1P17A 1M76A 1NVWQ 3E61A 3IDOA 2ISQA 3M5WA 2QROA 3FYCA 4KO8A 3WKBA 2ERXA 3C7AA 4OA5A 4OB8A 1WF6A 4D9KA 3UH0A 2OLEA 1DWQA 4N7RA 2GDZA 1M2HA 1GA6A 1X1RA 3NFRA 1BU8A 4JX8A 3R0QA 2AW3A 1M2OA 3DHEA 4CIBA 4DSTA 2P6NA 3GJXC 3AR7A 4AF8A 1WLSA 2A3NA 1CR6A 4R9SA 1XEWX 2G06A 5KJ1A 1ZAYA 4PHGA 3RYFB 1R00A 2F43A 2VCEA 3NT2A 2O06A 3NTLA 3QU4A 4XSHA 2M6KA 1OYWA 1RKQA 3NGMA 5E1DA 4XVUA 3ZDQA 1I8TA 2B4RO 2BFBB 1Q3HA 1TMGE 3GRUA 4L08A 2DFVA 3VPHA 4CM8A 2IXAA 4HNVA 1JWLA 1Q0SA 1ZJ6A 2RC6A 1H9AA 2QX7A 1ANKA 1YB4A 2ZK7A 3DG9A 5D51S 1ZCBA 2ZI3A 4DCUA 1VFNA 4JUFA 3F1LA 1UMBB 1HKUA 1J1ZA 2NPOA 3D43A 1GKUB 4R7TA 4A0GA 1GTVA 2D54A 3EGIA 3WMGA 3ESDA 2F9FA 3MWFA 1SUCA 3HUDA 1KH3A 2N75A 1GPKA 2COKA 5JQGB 2C4HA 3Q0IA 1PL7A 1SG9A 4YAOA 3LT5A 5AVKA 1OR8A 2PZLA 3C3KA 1E59A 1JLKA 2HCBA 2JH8A 3NASA 4KFUA 3WQQA 5KTRA 5LQMA 4BBZA 1SEPA 5TY0A 4Y0VA 2VPWA 3QBEA 3MMNA 3KLBA 1N6LA 3U7HB 1QO7A 1DS6A 1TT7A 2FW6A 3DM9B 3LF1A 3WLJA 4EG7A 3U1BA 4D02A 3PT5A 4LV8B 2C7OA 3TQTA 1LJUA 1Y8CA 3FY4A 4IGEA 4LXGA 1KK1A 4EY5A 1F2TB 2K4MA 5FQNA 2GMWA 3ICCA 3K9GA 5JI3E 3WAGA 1CUAA 1YZUA 1N6IA 4OHXA 3RIYA 2YY7A 2GAFA 2PGNA 1UBUS 4BZQA 2GEUA 5KOIA 3ZVMA 1T9GR 2HC9A 2EP5A 1FSPA 2X7HA 1PHRA 1X38A 1Y80A 421PA 7REQB 2B6HA 3BTOA 1KI1A 1K8YB 4QTYA 4H16A 2JFZA 1K8QA 3DBOB 3DEZA 3H6KA 1XWIA 5LQJA 1ZGCA 2ZIXA 5A9RA 3IH5A 2D6FA 1Y42X 1NXSA 1YCHA 2JIOA 3K8OE 2D1QA 5IG2A 2WHRA 3RGWS 1FTQA 3VHLB 3PUJA 2J0UB 3K0HA 4QNRA 3D6HA 5AHKA 5AKEA 3LDAA 2YIVX 2XNSA 4D98A 4OK6A 2XKKA 3UMJA 3TFOA 4ZC1A 1RLUA 3QPDA 4IDDA 4N0DA 1LLQA 1R12A 3KT3A 3VKVA 4ALLA 1MUUA 3NUZA 3DVQX 4NH4A 2ZJ0A 3IEUA 5DYTA 2HK6A 4GZLA 1CS0A 5AKIA 3TRDA 2ATEA 1BQ3A 3HH8A 4UFOA 4CKEB 4E5PA 3K0FB 1G9SA 2BRUC 1WX1A 1PLLA 2C03A 1WB6A 2PSHA 2ZBGA 4AMVA 4FQ8A 4Y67A 4QODA 2GCOB 3QNUA 3SZ3A 3ZEAA 3FB4A 2OBFA 3WGMA 2O7SA 3GU3A 3VV3A 2HA4A 4LOIA 3RM3A 1IVNA 2Y3IA 3QI7A 4BYMA 5EJ8A 4WZAE 1D03A 5BUZA 4PO8A 3HR4A 1GGVA 2WHQA 1U8TA 2QRVA 4C0KA 9GPBA 2DERA 3KJQA 5JTUA 3PCTA 4IXDA 3LRTA 5D5QA 3UT5A 4G1VA 2DYKA 1NI4B 4BMPB 5JH7A 4W1QA 5CVUA 1DOHA 1KIAA 3OT4A 1SHKA 4RM2A 5FPYA 2A14A 5IT5A 3MILA 3NBQA 1MENA 2O8EB 2FDRA 5ED4A 4KHZA 1KGSA 5HIIA 4HJRA 1M1YA 1XTRA 4LJ8A 4RZXA 4OQXA 4RVFA 3MWEA 3V7YA 1QYCA 4F72A 4LF9B 1Y8ZA 4R54A 4ZVQA 3LUGA 3WGZA 4WOKA 5BWMA 1LV7A 1S4QA 5CK4A 3MCZA 2KW5A 2IYSA 3WMWA 1YOVA 4ALKA 3D4LA 1YACA 3K0BA 1KYYA 4LYYA 4C7JA 4EG1A 2APJA 4BB6A 3N0WA 3OMXA 1JPVA 5HTKA 1VM6A 3CYFA 4P3YA 4PXSA 1YUNA 3UJBA 5I7HA 5E2AA 1XIVA 4PXAA 4QYTA 3KQLA 1FNSA 2PL1A 1VKOA 1MVOA 1DWUA 3ZDBA 4JT4A 1YB6A 2PBFA 1QIDA 3PPIA 4P53A 4TKUB 5AM2A 2B8TA 1EG7A 4DSNA 5L4NA 1H8ED 1GUZA 1PDOA 2FR1A 3NHYA 4XE5A 4PNEA 3C41J 4UU8A 3Q7PA 1CUZA 1R0LA 4OQQA 5AXDA 5IX8A 1TCBA 2IP1A 3U19A 2OBBA 4FYHA 4RVHA 3FOCA 2CLKB 3COSA 5LA6A 3CX8A 3PUYA 4IHKA 4I5IA 3AP3A 4M22A 5ADVA 2WG1A 3W6ZA 1T3LA 3FJYA 4YJ3B 4CQJA 3BJRA 1X7WA 4M37A 3KCNA 5ALSA 3Q9UA 4EHKA 5L6LB 4X44A 1OWPA 1P81A 5L3RA 2J3HA 1SA0A 2RG1A 2HSJA 2ZKIA 3ZHVA 1XQYA 3N53A 3RJ5A 3I1JA 1GQ2A 3HYLA 5FB3A 1F0KA 1EHIA 3H0KA 1RQPA 5AO9A 3OM8A 5BSHA 1KP2A 2C97A 2L0XA 4FOPA 4M9SA 4QECA 1GRRA 5AKHA 5LQDA 2P2ZA 4RGQA 4G4SP 4G0MA 4L8VA 2IW1A 5JARA 4RTQA 2NZVG 3UHOA 3VC2A 1XKQA 1T9AA 1ZD8A 4G65A 1VJ1A 2EP7A 3F2IA 3HN7A 3MJHA 5HJEA 2V4UA 1J99A 2VLIA 2ZULA 2KMLA 1EB8A 3W9BA 4KXLA 3MCVA 2BEWA 2ZIAA 5LZ5A 4C76A 1OX4A 3LOUA 4LC1A 1U0FA 2RHBA 2NZJA 2A0XA 2O2CA 2CL0X 2ZRIA 4UUOA 5HUQA 5AHWA 3AVUA 1PVOA 4IDPA 4X20B 3HJHA 3U61B 2ODEA 4F93B 4JBXA 2W6IA 4YV2A 1OZFA 3VR5D 2Q5JA 1WD5A 3EWSA 3OTWA 4GLFA 3E0XA 3BJZA 2A2ZA 3WDLA 3VH1A 2V7BA 3GUVA 1SKAA 4WDRA 3B9RA 3RJ9A 3S7ZA 4AZ0B 3TR6A 4CM6A 4UFPA 4NTZA 4JYCA 2NTEA 3L7MA 2KI5A 2Q49A 3B3AA 1CR4A 2H07A 1TXGA 5LP6C 4BMXA 1F12A 1AHPA 3MT8A 4GZ5A 1TQDA 4B3JA 2WWYA 3AIOA 5T8KC 3WV5A 2WVJA 5EP2A 1H3NA 1X8KA 3CH4B 5FBHA 4R9RA 3I01M 3L3BA 4F1JA 4LV6A 1A7UA 3FPKA 2D7CA 1D3AA 3N0RA 1BAPA 1PK8A 3FWHA 1T2UA 2IZ6A 4RFVA 1XQXA 1ZISA 3CNBA 4MX8A 5F2EA 3TLGA 1HTTA 2CXNA 4EF5A 1YZQA 5CB4F 3AUKA 2ADOA 4F3CA 1SOAA 4PE5B 1W581 4E5KA 4NS1A 1DT3A 1BW9A 3MSXA 4NZ9A 3LS2A 5IULC 1O87A 3E81A 1XUOA 2PSSA 1E6WA 1M83A 4S1VA 1QIKA 3ITDA 1U7XA 2RBEA 4WXHA 5IH3A 2FMUA 3NI2A 4KEAA 3O8QB 4LDAA 3R9WA 1E58A 1WSWA 3P4UA 4G5FA 4L0DA 5L45A 2Q9CA 4FJ1A 1JUDA 1DC5A 2C77A 2WJAA 4IW3B 4QRIA 1RABA 4MLZA 4RLQA 1E4EA 1QH1A 1P5ZB 1TI7A 3AR6A 3E3AA 3LVQE 3L7CA 3OQ1A 4LWPA 4M1OA 4DLAA 4XVHA 4ZZ0A 1I2DA 2DG2A 1PR1A 1KMHB 1WJGA 2HWXA 1KYXA 5KSYA 3IUPA 1T8PA 2K6GA 4TMWA 4O4LF 4JMPA 2C7VA 3YASA 2V3WA 3A6EA 5C1BA 3A05A 5AXBA 3QUTA 1KKUA 4YUAA 4DDKA 1X19A 5C3UA 3D1LA 1W73A 1OSNA 2IZ1A 2YY5A 4P4NA 4RL4A 3W34A 4G2TA 3RS3A 1ADYA 1O6BA 1PTJA 1RFGE 2QTFA 2WSIA 2ZCVA 2VZ8A 4ZVVA 3RCBA 4BVFA 1ZD1A 1C3JA 3FHLA 5IJ9B 1V6CA 1NMXA 5A4DA 4L5IA 2Q5QA 1E9SA 1OXXK 4J7UA 2P9QA 2H1RA 1AK2A 4EG8A 1EX7A 4UATA 1WZ2A 2JS7A 4MCJA 2B30A 1ZS9A 3LHDA 2GKGA 2VTEA 2ZSKA 3UYLA 3PU6A 4KX5A 2ZZNA 1HYBA 3VA7A 3WGKA 3LXMA 4PCLA 1OXUA 1GT6A 5CIQA 3D2BA 4U7FA 2HXGA 1EFHA 4YBZA 1GSIA 1OFGA 4ETIA 3IULA 1JR3E 4PSCA 1OD6A 4QASA 1KJWA 2IU0A 2R6R1 1JALA 3GQBA 1H93A 1ZW1A 2L17A 3NONA 5EJAA 4UVDA 1DKRA 2M1XA 4CCYA 1L6IA 4EMTA 3KYDA 1ZW6A 3AESB 2CHFA 3RROA 2B0JA 2LDXA 2MHCA 2ZTSA 2EBFX 2KE5A 4LF4B 1DOAA 4HN9A 1Z82A 4QEZA 1H8HA 1MORA 2ESRA 1NL3A 1T4CA 1ZNWA 4GQBA 3DT9A 1HLPA 3FLBA 4MYCA 3OHPA 5IK2A 3A1WA 4KV9A 2YVLA 1XDWA 3EEYA 2F64A 4LMRA 5DHFA 3ZGVA 1XELA 4V0LA 1VIYA 1GXSB 3GYGA 2PN1A 2NLOA 2WY2D 3CLUC 3IJRA 1NHWA 2YRWA 5B4VA 2VRBA 1XPOA 4P33A 4PWZA 2P5YA 1YR1A 3B1YA 3CLHA 3ZJYA 3QKIA 5K0GA 4M4SA 4MQLA 3OZTA 1AB6A 1F6WA 1T1IA 3OU6A 4JWTA 3RBVA 1TEXA 2BMWA 2W6PA 3TI7A 3WBJA 3AXSA 3K72B 4G0OA 1WR8A 3NWJA 4CODB 3JQEA 3ETNA 5ALHA 1A9YA 4N82A 4MXDA 2TECE 2X0RA 4OU5A 4ZMBA 1A69A 5JBNA 1FP4B 1LI5A 3TECE 1GTL1 1LTQA 1DFGA 3QYFA 3H4TA 4P82A 3GZ4A 4I1OA