3WSWA

Crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-bound form
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
316
structure length
316
Chain Sequence
KTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGEALDLLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb
source organism Enterococcus mundtii
total genus 105
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wswA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3wswA02
3S1LA 3A06A 4ND5A 3ZGYA 4OJNA 4GI2A 4Q3BA 4IQ0A 1FJHA 4AJLA 1FF9A 4FN4A 5TIIA 1HSOA 2QQ5A 5I9MA 1HWYA 1EUDA 4Q3EA 4OQZA 4K9DA 5JYEA 3F46A 1O95A 2VCYA 2VYVD 1F12A 4BNIA 3U49A 1X15A 4E13A 1QV7A 2ZK7A 4RQTA 4YVFA 3FPLA 3I9KA 3EK2A 3H3FA 1MX3A 4EUFA 4ITUA 3DQPA 1UJMA 2Z1NA 2X5JO 1NX6A 4CUZA 4NK4A 5F1KA 4LVCA 1BHSA 4Q9NA 5A9SA 3HFGA 3I4CA 5FI3A 4FOOA 5DOZA 4TKLA 1I32A 3KM0A 5JAQA 3B20A 4L0QA 7ADHA 1DRUA 1Y7TA 4IJKA 4P4NA 2O3QA 2NU8A 3TPCA 2Q46A 1J49A 1NYTA 4LCEA 4BO6A 5CFZA 4YACA 4BOYA 1C3VA 1KVTA 1MG0A 1QORA 4B8WA 1N7GA 3WGQA 1L7DA 1I36A 1PEDA 3RASA 1OOEA 4A03A 2RHCA 1B8UA 1LC0A 3PXXA 4S3MA 1PQWA 5HBRA 4LW8A 1ADGA 4RVGA 3UKOA 2GRAA 4PVDA 1W8DA 4HBGA 4PG5A 1NFRA 3QY9A 3ANMA 3WGZA 3IP1A 2X22A 3BZUA 4XZ3A 3D5TA 5AQ1A 4YJFB 1OC4A 5JSFA 1WW8A 3TQHA 1HZZA 2AHRA 1KBZA 3DBRB 1C0IA 4BB6A 1X7GA 1SOWA 1E7MA 3R3SA 4IDBA 2FP4A 3KSZO 5BNIA 3G79A 2X1HA 2WTBA 4TRNA 1Y81A 1DDOA 1L1FA 2VHXA 3WQQA 4BS9A 1IHXA 1UDCA 4L76A 4KOAA 4YAGA 4HKTA 4OOFA 4WEQA 1PWXA 2JFFA 4J0EA 2BF7A 4HXYA 4LK3A 2D4AA 4J1NA 2C5AA 3MJCA 1UUFA 3GY0A 2YZ7A 3OHSX 3PJEA 1SAYA 1U3UA 3AI3A 1VJ0A 4RVFA 1E3LA 3F6YA 4TQGA 3MEQA 4DQXA 5IDXA 5B1YA 5ICSA 3NJ4A 3KOUA 3WYCA 2DT5A 4NR0A 1R0KA 2A9FA 1R16A 2NWQA 2AQKA 3LF1A 1I3KA 1P77A 4QT0A 4XWYA 3C1OA 4QO7A 5F3RA 1PGOA 3DBRA 5ITWA 3JCZA 3F47A 4NHEA 5EIOA 4JLWA 3IJRA 5TT0A 4HFNA 1GQYA 3GVXA 2E82A 5DOVA 3L4BC 4PG7A 2P91A 2W90A 3RUIA 3QVWA 5JCJD 4AJ1A 3AFMA 4EEZA 3CEAA 4WOKA 2HO5A 2JD0A 2FRDA 5JE8A 1NHGA 2B37A 5G0TA 4PVCA 2DTXA 2OMEA 3OMLA 5IZ4A 2GF2A 2EKPA 4XQCA 5JBIA 4Z0TA 1ENOA 1UAGA 3GG2A 3RSHA 1E5LA 3UF0A 4XB2A 3DFUA 5TT1A 3RKRA 3FNFA 3H9UA 4CV1A 3OJLA 4JN6B 1H6AA 1Q0HA 1E7SA 4DYDA 2IZZA 4JBIA 4QXMA 1P0FA 4I5GA 3KSUA 4MVJD 4ZHSA 3JQGA 3JD0A 6LDHA 1UP7A 4E4YA 3QW2A 1IZ9A 5JAIA 4XYMA 3SLGA 3KEOA 3V2GA 4FPXA 1EBFA 4KWHA 4YAJA 4D41A 1YDEA 3QV1A 1TB4A 2I3GA 5AXCA 1SPXA 1I2ZA 4XDYA 5L51A 4R9RA 1J5PA 3WGGA 1IB6A 2GZ1A 1XA0A 4MP3A 3ZHXA 3A9WA 2C07A 1KEUA 4IMRA 4UUNA 4PZCA 3DZHA 3E48A 3I52A 1UXGA 1H9BA 1TEHA 3TSCA 4BKPA 4U6QA 2WDZA 2BELA 1E7YA 4TSKA 1QYDA 2HQ1A 4BNMA 3DMYA 2CDCA 3AOEA 3TFQA 4BO7A 1YQGA 3BAZA 2P2SA 1LLDA 2PKRA 4FQ8A 4Z3KA 2NSDA 3W1VA 1HKUA 3JQ7B 1XQ1A 1VPDA 4IDDA 1DIHA 2HK8A 3OETA 2RIRA 1PU2A 1PZFA 4IXWA 3UUWA 1Y8RA 1YDWA 3V2UA 4L9RA 4AJHA 4D43A 2I65A 3H5RA 3ZWOA 5JY1A 2PZLA 4UREA 4W7IA 5JAMA 4J2OA 4ALLA 2VT3A 1SEPA 3AWDA 4R3NA 2IDZA 1MGOA 2D5AA 3JQEA 3OBBA 3OEYA 1ADCA 3QQPA 4BO0A 1XKQA 1ONPA 4R41A 1WPQA 1MG5A 2YJZA 4KWIA 3KV3O 2AE1A 5KJEA 3GVHA 4Y9DA 5I7VA 2DAPA 4R5MA 1A4UA 3GF4A 1WAMA 2XOXA 3JQ7A 3LDHA 3O8QB 4FR5A 2CUKA 3RUCA 2O50A 3C7CB 5LDHA 1DC6A 1ISFA 3UN1A 4JROA 3WS7A 1EVYA 3L9XA 4FJ0A 1E3JA 2CVZA 2EKQA 5K0ZA 2I66A 3D1LA 1E0DA 3S2GA 3PVZA 5GZ1A 2IEBA 2WMDA 3AUAA 3IUSA 8LDHA 4KTVE 4BL5A 3RCBA 2DFVA 2JFHA 4W9NA 1IPFA 3NV9A 3K2EA 5H82A 3F1KA 1MC5A 4CLOA 1MLDA 4BMSA 3JQ9C 1JAYA 3CUKA 4Z9XA 3AY7A 1K2WA 3MZ0A 4BNJA 1P33A 1XR3A 2FR8A 1UP6A 3STHA 1LDMA 3LT1A 1HDOA 2FWMX 1H9AA 3MJTA 3H7AA 1T1RA 1KEWA 3O8QA 4YXFA 1NTOA 3CE6A 1RM5A 1X13A 4XCVA 4A73A 1BWSA 1FDSA 1PJCA 3EMKA 1F0YA 3KVOA 3L07A 3TNLA 1GZ4A 3FR8A 5AXDA 4UULA 4IDCA 4CLRB 1NWCA 1N1GA 3ORFA 3V1UA 3VTFA 1M66A 4BGIA 4CQMB 2OBNA 4TMFA 4XJTA 2NVWA 3QJ5A 4AJNA 1GUFA 2H5LA 4FFNA 3OIGA 3SC6A 1A71A 2ZB7A 3B1KA 3LC1O 4GAEA 2EXXA 1DBVO 4GKBA 5JPIA 4BMVA 2PA3A 4KUHA 3FRJA 3GZNB 4KP7A 2NVUB 2P68A 4OXNA 1GDHA 3RIHA 3W8EA 3KUXA 4OOEA 2CZCA 4Y98A 2IZ1A 4DMMA 1ZW1A 2B35A 2Q50A 3GHYA 4I8XA 4QFCA 3I6IA 5KVVA 1BG6A 3U62A 3PK0A 1XQ6A 1U1IA 4B7CA 1ARZA 3BTSA 2O48X 2ZTVA 1GY8A 1RKXA 2FPGA 4BNFA 4CLRA 1K5HA 2CNBA 3A4VA 4R5HA 4CQMA 3FNEA 4NBVA 3TJRA 1B8VA 1F17A 3C24A 1DIRA 2C7VA 3FR7A 3QWFA 3GNSA 4F3YA 3RU7A 2H9IA 2VUSA 3GZNA 5IAAA 1XIVA 2NVUA 2DU8A 5H81A 2QG4A 5JC8A 4ND1A 3I1JA 5A05A 2PY6A 3JD2A 1VL8A 4YQZA 5I9NA 3Q9UA 1MP0A 2RCYA 3PFWO 3MWDB 3EHEA 1NFFA 4XYGA 1F14A 3KXDA 5KJFA 1ISJA 2UUOA 2A94A 4CM7A 5L4LA 2YV3A 3UFXA 5U9CA 2AQIA 1CIVA 1B8PA 1PL8A 4I5EA 2PKQP 2P9CA 4AJOA 3MWEB 1AHIA 5HS6A 5BSEA 2A35A 3AOGA 4S1VA 1XHLA 2BGKA 4CQLB 2BI8A 4B4UA 1LDEA 2VYNA 5AVOA 1PJ3A 3GGPA 4TVBA 3JSAA 3EUWA 1UP4A 1V3VA 4TZKA 1GAEO 2Q45A 2EKLA 3VH2A 2UYYA 3LLVA 2BGLA 4DBVO 5G0SA 4DBZA 1DPGA 4FBGA 4BIIA 5K6AC 1RM4A 3GGOA 1GU7A 4LMPA 1E77A 3JQDA 3V1TC 4LGVA 2R2GA 4XJSA 1E7WA 1TT5B 2PD6A 1ZBQA 3HE3A 1ZJYA 2ZQZA 2J3IA 1GZ6A 2VUUA 2VNAA 3UAGA 4BUCA 4GSKA 4E30A 1I33A 5B37A 5FWNA 3GA0A 2G82A 3L4SO 1ZEJA 1OI7A 4CL8A 3BHIA 4TROA 3A1NA 5CP8A 4IJVA 5CEJA 1KS9A 3JD4A 4MVJI 4R51A 1IPEA 5TJ9A 3I9MA 2OOSA 1NPDA 1R4NB 4KQXA 2NV6A 3INGA 1ZK2A 4UVGA 2CMDA 3WICA 4CPDA 2CVQA 3Q3CA 4F46A 1YBAA 5CG1A 1L7EA 4BO1A 5BQFA 2Q49A 3D3EA 4MVJP 4BO5A 4J1SA 4XQ9A 3GN2A 3I23A 4B4OA 2PZJA 2HKIA 1BDBA 4BNLA 1HYGA 1LNQA 2VTDA 3KYDA 4YWJA 3ZWMA 3NDIA 1EMDA 3L4BA 2VYVA 3W4KA 1LI4A 2JD1A 4BB5A 3JQ6A 1JKFA 5TQVA 3UICA 1OC2A 3DBLA 3PIDA 4E12A 5GZ3A 2I67A 4FS3A 2DUUA 3H5AA 4E21A 4Q3CA 1R4NA 1FMCA 3ZV5A 3H9QA 2Y1OA 3IAHA 1EEHA 1X14A 3C7AA 3LT0A 4NBRA 2EV9A 1YRLA 1K89A 1J6UA 1PX0A 2NM0A 1HDGO 4XGNA 2AEMA 2HSDA 4Y67A 5T64A 1B14A 5I7FA 3NKLA 4IGEA 3G1TA 2WJPA 4Q3DA 3HB4X 5DULA 1ISHA 1QYCA 4PG4A 3VZSA 5CG2A 5JMWA 3GC6A 5JDIC 4OQYA 3COSA 4BKRA 4XR9A 2I99A 1BTOA 1DHRA 4WK6A 1PS8A 3WBFA 2FSVA 3RC9A 3H5NA 2OBYA 3L6DA 4H15A 5EJ2A 5DF1A 2BRUA 1ZK1A 2PH5A 3DDNA 1PL6A 3GR6A 4Z6KA 1KEVA 4WGGA 3IKTA 1PJ2A 1YB5A 4IQGA 2SCUA 3TL3A 3TWOA 4WLFA 3NTQA 1QV6A 3LC7O 3OIDA 3PQFA 1N8KA 1JN0A 1P9LA 1RYDA 1S6YA 5ENDA 3GVPA 3P2OA 4UVEA 1I24A 4GBJA 2VRBA 1R4MA 2POQX 3DB2A 1YE3A 3DTTA 3L6EA 4FFMA 1WNTA 4LMRA 5GY7A 4AG3A 2ZTUA 4ZQHA 1HT0A 4EYEA 3OSUA 4RORA 3HZZA 4LVUA 1T2AA 2I6TA 5GMOA 4CLHA 4EBFA 2X9GA 2J3JA 2Y1CA 3GRKA 3DAGA 3BTVA 1UDAA 3EVNA 4OGWA 4KZPA 2A4KA 4Q3NA 4D3FA 2TMDA 1MFPA 3GZ4A 3BHJA 3BHMA 3RFXA 2BFMA 5G0VA 3UGKA 3KEQA 4PLHA 1JLLA 2YFHA 2Y99A 4NNJA 4CV2A 3I83A 5KKCA 4DA9A 2V6MA 4O59O 3GNTA 3ADOA 1IOLA 2Y0EA 2D1YA 4RF5A 5AYVA 4NFHA 3NYWA 4R1NA 3W6ZA 3C7DB 2CD9A 3NRCA 2O23A 4RDIA 4W99A 3JQAD 1SNYA 2Q4EA 4YB8A 3JQ8B 4EW6A 2JKVA 5T67A 4NJMB 1DRWA 2AQ8A 2FN7A 1ZIDA 4OYRA 3GFBA 3GRPA 1B7GO 3VPSA 4L4XA 4KTTE 4I9UA 1PJTA 2ZATA 1PR9A 3U3XA 1WVGA 3ZN2A 2O7SA 2QIOA 3ZV3A 4YAEA 4BNHA 3CMMA 2BKAA 1KVQA 3DHEA 5L7WA 2AG5A 2JD2A 3AK4A 3G3EA 4KUGA 2W4QA 4OSOA 3ZU5A 2YW9A 4B4VA 2Y05A 3Q1LA 1Y1PA 1PZGA 5A4DA 2ZJ1A 4Y6RA 1OAAA 4NZ9A 8ADHA 3AU9A 3IC5A 3Q6IA 2Y0DA 3JQ9A 4FFRA 4WASA 4BO2A 2DTDA 4YT8A 1C0LA 5EINA 1U3VA 3WTCA 5DT9A 4M86A 3IIEA 1IE3A 2FZWA 1NR1A 3S8MA 3TZCA 4GMGA 3KETA 2W2LD 3JQ8A 4CMAA 4NJMA 1PJQA 1YB1A 3D3WA 5F5LA 1K3TA 1FK8A 3FTNA 1HDRA 4G5HA 4NG5A 2C5EA 3M2PA 3WDSA 2DVMA 3FPCA 3WIEA 2A92A 3Q0EA 3VHRA 4BGUA 3FHLA 4J43A 1GD1O 1AXGA 3GMDA 4BNXA 1E3EA 3L9WA 3PHJA 2UAGA 4M49A 4CM9A 3IOYA 3NDRA 2EP5A 1DHTA 1K6XA 1QXSA 2XXJA 3OEWA 4J1QA 2DM6A 3FWZA 1P1JA 2RHRA 1MA0A 2GN6A 4TWRA 1WP4A 4TKMA 1D8AA 2ZQYA 3TZ6A 3PYLA 4Y8VA 1BMDA 2NTJA 1PGQA 2VWGA 1YBVA 3AY6A 3ZH2A 1SEVA 2XPCA 5MDHA 3IS3A 4Z9YA 5ILGA 2PLAA 2FMUA 3PHIA 5KKAA 1CERA 1KEPA 3EVTA 1LRJA 5TJHA 1EVZA 3BTUA 1ZCJA 3UOGA 3WYEA 2O3UA 2O3JA 4RQUA 1SB9A 4ND2A 4D0RA 3OA0A 1AUPA 3OJOA 5JO0A 3ZWCA 1U9JA 1Z73A 2ZJ0A 3D0OA 3ZDFA 1JTVA 2WSBA 1KY4A 4JNKA 3RC2A 1B3BA 4AJEA 1ZK0A 3NX4A 3RROA 4DRYA 3ITDA 4J0FA 2EF1A 1EBUA 1NNUA 1ONOA 1GTMA 2X86A 4R01A 2EWMA 4J9UE 4HWKA 2ZYDA 2JFGA 3TOZA 2VHZA 1AE1A 2BH9A 5I8ZA 3K5PA 2GD1O 4B7UA 1HXHA 5AXAA 1W73A 4MKZA 4NBUA 1PQUA 4CR7A 1Y6JA 2DBZA 1U3WA 3DZJA 4CMHA 1BVUA 2IEDA 4Z0HO 5CEEA 1LXCA 3CINA 3ICCA 3RWBA 2RH4A 3ONEA 3OP4A 4E0BA 4LCJA 3WWYA 4BNWA 2WEKA 1D1SA 1JAXA 2PNFA 4EUEA 2WYWA 4RPGA 5DCUA 1Q1NA 2DUWA 3PJDA 4IGFA 1O8CA 2X4GA 1A9ZA 3DAPA 5IFLA 1NFQA 5DP1A 1DIGA 5F1OA 4MVJM 3ENKA 2GERA 5TRTA 4DIBA 5K6AA 1F06A 4FC7A 2C7GA 2D2IA 3QVTA 4M54A 4NFYA 2ZYAA 3WFJA 1EE9A 2VTEA 4AL4A 3PI7A 4CM5A 1P1IA 4RF3A 4J3FA 1ZNQO 5CDUA 3SEFA 1I5RA 2CF5A 3A14A 4XGIA 2WYVA 4BGEA 2EW2A 2J3KA 2YQ4A 4JIGA 4PG6A 3JQGB 4QQRA 3H6KA 4PIVA 3VH4A 1DB3A 2PGLA 3SJ7A 2I76A 2ZTMA 1VSUA 2P9GA 2HJSA 4CMJA 4TZTA 5CDYA 1IL0A 1CWUA 2B69A 5TS3A 1LSSA 3T4XA 4G81A 4KDFA 3NEPX 3RBXA 4OSPA 2V6BA 3P19A 3MTJA 1Y8QB 4NJOA 4E5NA 2EJVA 1DOHA 2P9EA 2GLXA 4TRRA 4GX1A 1LSOA 5B4UA 3T7CA 4RPJA 1NPTO 3ICPA 4BNKA 1Y9EA 4PLTA 5L45A 1LJ8A 5L4NA 4MOWA 1IYZA 5G4KA 1ISGA 3L0DA 4J4HA 4QX6A 4NU6A 3U4CA 4R68A 1VC2A 2AXQA 2YQ5A 3KSDO 5EQDA 4EJ0A 2FR0A 3VOSA 1K0UA 2I3AA 4UVDA 5LDGA 4IINA 4D79A 1Y8RB 3RKUA 4DWVA 3H8VA 4BNYA 4BVAA 4E2XA 4E2YA 4GPD1 3WNVA 1B3RA 4G65A 2ILTA 2HMWA 1YGYA 2JAPA 1E3IA 1DAOA 3I5MA 4MINA 1OMOA 1Z7EA 4ID9A 3HSKA 3WBBA 1Y8QA 4NI5A 4CJXA 1TI7A 1QYVA 1U3TA 4M8SA 1H6CA 2J3HA 1DJQA 3DAFA 4GGPA 4DPLA 1ZKMA 5DNAA 1H2BA 2EJWA 1RM3A 1M2WA 1CYDA 4D0SA 4R69A 4XQGA 3SX2A 2GCGA 3WOHA 2Q2QA 3QLJA 1EK5A 3W6UA 4CR8A 2QYTA 1LA2A 3PYXA 4CUKA 2PWZA 5ILOA 1H6DA 3U9LA 1Z45A 3OH8A 5JDIA 5BSFA 3ITKA 2YV2A 4MJLA 4EUHA 1W6UA 4II2A 3TOXA 4FB5A 3ZWXA 4YJDA 3G0OA 3PYMA 3TDKA 5DDIP 4YYZA 2EG9A 1UXKA 2X7HA 5G4LA 3RJ5A 4DGSA 2O3SA 2FPPA 1BXZA 3QHAA 5U4QA 4DL9A 1V3TA 5FEUA 3K6JA 2VWQA 4B3IA 3JYPA 4ONEA 4JP3A 4CLOB 3WMWA 1E7RA 4A10A 4LRSB 1PS9A 2NTNA 3K9QO 3F5QA 2FR1A 4GVXA 1V3UA 3N58A 2ET6A 5BSGA 4YBZA 4ALIA 2CDBA 1NHWA 4KMSA 1ZMOA 4RCVA 5EERA 1O5IA 2V65A 1GYQA 3EGOA 4IDEA 5THQA 5ADHA 1NM5A 4MVJE 2G17A 3WX0A 4MO2A 3RC1A 4HNGA 4EZBA 1E7QA 3FNGA 3TZHA 5JS6A 1E3WB 1D7OA 3KLPX 4WLEA 4DQVA 1U2DA 1HDCA 3C1AA 1B16A 3OJ0A 4UVIA 1DRVA 4PRKA 1QG6A 4YA6A 3PDJA 1U7TA 4TVOA 3LK7A 3V1YA 4JBGA 5CDSA 1T2DA 4F45A 4RVSA 1JU9A 1JVBA 4PN3A 2D59A 4I08A 4BMNA 2HRZA 3DHYA 3NJ8A 4KUEA 1KC3A 2X5KO 1XGKA 4W6ZA 2PD3A 1F8GA 4FGWA 3PQEA 4E6PA 2HK7A 3IL2A 3AUTA 5KTKA 3WSVA 2PR2A 3BMCA 5KWEA 1JWBB 4OIMA 1B26A 2G5CA 5JLAA 4CM4B 4PZEA 2GYYA 1HEUA 1AGNA 2VRCD 4JJGA 5CHEA 1B15A 2VOEA 3E6AA 5C37A 4I9NA 2VHYA 3DMTC 1LQUA 3VDQA 1D1TA 2DLDA 2Q99A 4WCFC 1E3WA 1QLHA 5A9TA 3F4BA 2Y68A 2AE2A 2GN9A 3QSGA 3U5TA 4EEXA 1HLDA 4DMLA 5CPBA 3K2BA 3ETGA 3ROQA 4GH5A 4CODB 3NT4A 4D3SA 2CY0A 3OIFA 3JQFC 3IMFA 3AUSA 4YJGB 3FN4A 3QE3A 1QRRA 4YTEA 4URFA 2X5OA 4NMHA 3PHLA 3SVTA 3DOOA 1P1KA 3WIDA 3VKVA 1LDYA 1SOVA 1YQXA 1GUYA 3VH3A 3HNPA 1M75A 4GSLA 3DBVO 3NUGA 1X0VA 4OXKA 1NQAO 2BD0A 4CM4A 1XU9A 3U4HA 5KIAA 2V6FA 1TLTA 2EGHA 3GGGA 4HNHA 3DC2A 4WPGA 4FFLA 2LDXA 4CR6A 4PLFA 4N5MA 2AEJA 1GEGA 1HDZA 4BQRA 1Y9AA 3HDHA 2Q1WA 5A06A 3FF4A 3S2EA 1V9LA 4ZJUA 2OGUA 1H5QA 5IDQA 3PLRA 5L7TA 4ZRNA 1C1XB 4N18A 3GOHA 2Z1MA 3O9ZA 5JMPA 3DO5A 1G0NA 4R1TA 4YJGA 1I3MA 1DEHA 2R6JA 4RZIA 4PLVA 2E49A 3EYWA 3FWNA 2F1KA 1QP8A 3LU1A 4HP8A 2HCTA 1YJQA 2NU9A 4FFOA 2B5VA 3RC7A 4XRGA 2XXBA 3U4IA 2NQ8A 4IJWA 3TL2A 4DQUA 2E6UX 5ER6A 1O6ZA 3S2IA 3VPXA 4AJ2A 2YDYA 1HYEA 2Y1GA 3ZNPA 4E3ZA 4LRTB 4RJTA 1X1TA 4P4LA 1WXDA 4DC0A 1LLQA 1LDNA 3B1JA 2GUGA 1GL3A 4J4BA 2B83A 5H83A 4K6FA 3C8MA 4GQAA 3NTOA 4I5DA 1GZ3A 1I3LA 1P1FA 2OXIA 3UVEA 1K6JA 2C20A 2E37A 1C1XA 5C7IO 4HY3A 2Y66A 1LQTA 3H2ZA 3P7MA 3O26A 4XKJA 3X2FA 1SO8A 3RQSA 3OICA 3BXXA 5ES3A 5C7LO 1DFIA 1SZJG 3LLSA 3MOGA 4IZHA 3HUDA 3KB6A 4YRAA 3HJAA 1H94A 1QR6A 4IIUA 3JQAA 3I9NA 3MTGA 4WLOA 1WLYA 4MIOA 3ZU4A 4CMBA 5JNLA 1PZEA 3MJ4A 3ZHBA 1AXEA 5BT9A 5CAEA 4Q39A 3HB5X 1T1SA 4YCAA 1UZMA 4HFJA 1MV8A 1O9BA 2X0NA 3F1LA 3PZBA 6ADHA 2GO1A 3PQDA 3DONA 1PGJA 1HZJA 2Q1TA 1I30A 1ZXBA 1ML3A 1R15A 4BNZA 4R4JA 2AA3A 3KYDB 3RUFA 1H2HA 4E31A 4PG8A 3CTMA 2UVDA 4IMPA 1GR0A 1SC6A 4N5LA 1KERA 4FFPA 5JDCC 3WWZA 3FTPA 1PS0A 1VJ1A 3LYLA 1GUZA 3DBLB 1VSVA 4BGVA 1LRLA 1P31A 3NGLA 5TGDA 2HAEA 4IIVA 2H63A 3S55A 4YDRA 2W2LA 3FSRA 3JV7A 2ZB4A 4NDNE 1CDOA 2P4HX 3ENNA 5G2OA 5TC4A 2P4QA 4XYLA 1ENZA 1TT7A 5JCXA 2DC1A 2UV8A 4A2CA 1I2BA 3AY3A 1IY8A 5IDYA 1WMBA 2HLPA 2YDXA 4JBHA 1ZUD1 3QWIA 5JXWA 3ULKA 2I9PA 2RBEA 1NAHA 2D3TA 3WQSB 4K28A 1GCUA 1HE2A 2HU2A 3AI1A 4RVUA 3GK3A 5COQA 4M87A 4F6CA 1Z75A 4CMEA 1HLPA 3WQRA 2B5WA 2PK3A 3PEFA 4MVJF 1WMAA 1VLLA 3KHUA 1KOLA 3QVSA 5U1PA 3UXYA 5JO9A 3MJEA 1DC4A 2PTGA 2X9NA 1C14A 1M76A 2O2SA 1RM0A 4IS2A 1UXJA 3ZWAA 4E2ZA 1DFHA 2HMTA 3CXRA 4W82A 4IDAA 3RFVA 4WUVA 3WG9A 4D45A 1EDZA 4DIOA 1ZH8A 4U5QA 3WNQA 1Y5MA 4WLVA 1GQQA 4M55A 3PHHA 2VWPA 4NBWA 2JCYA 2HK9A 1FDUA 3R3JA 4QSMA 4XA8A 3E8XA 3I4FA 2F00A 3CMCO 1R4MB 2GZ2A 3VH1A 4DYVA 3E5RA 4F6LA 3D4OA 2X9VA 1GADO 3ZNNA 4ZGWA 4MDHA 4FC6A 4PLCA 5HS4A 3ON5A 2QX7A 3H4VA 1C1DB 3SLKA 3HHPA 2Y1EA 4AVYA 4NIMA 5FI5A 2D8AA 3ZWBA 4CM8B 1G0OA 2QRJA 1QMGA 4PLPA 4NPCA 4XYEA 1KVSA 4D42A 1P1RA 3GVCA 3WLEA 3TFOA 1N1EA 2WE8A 3WGOA 1NQ5A 4ZICA 4ZD6A 4E5PA 1EDOA 1EZ4A 5K9ZA 4PLWA 1BW9A 3ZWWA 5ICMA 1EQUA 1SCUA 5IXSA 2J5RA 4AJJA 1BXKA 4JGBA 3VTZA 2YYYA 3BMOA 4A26A 4EJMA 5F1PA 1T2FA 2H1SA 1YO6A 2QZ9A 3CPSA 4JX8A 4IXTA 4UAGA 5DCYA 5I7SA 2DPHA 1CF2O 4NBTA 4IZIA 3LC2O 1UZLA 3JD1A 3MJVA 1CQJA 5KVSA 1C1DA 4IUYA 4C4OA 5KOIA 1ZK3A 4CQMD 1B0AA 2OHXA 3GNQA 1HYHA 3INTA 1I3NA 1FDTA 1EQ2A 1A72A 1JVSA 1ZK4A 3DEYX 3H9JA 2C59A 3PIIA 4CM8A 4AICA 1A7AA 2HMVA 3GPIA 1ISIA 3WXBA 4EI2A 4QECA 1S7CA 1Q7GA 1YONA 2YY7A 4PZDA 4BHTA 2CF6A 2IXBA 3G1UA 1E1MA 3SJUA 1T2EA 5JCJA 3NDJA 3ONFA 1KYQA 4L75A 4WNIA 4CMKA 4N5NA 1NASA 1KETA 1ORRA 1XELA 1YOVB 1ZSVA 3Q11A 1DIBA 2JHFA 1HF3A 3EAGA 1GCOA 5JC1A 4O0LA 4R16A 4B3JA 3IUPA 1YL7A 1TXGA 2BMAA 5DBIA 5I9LA 4QO8A 3D3WB 1EUZA 5A5EA 3GFGA 3QWBA 3PWKA 1Q0QA 5JYDA 5KVQA 2W98A 3ZV6A 2X58A 2YHUA 3SC4A 4YR9A 1BDMA 1AHHA 3CIFA 3E1KA 4RPLA 1P45A 2VWHA 1A7KA 4PRLA 2VZ0A 3UCEA 2O2YA 4HX5A 4OXYA 4J7CA 2VHVA 3ZW9A 3M2TA 3PLNA 3F5SA 5TF4A 1LC3A 2QRKA 4MVJA 4L8VA 2FSSA 3VZQA 4YJHA 3LT2A 1E1NA 4J49A 1V8BA 1R66A 4P38A 3VKUA 5J23A 4DPKA 2VT2A 2WYUA 2HMSA 3DWFA 4ZVVA 1YOVA 3CSDA 5AXBA 4O6VA 1LSUA 1CETA 4BKOA 3DMTA 5LC1A 2VQ3A 4LSMA 4W7HA 4IJUA 5BNTA 3GMSA 4WCFA 4H7PA 4NU5A 3AM3A 4BV8A 4J6FA 1ZSYA 3TZKA 4BQPA 1M67A 2IODA 3AUUA 1NR7A 3KO8A 5L3ZA 3ZWNA 3JQFA 2GN8A 1V6AA 3HQ4O 1LDBA 1U4SA 3KZVA 1LSJA 3ETEA 2IZ0A 2ZTLA 2FY8A 2AMFA 2NACA 1PJBA 3AW9A 2W8ZA 3QVOA 2VN8A 2B36A 4DIFA 5F21A 3DXFA 1LRKA 2NADA 4M1QA 2X0RA 1V0JA 3KBOA 3PZRA 3ZZNA 1G1AA 1WZEA 4U0KA 3HG7A 3GQVA 1Q7BA 5GZ6A 1PWZA 2O3TA 5EQFA 4ND4A 3WGHA 1A4IA 3EZLA 2FOIA 4YT2A 4YT5A 4RZHA 4OM8A 4PLZA 2J5QA 1JA9A 1GYRA 1EFKA 4CV0A 2X8LA 5IN5A 2B4QA 1NP3A 4CMIA 2PZKA 2QRLA 4D3DA 3OQBA 4X54A 4ROSA 5FF9A 1D3AA 2UUPA 2EW8A 2OO5A 3SBOA 4R1UA 3RD5A 1A9YA 4XGKA 3R0IA 3UCXA 2GASA 3DFZA 5G0UA 4GLLA 3ABIA 3T4EA 4GVLA 2ZIZA 4CLXA 3V5NA 2B4RO 4LN1A 1XG5A 1XEAA 3OF2A 3PFFA 3JQCA 3MOIA 5L4SA 3ZW8A 2AQHA 4U8GA 1R0SA 5FFFA 3JYLA 4RL6A 2UDPA 3GDGA 4TRJA 1OBFO 3QRWA 3RVDA 1E6WA 4BNGA 4YAKA 3ZWVA 2IRWA 4M89A 2Y1FA 2C54A 1LLUA 1YKFA 2J5KA 2VRCA 2P5YA 2HMUA 4WOJA 4ZU3A 3DZIA 5TX7A 4ND3A 3NT2A 1PZHA 4J4TA 3ASUA 3E9MA 3UW3A 1PIWA 1HDXA 3ETDA 3CZRA 4GX5A 1U5CA 3F4LA 1LTHR 5CDGA 4KDEA 3BMNB 1ZZEA 3AFNA 2CSUA 4DUPA 4J91A 3W4IA 4BNTA 2BFAA 1HETA 4GMFA 1JKJA 5L40A 5G4KB 5A04A 4CM6A 1NQTA 3DBHB 1X7HA 3GPDG 1JKIA 1N2SA 2X6TA 5THKA 1DO8A 1HE5A 4Y6PA 2Q2WA 2V7PA 5ER9A 3KTDA 1LLCA 1BVRA 3HDJA 4ZQGA 7MDHA 2Q1SA 5JY6A 1KVRA 4BV9A 3JYQA 4CMEC 4ZQFA 1ZVMA 5KNLA 4RF2A 3LZ6A 2NU6A 4UEJA 5JDCA 3GN1A 4C7JA 1Y5RA 1I01A 4YJFA 4DXHA 4L74A 4CMCA 4E5KA 2Q2VA 1SBYA 3JQBC 4J7UA 4XYBA 3JD3A 3RUAA 1BRMA 3B6ZA 1DC3A 1MXFA 2QZZA 3PP8A 3GLQA 1FDVA 2NNLD 1YBMA 4NK5A 5IJZA 2FZEA 3BMNA 1O0SA 1ZSNA 1YB4A 2YUTA 2AEFA 2CFCA 4PLGA 1Q7CA 4AFNA 2NTVA 4L4RA 2DPGA 2PH3A 1ADFA 1ZEMA 2EEZA 4WJZA 1DLIA 3C3XA 1J0XO 4P8RA 3DBHA 4CV3A 4MKRA 3Q2KA 3Q9NA 4I9HA 4XQEA 1N7HA 4H3VA 3PHGA 1BXGB 1EFLA 3NGXA 1CEQA 5TSDA 1GEEA 2WE7A 5IN4A 2BFOA 5COAA 5A5FA 1UXIA 3FNHA 1TVEA 5I8WA 3B1FA 1QKIA 5EMHA 2JAHA 4XIYA 5HRUA 1HE3A 2C0CA 1U8FO 4UVHA 3E5MA 3U0BA 5HM8A 3WTBA 1NBOA 3ASVA 4B8ZA 5B12A 4JJFA 5C3MA 2FHSA 3OFSA 4J7XA 2C2XA 5IZCC 3H9GA 3GAZA 3DR3A 5A03A 1NVGA 1T26A 4O1MA 1T4DA 3VZRA 1ZO8A 1RYEA 3RI3A 1HSZA 1BXGA 1UXHA 3B70A 2XAAA 1RPNA 1YWGO 1H0KA 1H6BA 2WD8A 5CDTA 2OORA 4RDHA 2PGDA 1U7HA 3RUHA 1U4OA 2D5CA 4RF4A 3VPFA 5A02A 2Y93A 2B0JA 5A9RA 2DFDA 3GH3A 2DTEA 4J2HA 3QA9A 3WJAA 5MGBA 3OQ6A 3PGJA 3ZV4A 5EN4A 4IS3A 3SXPA 3WB9A 3H9EO 3EC7A 4FSHA 1NAIA 1CQIA 2G76A 2R00C 4CM9D 3I3OA 1E92A 2Z5LA 1IUKA 3H3JA 4OHUA 3R1IA 3TN7A 4ALKA 4EITA 5IG2A 4PCVA 3F9IA 3BMCB 3GHHA 4MKXA 1H93A 3QWAA 3ROMA 2EERA 3IJPA 1RWBA 2BHLA 1UH5A 3IKVA 3FCOA 4MVJH 1DFGA 1PJSA 2C82A 4DREA 2OL4A 3VPGA 4UUOA 1PL7A 4ZRMA 3H65A 3HN7A 1EVIA 3INRA 1Q2XA 1Z7BA 1O89A 3G17A 5T8KC 2OZPA 2X0IA 3KRTA 2GR9A 5A3VA 3RUEA 3ADPA 4CLEA 1HRDA 2C29D 5B4VA 3WFIA 5TLSA 2XF8A 2VZ8A 3V2HA 4MPDA 3GDFA 3K92A 1PQPA 3U4DA 4CM3A 3HWRA 2PV7A 2IYPA 1MB4A 1DJNA 4DTIA 5KJ6A 5EPOA 3WJ7A 1ENYA 5HTOA 2IXAA 4AJ4A 4B3HA 4NFSA 1B2LA 1WZIA 1PJ4A 2O4CA 3C1TA 4QTZA 9LDTA 1ONNA 5KJCA 1XDWA 4OAQA 4YEDA 5A3JA 3K30A 4A5OA 4WLUA 1C0PA 1UZNA 2AW5A 3C85A 4I5FA 3RBZA 2DQ4A 3N7UA 1N5DA 3ROPA 3KYCB 3EY4A 4GKVA 2G0TA 3PPIA 2YHIB 4PFJA 1E1KA 2GN4A 4R54A 3WSWA 1PSDA 1MXHA 3D5QA 4MVJG 4ZQEA 3OJFA 3IP3A 3GUCA 3M1AA 3NTRA 4FDAA 4D7AA 3RUDA 4OH1A 4XX0A 4XB1A 3VAZA 2PD4A 1OFGA 2E48A 1VKNA 2HRBA 3DZFA 1I10A 1VL6A 4RVDA 1MFZA 1YS4A 5LCXA 2Y1DA 1ULUA 3KYBA 1GPJA 1YL6A 3PDUA 1QYWA 1M6WA 1O94A 2EP7A 2Q3EA 5F5NA 4H16A 2HJRA 2OUIA 1YXMA 2WM3A 2YV1A 1CJCA 3VVCA 3AM5A 1E6EA 4N54A 1K6IA 1U5AA 3M6IA 1HTBA 3AI2A 1E3SA 3DTYA 3FD8A 3KYCA 4CMGA 4ESOA 2ZB8A 2YHIA 3M1LA 2PKQO 1DIAA 3ZNOA 3I6QA 4L4SA 4ALJA 3BYZA 3K73O 5L7YA 4D44A 1HE4A 2X0JA 4O5OA 4QFDA 2OP0A 3DOCA 3X2EA 3GUYA 3PRJA 3IDSA 1WDKA 1LX6A 5KJ1A 4BO3A 2NLOA 3DZBA 4LSWA 5ITVA 5JAZA 1VJTA 4FW8A 1I2CA 4WKGA 4FJ1A 2J8ZA 3K8ZA 2NVBA 4GLOA 2I5PO 1YJ8A 4U6SA 4C7KA 1HL3A 4E2WA 1NPYA 4JJIA 2V6GA 2NU7A 1NVMB 1WWKA 3QVXA 1MUUA 3R6DA 1PTJA 2HUNA 3I9OA 4GL4A 4RV9A 3ST7A 1MC4A 3RU9A 2BFPA 1OZAA 2IYOA 3O4RA 3JQAB 4U7WA 3PWZA 1CRWG 3VVBA 3WLFA 1DLJA 4BNUA 1XWFA 3EW7A 4XR4A 1X1EA 1JW9B 2G1UA 1JDJA 3K31A 1R12A 4K1LA 1NQOA 2C2YA 3D7LA 4P4GA 3DL2A 4Z3DA 4DLAA 2PGJA 4E32A 2Q4BA 4Q3AA 4HFRA 4A7PA 4EJ6A 3ANLA 4U0JA 1Z74A 2OFPA 5T5QA 4HV4A 1IZ0A 3WGIA 4IPTA 1DAPA 2DBRA 5DN9A 2ZKLA 1M6HA 4XIJA 1Q0LA 1ID1A 4ZA2A 1YL5A 4J16A 4GWKA 5BNFA 3ZNQA 5B4TA 4RVHA 3GG9A 4HUJA 1U28A 1QLJA 3D64A 3S2FA 3JTMA 3WYBA 1R6DA 2VHWA 3RJ9A 4UEOA 1RJWA 5IF3A 3EZYA 3FBGA 1FXSA 4AJPA 5IXYA 2PFGA 2WWRA 4W4TA 3MCVA 1I8TA 4EDFA 1F8FA 4YAIA 4WEOA 4BNNA 2E4AA 2IE0A 3ONDA 4UUPA 4RGBA 1VM6A 4B79A 2JCXA 3AJRA 3K96A 1IHYA 5DBGA 3WGTA 3BIOA 4L73A 1YH3A 2EGGA 4FD3A 4GWGA 1VI2A 4II3A 3OA2A 4RO0A 5JFOA 2VUTA 2QYSA 3GEMA 4JCOA 1FDWA 2DKNA 4CUJA 3V8BA 2EHDA 5A1TA 4JXKA 1GQ2A 3VPHA 4GX2A 3ZU2A 3BMQB 9LDBA 4YRBA 5L95A 4FCCA 1GV1A 2GDZA 4JK3A 2ZYGA 3W8DA 1E1LA 3GVIA 1XCBA 3WR5A 3ANNA 2DBQA 3HFSA 4B7XA 1ADBA 1PR3A 1GPDG 3LQFA 4FJ2A 1X0XA 3IQDB 5DBFA 3ZHYA 1LU9A 2GNAA 3W8FA 2VZ9A 1DXYA 1N9GB 2ZCUA 1Z82A 2JJYA 1R37A 4JP2A 3A28A 3FI9A 3O03A 3EDMA 2TMGA 4CQLA 4AJIA 1XLTA 4D46A 3OECA 4MIEA 4OMUA 5HWSA 3DOJA 4HADA 4OKIA 4IBOA 3LT4A 4LISA 4XRRA 2H6EA 3WGYA 1GYPA 1P0CA 4CLDA 2P5UA 3D4PA 4Z0PA 4ALNA 4YRDA 1IULA 1GFSA 2Z95A 4IM7A 1ULSA 4FOSA 4YT4A 1NVTA 2VOJA 4RLSA 5FYDA 3BMQA 3AU8A 3PWSA 4OKNA 3L6OO 4E33A 3P2YA 5TNXA 4CL3A 3RBVA 5DCWA 5CEFA 1XSEA 3CKYA 1KY5A 4MP8A 1TT5A 2QHXA 3JQBA 1ISMA 4K26A 3ZWYA 4B4WA 3JYNA 3NT5A 1N9GA 1V35A 1PJLA 2NQTA 4P22A 3GAFA 2CDAA 4WLNA 4IQ8A 2WD7B 4KQWA 1E5QA 1T25A 1BW9B 4R9SA 2RAFA 4UEKA 3UHAA 1P1HA 1EVJA 3AM4A 4G2NA 4AJKA 1LBEA 1AN9A 2EIHA 3BMOB 3DZGA 1T24A 4BO4A 3TF5A 4E5YA 3HN2A 4BO8A 3OQ1A 1Z6ZA 2Y0CA 3OM9A 3E18A 2RH8A 5EESA 3I9JA 5DZSA 5C5IA 4MIYA 1GV0A 1HDYA 3DZKA 1XU7A 4A27A 2Y67A 1DSSG 3GEDA 5AOVA 3ZCXA 1U8XX 4I1IA 4BNVA 4DVJA 3AOEC 3D4NA 2BI7A 3TZQA 5ENVA 3HDYA 4QUKA 5IDWA 5BR7A 1JWAB 4CM1A 4WCDA 3BTOA 1XYGA 4J90A 1ZXLA 4J1TA 3GDOA 4INAA 2J6IA 4PLYA 2Q1UA 2WD7A 4O63O 2BGMA 4OL9A 3ZI0A 5IZCA 3TRIA 2JCVA 3P5SA 4ILKA 1A5ZA 4Y6SA 1X7DA 4N7RA 1EK6A 2GPTA 2NUAA 1ZMTA 3MJSA 5HA5A 3VC7A 5L53A 2X23A 3W4JA 3F3SA 1BSVA 2DBVO 1PGPA 3L77A 3UCFA 3VZPA 1KC1A 3RFTA 1NWHA 1N92A 3RAJA 5I7EA 3WMXA 3E9NA 4IDGA 2GSDA 1LUAA 4QEDA 4TRMA 5JW6A 3CH6A 4MP6A 4R3WA 4BO9A 3ZU3A 2OP1A 3HADA 3G49A 1VE9A 1ZJZA 4ALMA 1I0ZA 4J9VA 3ROKA 3PJFA 1PGNA 1P74A 3LSYA 1G6KA 1J4AA 4PGFA 2R00A 4YQYA 3UH1A 3QWHA 4R1SA 2JL1A 1EUCA 4DLBA 3H2SA 3VDRA 2GGSA 3OJEA 4YJHB 3DHNA 3I9LA 4A0SA 4WNCA 2HDHA 2YFQA 1W0CA 2ZCVA 3N74A 2B4TO 1P3DA 1WDMA 5CPFA 1VL0A 2W2KB 4GGOA 4E5MA 4W9NC 1YQDA 1NXQA 3E82A 1A27A 5T6BA 4YPOA 4HFMA 4WCFB 1BGVA 1T4BA 3BA1A 3QIVA 3HDQA 1QSGA 5T8KA 3JYOA 3NAQA 4GX0A 2GZ3A 1QYXA 3PTZA 1KIFA 4WE3A 3ZWPA 4DLLA 2PZMA 3E9QA 2VNSA 2VYND 1UR5A 1SMKA 2AG8A 2FPIA 5BSHA 1C0KA 4XD2A 3PJGA 4NH4A 3LF2A 1UAYA 3GT0A 3O38A 4ZN6A 5KVCA 4Z9FA 1R0LA 1P44A 4DC1A 2D0IA 3T7EA 4RPHA 1SB8A 3ZHZA 1U2GA 4BKQA 1TA4A 1LDGA 1WDLA 2O4UX 4XEHA 1DC5A 1ZFNA 3GEGA 4FIZA 2W2KA 2O7QA 5DP2A 3E03A 3KLMX 2CVOA 2QW8A 4UUMA 1E6UA 1JQBA 4FGSA 4EGFA 3FBTA 3Q2IA 4ZQBA 3U09A 1W4ZA 2JHGA 5KCZA 1EE2A 3QP9A 1UDBA 1YVEI 4JQCA 5C7OO 4K6CA 4OO3A 4DPMA 5G0WA 2BLLA 2O3RA 5COBA 4RLHA 4IY1A 4CMIB 1KVUA 1T2CA 4BKUA 3CZMA 4RPKA 1VRWA 4XDZA 5EL0A 4NQZA 2ZB3A 4WECA 1ENPA 2LDBA 4IDFA 1VKOA 1LEHA 3PGXA 3LVFO 5T57A 5A9SB 1D4FA 5L9AA
chains in the Genus database with same CATH superfamily
4JHXA 4PNZA 3GGCA 4ND5A 4AYTA 1HURA 4N4AA 3O92A 2XCLA 1GTL1 1SXHA 4UXHA 1GNVA 4AJLA 4AS3A 1DJMA 4N6NA 2WYIA 3TLKA 1K5GA 3AHCA 4FN4A 4B3XA 5TIIA 5I9MA 4B46A 2FMKA 1EUDA 3B3GA 4JSRA 3I6BA 4H0CA 2EKDA 2XEDA 1JEOA 5DH9A 4K9DA 4X1IB 2ZBQA 3F46A 2VCYA 4E08A 5JYEA 3EQ2A 4CIWA 2SNIE 1X1DA 5I9BA 1FS4A 1QV7A 4RQTA 3FPLA 3HUEA 2UYOA 3I9KA 4H18A 3U1VA 3C5CA 3CLUC 1ZN8A 4Q93A 2JKZA 4TMTA 2CNNA 3HL0A 1RLUA 4L85A 3U81A 4E6EA 2HR1A 2C5SA 3AEUA 2BBSA 4R1LA 4EUFA 3DQPA 1RLOA 3SMVA 2YASA 5KEIA 1VG8A 2LKDA 2JLXA 1NX6A 2AR7A 3KHTA 4CUZA 2V96A 3FNRA 5MGNA 1T10A 3WHIA 1FP4A 3K0AB 2MTBA 1QVWA 3HWX1 4W1PA 4BMXA 1BHSA 2VA8A 4Q9NA 5KB3A 1JG7A 1RIIA 4RELA 4OI0A 4NV3A 3F6CA 4FOOA 4HWTA 4FFWA 1KYXA 1ZLYA 3KM0A 4IIXA 1NULA 2YIJA 3OX2A 5JAQA 4DIUA 4BQIA 2R6FA 2O3QA 3F5DA 1P62B 4JUDX 1ZNZA 4BO6A 2CYAA 4BOYA 1C3VA 1CJVC 1M7HA 1A9TA 2J4FA 1C9DB 1QORA 3KPVA 2YV4A 3OM8A 2GF9A 5FBHA 5HMMA 3T95A 1N7GA 3T3IA 1L7DA 4O4LB 4BMCA 3I8XA 5AKZA 4A03A 1R88A 3PXXA 3TEMA 3WNDA 3ZLVA 2J6BA 1F4PA 5B3JA 4RHCA 1QCZA 5GQSA 4PVDA 4JOBA 2OXFA 6GPBA 4KBFA 1W5TA 3JATB 3G2MA 3P26A 3EVCA 3QEMA 4IWXA 3RWOA 2QAGB 4N9WA 4B2YA 4UFPA 5AQ1A 4YJFB 3VHXB 1OC4A 3EDOA 4K87A 2RGBA 3AIKA 1WW8A 2IUFA 5DTMA 5FPHA 5KUTA 3OJXA 2QE7A 4BUJA 1OKKD 2R7MA 2AWNA 4JLBA 3LD9A 4BB6A 3QXSA 1SOWA 2ATXA 3FWHA 3GYBA 1E64A 1X1CA 4WBNF 1BS2A 2FP4A 2QDKA 3G79A 3OLXA 2X1HA 4TRNA 3VPDA 4QREA 5IEBA 3P9SA 2VHXA 2HDNB 1IHXA 1UDCA 2IZ7A 2WVJA 3MWYW 4KOAA 3U7FB 2DB3A 4OOFA 3IAEA 3F8TA 3B5IA 4ES6A 3NO4A 1PWXA 4AMBA 1ZUIA 1YZKA 3T52A 4XWGA 5CLFA 1OWLA 2Y71A 1V45E 1V5IA 1H2ZA 2A3NA 3MTBA 4LDZA 4LK3A 3ROXA 1Z39A 1XVIA 2OV2A 3GY0A 1AF7A 1U3UA 2CMHA 2L17A 1UEXC 1J0AA 2JZCA 3ZVLA 2KWIA 5FFMA 4ERNA 4WFJA 1E3LA 1ZVQA 2P2DA 1Z56C 2VH1A 2H7CA 3MEQA 4QYIA 4Y2TA 5AVWA 3LL7A 4Z5XA 2ZETA 2XMPA 2Z8ZA 5ECDA 3Q5DA 3WYCA 2DT5A 1RYYA 1R16A 2QN2A 3LF1A 5ENZA 1I3KA 1ZN9A 2LW7A 2WZBA 3SEZA 3VSAA 3VYRB 3DZDA 4M99A 2QTGA 3MUNA 2POCA 1KH3A 3IAAA 3DBRA 4NHEA 2GZAA 5EIOA 1NMSA 4HFNA 3URMA 3C74A 3ZK9A 2AJTA 3GVXA 1RCUA 2E82A 5DGDA 3L4BC 4XWKA 2W90A 2G07A 3P52A 4L95C 2FOLA 2BMDA 2RH5A 1KYZA 4NY1A 3EG9B 1NVVQ 4JA0A 3AFMA 3OKCA 3HO1A 1RCTE 4EEZA 2JAUA 2HO5A 2C2GA 2WM8A 3NNNA 4GICA 2EC5A 3TVTA 5C52B 2OV8A 5HKKD 5JJIA 1NC1A 1V26A 1FA9A 4B75A 5A6SA 4G41A 3W34A 4N8DA 5G0TA 3FPGA 4JOQA 1GAXA 1SXJE 1Y4UA 2QN7A 2AJDA 3AUXA 3OZDA 2DTXA 1PR4A 1G2QA 4L5IA 2ANCA 2HPVA 2Y2VA 5JBIA 2C92A 1LV8A 4GYWA 2F67A 3PNYA 1P2UA 3FNFA 1Q95A 5AI8A 4FHDA 4AKIA 3H9UA 4CV1A 2RHDA 3NHRA 2AKYA 1WB9A 2BGWA 1Q0HA 4TGLA 1E7SA 3LX4A 4DYDA 2K5UA 3KQWA 4Y7CA 3ZDAA 1VL5A 4RZXA 5JTTA 1U7OA 1P0FA 1UEJA 2P0EA 3HMQA 4LZZA 4W6QA 3RYFA 4MVJD 1Q7EA 3QJGA 3MQ2A 3L7LA 4W1SA 1UP7A 3B89A 4Z9BA 4EW1A 3QW2A 4OEHA 4INJA 1EXVA 3D0KA 4AG6A 2FSVC 1K92A 4ZT7A 5IYZA 3R0QA 2CJPA 2GPBA 1ZA1A 3LTEA 1Q17A 5HZHA 2GZRA 4DMGA 4XIIA 3RS9A 4Z3OA 1RABA 3PWTA 1LTQA 2WNIA 2C3YA 4ZVRA 4JP1A 4DIMA 4HC4A 4WBNB 1AMNA 3OURA 2R68A 1BGXT 5GAJA 1G8HA 3WGGA 1IB6A 3Q7IA 4L2IA 4C0SA 1MA3A 2CFOA 1U6KA 3F67A 4XLTA 4RC9A 1G20E 1UEIA 4LXQA 5D1HA 2ZIFA 4MCIA 4H7FA 1JHPA 5E1MA 3OZGA 1N3IA 1YAHA 1TEHA 3L1VA 1VPTA 4DJEC 5ALVA 4U6QA 5DNYB 4HDCA 4MNTA 1E7YA 1ECJA 4U9HS 3UA4A 1QYDA 3D5EA 2QM0A 3ELYA 1R64A 5FPQA 2P30A 1RPJA 3H19A 2JRLA 5LLTA 3T1QA 5IC4A 5F4BA 3BAZA 2PZ8A 1WU8A 4QTUB 1YFJA 5CT5A 1I6KA 5DW0A 4DCSA 2ZRGA 4Z3KA 5CDHA 2WSYB 3PE6A 5KTMA 2ZR8A 3JVDA 5REQB 5LMNB 1XQ1A 3K7EA 2IYYA 2HK8A 2WAAA 2J7PD 4HWPA 3OETA 2RIRA 3N2YA 1XTKA 4Q21A 3FSJX 1R9MA 3WRWA 4BBPA 2I65A 4ZO4A 2WABA 5FTJA 1VBFA 4FWIB 1LK5A 2QTFA 2IV3A 3L0BA 2WUFA 3IKMB 2REXB 1OTYA 4N3NA 4OVKA 1E2DA 3QY0A 1TJ3A 1L4HA 3ELBA 4C4YA 3G0DA 1KJZA 3UHPA 3AL0C 5BUCA 2R3SA 4X45A 5F4ZA 2D5AA 3DKVA 1V7PC 3PV0A 4JI6B 2FUCA 3ILHA 1XKQA 4EJSC 1SXQA 1I6LA 3IT2A 5D87A 2FUG6 3RRXA 1G38A 4NP6A 5AHWA 1Y8AA 3NKVA 3WQBA 1BQ3A 4KAFA 3JAKA 3UB3A 3A0UA 4D9IA 4MZXA 2HV8A 2NN3C 3GVHA 5EHGA 4OHXA 1GLVA 2JEZA 4Y9DA 1ZS9A 4R98A 5LZ7A 3WWDA 1QK5A 2DAPA 2NSJA 1KJ9A 4IDQA 4R5MA 3SIRA 3V55A 2XOXA 1IJFA 3LDGA 3SYKA 4AN4A 4AZ0B 2CUKA 2VVTA 2O50A 4W5NA 1HFKA 2FEWB 4RZQA 3M4NA 1DC6A 1WXEA 2QSYA 4HJRA 3U7EB 3A1SA 3UN1A 4EI9A 3HCWA 3UMYA 4KFSA 2V3VA 4NG4A 3UGJA 3PUWA 2J3DA 3S6JA 1GILA 1E3JA 1YZGA 5ALSA 1ZN7A 3D81A 3AF5A 5KHLB 3OQMA 1E0DA 3DYIA 1MT3A 4IEIA 5GV8A 1WCV1 3H8SA 5FOUA 2ZRBA 4QOHA 4PSUA 2DFVA 3H99A 4W9NA 1U9CA 5TQ0A 1IPFA 3ADDA 4QPCA 1MC5A 3HVJA 2VJMA 1UMCB 4U2KA 1H65A 3EASA 1MLDA 2O7VA 3OKFA 3JARA 3VO1A 4B6GA 4A9AA 1O0BA 1JAYA 4QBKA 1CUYA 1K2WA 3MZ0A 3QTTA 4MEAA 1P33A 3HRKA 3T15A 2CE7A 2CLFB 4I4LA 2RFLA 4D4KA 2WBLC 3NONA 3STHA 3REOA 2GHRA 1HDOA 2FWMX 4BATA 2OFFA 1W5AA 3MJTA 4XVRA 3CF6R 4RJ2A 1QH9A 1RRPA 2XBLA 4PPYA 3PBKA 3PTAA 1MF7A 1NMYA 1HFEL 1R0XA 1A9QA 2YJ5A 3D4IA 1QYIA 1VQ1A 3FLBA 3BB1A 3KE9A 1JHUA 1X13A 4A73A 2NO9A 3L07A 3ZW7A 5HGXA 3AVXA 2WF6A 3A3YA 3UHOA 4GOMD 5D01A 1R3UA 3D6AA 4EA8A 4AKTA 4ZMRA 2G1PA 3KOYA 1GZVA 2VCHA 4RK5A 4UULA 5AXDA 3WGMA 4CLRB 5BN1A 1R10A 1M2OB 1TADA 4F4CA 4TMFA 5JTUA 2BWJA 5FCDA 1O6CA 4AJNA 5DEIA 3SC6A 4FFNA 1XNQB 1CD5A 4GAEA 2QUJA 4RD6A 4NX2A 1DBVO 3CB2A 1AQUA 1Z8DA 4GKKB 4OXXA 2PA3A 2R6HA 3GI1A 3GZNB 4X85A 3ESDA 3I30X 4K6FA 3V4ZA 2FLKA 2Y9MB 3N2ZB 2CZCA 2IZ1A 4WZAB 4EDHA 4MH0R 4FS8A 2B35A 1U63A 5IVDA 4I8XA 1VCOA 2VNJA 2QSZA 3I6IA 5C51B 2ZYWX 2W6CX 5CGQB 1BG6A 1YU6A 1TPZA 4WKPA 1XJ0A 2X77A 1HQDA 4ER3A 1L5ZA 3U62A 5I47A 1RLTA 2FU5C 4KQ2A 2Q07A 4L78A 2IKSA 5BVGA 2WWVD 3PCXA 4HWSA 5AJHA 2AN1A 1CUAA 1W6RA 1RKXA 2FPGA 2J0VA 1XTZA 4II7A 3GB9A 3I2YX 1WDWB 2CNBA 1UMDA 2NVOA 4CQMA 4NBVA 3ZTYA 3OKPA 1H0RA 3C24A 4LOAA 4QDUA 2G9QA 3NVKI 2GZMA 3FR7A 4XX1A 3IQIX 1XRSB 1CUVA 2P41A 3A9SA 4K9RA 4NNPA 3GNSA 4UHEA 2W22A 2P6NA 3RU7A 1ISRA 3PUHA 2H9IA 1QDUA 5HQTA 2Z3ZA 4RKEA 2NVUA 1Z6QA 1UC8A 2IXFA 4HLQB 5H81A 1ZH2A 1XOIA 4PBTA 5EXSA 1JPUA 9ATCA 4GBGA 4MS3B 3FYHA 5JC8A 5A05A 1ECPA 4YQZA 1J1IA 2NZYA 3UWMA 5EHXA 5I9NA 1U0BB 2HHAA 3MWDB 3PFWO 2HU7A 2HGZA 2YZGA 4D1YA 1E2GA 5AJWA 4XYGA 4B0OA 2R751 3KXDA 2N3ZA 5HCIA 3Q7TA 2UUOA 2A59A 2YV3A 4LYGA 3R8XA 3OZFA 2AQIA 1Q92A 4U7HA 1G9SA 2ZZMA 1IXRC 4I5EA 2QRUA 1G60A 1GCGA 1XALA 3F3KA 3IX7A 4XTRA 3MWEB 3WMRA 1AKMA 2FWBA 1G2PA 2IITA 4R6WA 3KTAB 2XWPA 3N0XA 3QX8A 5F12A 5KSYA 5BSEA 1Q57A 2GJSA 1TMOA 2A35A 3EOZA 3O4FA 3SX0A 1XHLA 1KKLA 3GRFA 5CLLA 5K3EA 3CUWA 4G1MB 4X3OA 1A97A 3PHCA 3AESB 3LY7A 4FNOA 1JG1A 4GRIA 4G4GA 3Q10A 1ZW6A 5AVOA 4D98A 1SCNE 5H70A 5DHQA 1A7UA 5D2CA 1CUFA 2BBWA 3M9WA 1EFRD 4MGHA 4TZKA 2Q45A 1GTG1 3MT9A 3VH2A 1BU5A 5D3ZA 3H84A 3LLVA 1QAQA 1TO2E 2BGLA 2G1JA 3IIMA 3R7SA 5E4JA 5JEDA 4FBGA 2VPWA 4P54A 5CRIA 2BZGA 1CULC 3OPMA 3UY4A 1XCGB 3MJRA 1KMNA 1ILWA 2IY9A 1Z6YA 2ZSBA 3JQDA 1FTWA 1ND5A 3FNQA 3FA2A 4MJ3A 4QTTB 4R1PA 3E2PA 3SR4A 4JS0A 1T8PA 4DCGA 1UDXA 1ZD1A 2VT6A 3QTBA 4QYMA 5FOQA 1YAJA 3H2GA 1Z34A 1A77A 4NQRA 3KOXA 2Y8EA 2G09A 4BE7B 3SXUA 1IZ8A 1ZNYA 2YXLA 3OCXA 4GZ5A 4TTQA 4MDEA 2ERYA 2JJ2D 3LHDA 1KIMA 2QP4A 3RGWS 1ZWKA 4PHFA 4N5HX 3UAGA 1XEFA 3X1KA 3U17A 1I33A 5B37A 1ZU5A 3GIWA 3M5CA 4R9NA 3E05A 5H80A 4MWOA 1ZEJA 2QTNA 3N2EA 3MPUA 3C14C 1P17A 1LBQA 2P6MA 1QQ5A 4N7JA 3RYCB 3M6FA 3BHIA 4KXUA 4NU8X 4JI7B 4IJVA 4KE7A 4R51A 3OZCA 1KFJB 2FN4A 2OD9A 3C8UA 2HXSA 1U7XA 4M2LA 5DHPA 5TJ9A 1HDEA 1NPDA 4GQBA 4KL8S 4UVGA 1OLSA 3FKSD 2BM8A 1GR1A 1R00A 2CMDA 4OA5A 3I72A 2O5VA 4CPDA 3F78A 2IELA 1W88B 3H4TA 5EJGA 2QV0A 5BQFA 2Q49A 3TKLA 4MVJP 1F9EA 2FZLA 1TLFA 1XTTA 1FE8A 1YCFA 3I23A 4J1SA 4LX0A 4XQ9A 4B4OA 2VXYA 3FCSB 4YV1A 3JVEA 2HKIA 3RRYA 1LW6E 9GPBA 4WV3A 1LNQA 1Q1ZA 3IUNA 2R8OA 1SD2A 2ZREA 3O4GA 3ZCRA 4DM7A 1NUPA 3CVJA 3D31A 4O4IB 3JVVA 1QO9A 3GJ3A 3NHSA 2VYVA 3CKLA 2BHNA 3M34A 4H3KB 4K2AA 5A1JA 2R1ZA 3WP0A 1JKFA 4ARZA 1EVKA 2F62A 1T2NA 2QJRA 2B9VA 5HXAA 1OC2A 1FRQA 2IKQA 4INPA 5I9IA 16PKA 2IPAB 5AVJA 2Z56A 4CKCB 5GZ3A 1MKYA 3B51X 5CVVA 2C7QA 2C04A 4C3OB 4MQMA 3KEGA 4EY4A 4OQEA 3USES 3H5AA 3GV0A 1R4NA 4IYRA 3L0CA 4LJRA 2IHTA 3H9QA 3FUWA 4R2JA 4G23A 1OJ7A 3UUEA 4UJ5A 2JIZA 1FX0B 3LT0A 4H1TA 4IKPA 1NLUA 1TEZA 1YRLA 1EH5A 1K89A 4W8OA 4XGNA 3ZYCA 2AEMA 2XCQA 3LBYA 2VXOA 5J1TB 3ZGLA 5I7FA 1NUTA 1O94D 3JQRA 2WJPA 4Q3DA 3DFFA 3HB4X 4UTOA 1K5DA 1L4FA 1W4CA 1XHEA 2DHQA 3GC6A 3OLQA 3NHYA 4JX9A 4NENA 3O8CA 4P0PB 4BKRA 4XR9A 4OJTA 5FPPA 5AW5A 2CCGA 4KNVA 1SXJA 1XPOA 4WK6A 1EU1A 1Q6YA 1FMTA 1D0SA 3ETNA 1WUYA 1WHTB 4JI8B 1TC2A 4H15A 5DF1A 2BRUA 3IT1A 3UAVA 1VG1A 2PH5A 3DDNA 5EXTA 3GCWA 3GR6A 3KB1A 1SUFA 1D2RA 1GGVA 4FDUA 2HF2A 3BZWA 1OH8A 4GI5A 3K5HA 3SS9X 4IQGA 4RK6A 4BJ3A 3NTQA 1KAQA 1O9GA 4TYPA 1JLLB 1L9XA 3DF7A 3OIDA 1N8KA 2JIDA 3K94A 3AYXB 3PQFA 1N34B 1AB6A 5AVZA 3ETCA 2WFMA 3JAMA 3P2OA 1KDRA 3I37X 4I1SA 4UVEA 2QOEA 5SY4A 4ZMBA 1V11A 4DE5A 3T38A 3CNQS 4CKEA 1WNTA 2B1QA 2ZTUA 4ENQA 1DX9A 3PRHA 4G1EB 4EYEA 2QA5A 5BQOA 4AKHA 1E6MA 1G20A 4HNAB 1T2AA 2I6TA 3GFFA 4L02A 2BTOA 5AHRA 3FDIA 3DCJA 5F78A 4BN0A 2ONZA 1I1OA 2XODA 4DA0A 2PX6A 2CMFA 2ZRIA 2W43A 4KZPA 3U7GA 4C43A 2TMDA 3BHMA 2R4QA 3EQ9A 4XOIA 1BDJA 3PVCA 4QU9A 4Y0NA 2C4TA 4X6YA 3TW8A 2AYXA 2H0AA 4C22A 3TGLA 1VE1A 1W9MA 2ON6A 1K4KA 3K9FC 1CUEA 1Z0UA 2AJBA 2EHJA 3M9XA 1LVGA 3MAJA 3NBZC 3W1WA 3I83A 4NHOA 4DXDA 2NYUA 1S1MA 5LYJA 2V6MA 1XRRA 2VK4A 3A32A 4NFHA 2XMRA 2VEOA 2IVFA 4O25A 2J3LA 5CJPA 3W6ZA 4D4LA 3QBEA 3SJBA 3AC0A 4W99A 2O06A 3JQAD 4A6XA 4LXGA 4B44A 5FBKA 3ELUA 2VJOA 3PNPA 5IT0A 2HA4A 2PX2A 3N7AA 1A9PA 3SHTA 3N28A 4NJMB 2AQ8A 2H2WA 1ZIDA 1WMFA 2I4LA 4MV8A 4OYRA 3KUDA 3TQOA 5LD2B 3VPSA 1QPZA 3O91A 4L4XA 1XTUA 2EYUA 1YR8A 2B99A 1G18A 1TK2A 1PHPA 2QIOA 3B8EA 3ZV3A 1HGXA 2COKA 4ZVMA 1I3OA 5FTLA 2MSNA 4KQKA 1NQWA 1KVQA 1Z4MA 2OC9A 3DHEA 4KIJA 4WZ6A 1JXOA 1DVRA 3EIWA 3EXAA 4GE0A 4KUGA 2XNDD 2Z1DA 2Y05A 3TD6A 2XE7A 5BWNA 2Z9DA 4BRZA 3BKXA 4MUBA 1L2TA 1OAAA 4MI9A 4NZ9A 5TMBA 3AU9A 4C1NA 1RPAA 3Q6IA 4K6OA 3OZAA 2BC9A 4L6AA 2PEZA 4RTQA 1Z8NA 4IF4A 3WZMA 2EWVA 1C0LA 3M9LA 5EINA 4DMRA 3WTCA 2PXAA 2C9YA 2OLJA 4M86A 4ZO7A 5LBUA 1JHYA 3IIEA 2GVDC 4TTJA 3EQ6A 4GMGA 3J80A 1N33B 2Q2OA 4YPVA 3KETA 2W2LD 3K6RA 1E2HA 2BZ0A 4QGBA 2BLNA 3LW8A 3SHFA 4UHCA 4Y1FA 5E6RA 4DILA 3FTNA 2W2VA 4UDYX 1S2GA 3I42A 3WDSA 3ABRB 2EZ8A 3L2OB 4GOND 1RFGE 2NZXA 2VXCA 4Z54A 4TMKA 4J43A 3GMDA 4BNXA 1E3EA 2JAXA 1G8JA 1D2GA 3OBIA 2Q6TA 1XPUA 4BX3A 1F9AA 2XVZA 3ZVNA 1DHTA 1QXSA 2DM6A 1RACA 2PSJA 1A95A 1X6VA 1JFRA 1V5GA 3BEOA 3D9QX 2VQSA 1XRLA 4URYR 3WRXA 1GTJ1 3G85A 2JCBA 2QN6A 1D8AA 3I58A 3KJIA 1MCZA 3LDAA 4GPTA 1K7XB 3NIFB 3I9FA 3O8OA 4LDNA 1VP9A 3W05A 3AY6A 5EJFA 3ZH2A 5JVDF 5BYBA 2XPCA 5IKPA 3IYLW 4YBRA 1DX6A 4W5JA 4RY9A 4UU7A 5ILGA 2G1AA 1C9MA 5KKAA 3W2FA 3PJRA 3EVTA 2JNWA 2ZE7A 4HSGA 2MSWA 1JAIA 3UOGA 1JXAA 2E4YA 2YWGA 4Q82A 4RQUA 3RK4A 4YCLA 1WZCA 1Y4ZA 4ZJZA 4M76B 4PC1A 4EH1A 5K5EA 3OLYA 3U4GA 1AUPA 2ZI9A 5JO0A 2DKOA 3FOZA 3LC0A 3WXMA 1EB8A 4RGYA 1ACMA 1XXHB 1TZCA 1QCYA 2P9TA 2R7AA 1U2RA 3B1VA 5DPMA 2PMEA 4D6XA 4KMMA 4EYGA 4Q47A 1SUSA 2DPXA 5HX7A 4EO9A 2WJAA 2XNSA 4X66B 1YD7A 4DRYA 4J0FA 1UMBB 1NT4A 4Q5IA 1EBUA 1WEHA 3KYJB 1DWPA 4N49A 4HYYA 4ZTZB 5EJAA 3M6MD 2JFGA 1Z0AA 2YXNA 2AFHA 1RXEA 2VHZA 1E4EA 3BH6A 3QKWA 5I8ZA 1KMQA 1OYVA 2WTEA 3WKAA 4F85A 2GD1O 1EX6A 1TQ8A 2VYCA 4MR8B 4B7UA 1VE5A 2JI8A 1YZQA 4NBUA 3KKEA 3A1CA 1E2QA 3EZNA 1T0IA 2IYAA 3BFXA 2I87A 2Y1KA 5E6UA 2YCLA 4KK4A 4KPGA 3DZJA 2F59A 1BVUA 3HBJA 3LG2A 4Z0HO 2ZUTA 3V4PB 3ZBUA 4BTEA 3DLHA 1AB5A 2X13A 2ZJ5A 3ICCA 2AG0A 2GVZC 2YIVX 1K3FA 4HZUB 5FTWA 3H83A 2FI1A 2RH4A 2ZVDA 3ONEA 4R31A 1WB6A 5HE9A 1MU0A 4E0BA 2WEKA 2HO4A 4K9SA 5FL7D 1NOKA 4MWTA 3CH4B 2QVZX 1A9OA 1KFCB 2XIJA 4IGFA 4YASA 3FOFC 3ECCA 3V8NA 2Z2JA 1ANKA 4F8EA 4JYPA 2TMYA 1DIGA 4J76A 3QOXA 4JB0A 4PCUA 1Q1GA 3LUHA 3ENKA 4WXMA 4DIBA 3ZLJA 4NICA 2ASEA 5EE9A 2WM2A 3UK1A 2D2IA 3G2KA 3QVTA 4HDMA 1GA1A 1UODA 1EE9A 2WV7A 1LVUA 2ZYAA 3PI7A 4MK4A 1TQ4A 2QN8A 2BHTA 1ZNQO 3ILYA 3AY0A 5SZKB 5CDUA 2HQOA 4MCHA 4YR7A 3NP7A 1DXOA 4DR6B 1SM4A 2EW2A 4JIGA 3H6KA 3I4LA 3VH4A 5KYVA 3PXBA 1DBWA 4U8HA 1DEXA 1HEIA 2JH9A 4EUSA 3E4CA 4JENA 2P9GA 4CMJA 1T5DX 2ADMA 3KZCA 1WXXA 5DNWA 4Q7LA 5JVDB 1N0IA 2L18A 2ZVPX 3I0NA 4ZEMA 2VAVA 1LX7A 1I9CA 2WFAA 5TS3A 1LSSA 4UU0A 1FS5A 1TD9A 4FI3F 4RLQA 3QOYA 3ZBTA 2B1IA 3RBXA 2AS0A 1SQSA 2V6BA 3FTEA 4HLUC 3MIZA 4GT1A 1YOBA 3CPJB 3Q88A 1VOTA 4E5NA 1R6XA 4C3ZA 1FDOA 1DOHA 2NIPA 1KI9A 5IKXA 4GX1A 3E9EA 1QHYA 2WAXA 5DGXA 4WKOA 2JJQA 3OZXA 1BJTA 3ONWA 4MOWA 5L4NA 2IU3A 2X5XA 3L0DA 4FZ5A 4J4HA 1Z5VA 1CY7A 1FRVA 1P4JA 3WZ2A 3U4CA 4BTVA 5HNKA 4GPEA 4MCJA 3RSQA 3O3OB 4EJ0A 1AV7A 4DAOA 2FR0A 4DMCA 4JUFA 4HQ0A 3N70A 5BV2P 5BWCA 1MN6A 3QUTA 4UVDA 3ZJVA 1I0LA 5K0CA 3EUEA 2ZR9A 1PEYA 2I55A 5LDGA 1YQWA 4ABTA 3H8VA 2R6AA 5KX5F 1P7PA 1CUCA 4QJ4A 3L8ZA 1LI7A 1B3RA 1JEDA 4HG2A 4G0PA 1I1NA 2FMHA 2HMWA 1DO0A 1V37A 5ICCA 1W30A 3I5MA 1UFRA 4HD8A 4ITVA 3THSA 1IXZA 1EJ2A 1L4NA 2EARA 2ZDGA 3BJRA 3VR5A 4BVFA 1Y8QA 5IX8A 2CJWA 4CJXA 4KNWA 3WC4A 2B8EA 3LMKA 4F21A 1XVLA 3UOAB 3DAFA 1NW3A 2G25A 1THGA 4XM1A 4ZVUA 3UT5A 3ZC3A 4RY0A 2YXBA 2H7XA 4R1OA 2XYVA 5CTAA 4YRFA 1KPIA 4DPLA 4C6HA 2PSFA 4ARAA 2J5XA 4S2UA 5K3SA 4D56A 2VSNA 3OEHA 1CYDA 3AIIA 3FWPA 4R69A 4D0SA 3TCKA 1XQWA 3QU2A 4KKXB 3GJRA 5FUXA 1L5RA 1RWQA 1DDGA 4BVHA 1GNPA 2Q3HA 3WOHA 1EK5A 2R65A 5ISMA 1U0LA 2QYTA 2WU8A 1QTRA 1LA2A 3L06A 5DXFA 4DJDC 2PWZA 4MAFA 1F1BA 1FXWF 1Z45A 3FVVA 3HP1A 2OQVA 3WISA 5JDIA 3MNFA 3RRJA 1JG3A 1BS1A 1VFNA 3WADA 2WVGA 3ZZUA 4EUHA 1Y42X 4H31A 3UC9A 1P0IA 2WSSD 3R74A 4FB5A 4J0IA 1JDBB 3HNRA 4YJDA 3KTOA 3I28A 5EP3A 1ACLA 2JATA 1VI6A 2EG9A 5FUBA 1AKNA 5TB5A 1UXKA 2B6HA 3RJ5A 2FPPA 3CM0A 1ZKDA 4NOKA 4HAXA 2MSCB 3JYPA 3QG1A 5JUWA 4A10A 1IIRA 1NRIA 1PT7A 4LRSB 2WM9B 1IN1A 4G5GA 1PS9A 2B5OA 4DG5A 3K9QO 1V3UA 1PDWA 2X1VA 5BSGA 5CVDA 1QLWA 1MJ5A 1FVOA 2AOWA 4KMSA 5CMLA 1GL7A 3PUKA 4S35A 1ZMOA 1Q0SA 4OGGA 5EERA 4LEIA 1REQB 1GYQA 2WP8J 3HMKA 3PRYA 5THQA 3TBFA 5C18A 3SKYA 5ADHA 3AINA 3V4VB 2IYTA 1GNLA 2G17A 3WX0A 1U8ZA 4MO2A 2JARA 1FFAA 3QVLA 1E7QA 3EIFA 4HNGA 4L9WA 4HAVA 3LHSA 1EGVB 3TZHA 2WNSA 3KLPX 4AB1A 1KO7A 1E9SA 1DV2A 4QVKA 1WO8A 2NG1A 4C3VA 5AW0A 4C9BA 1B16A 2HYDA 4RBNA 4UVIA 2PPVA 4O8CA 5EWMA 4EELA 2XTMA 3IRVA 2ZIGA 4K6GA 4DXAA 2O8EB 2WWIA 5D00A 5ALFA 1VYHA 4G1BA 4JBGA 5K2OA 4V0LA 1VG9B 2HRZA 1UCFA 3NJ8A 3WRYA 4Y1RA 4FZJA 3UJBA 4W6ZA 5KC9A 3V00A 1DZ3A 1O87A 2BEWA 4I2NA 2ZBRA 3AV3A 4UE2A 1IM8A 4E6PA 3C2QA 4FNMA 2XXAA 3EVBA 1RWWA 3MMZA 3C6KA 5B1DA 3WSVA 4AYXA 5F7OA 4Z4GA 1JYSA 3GX1A 4KGDA 4MA5A 2WW8A 1SCBA 4OIMA 5JLAA 1FTQA 3AB8A 1AGNA 5EC8A 1SVNA 1TFUA 5DB4A 1B15A 5EMLA 4IIJF 5GM2A 1I7NA 1MX5A 3O73A 1C7JA 4B71A 5C37A 1J1UA 4TT8A 3DWGA 4DA4A 2C4HA 2DLDA 3QXXA 4GMHA 3TOCA 2G72A 5CB4B 3SQOA 4TV8F 4P33A 5JSZB 3F4BA 1RJ9A 4MYDA 1PR6A 2ORED 3O3MB 4NZMA 1EGQA 1W0KA 2WNHA 3B1ZA 4ML3A 1HLDA 5DVZA 3OD1A 3W04A 3KFXA 3LVQE 4YC7A 1U1CA 1ZQ9A 2GXSA 3QLVC 4D3SA 2CY0A 4K2HA 3IMFA 3AUSA 1OXUA 4KH0A 4YJGB 3FN4A 4YTEA 3AVQA 3SP1A 2V54A 3EFEA 3WWCA 2HTFA 3WIDA 3VKVA 1LDYA 1U2ZA 3IMGA 3WWPA 5BN5B 2PT9A 1YZHA 3HNPA 3WWYA 3HH8A 2ZPAA 1QIGA 3P9XA 4OKSA 2XDQB 1YVRA 4OXKA 4URVR 3C3PA 1XDZA 1RZVA 2G77B 2J9FA 2WWFA 2CLEB 4M53A 1N1MA 5KIAA 2V6FA 1TLTA 4WPGA 3DC2A 4RNCA 4CDMA 1G9TA 5K45A 1V43A 3TB4A 4WERA 4CR6A 3HLTA 4KZKA 1DX4A 4R2HA 5BV8A 3EPKA 2REOA 3E3MA 4GR9A 5DBEX 4PFQA 1M10A 2N0SA 3PD0A 1QQ6A 1U2PA 1Y7HA 3OIWA 3H16A 3HDHA 4JJ4A 4HDSA 3KALA 4WHMA 5ECYA 2NSYA 5FWXB 1MENA 1Z6PA 4KAXA 1NMZA 2R8BA 3I76A 3FF4A 3BPSA 5SZIA 2OGUA 2X14A 5BV7A 5IDQA 1N36B 1JLMA 4D96A 3GOHA 2Z1MA 3K16A 2PG3A 2BFDB 2A1UA 1IAVA 3ISTA 1Z5WA 4L8GA 4BFLA 2V03A 1CNFA 1DEHA 1VLVA 3UXEA 3WYFA 4Q1FA 3WSTA 1QQ7A 4PLVA 4EW3A 3BX1A 2OO5C 4KB5A 1YV9A 5H9VA 4WJKB 4D0NA 1MJFA 1LJLA 2NO4A 2I3BA 4HP8A 3G2HA 5LXTA 2NU9A 1MH1A 2MSKA 3O93A 5KMGB 5TVKA 4P32A 4M6WA 3AGQA 3U4IA 2NQ8A 4OTZA 4C78A 5I7AA 1O6ZA 3WLTA 5CNJA 4DN6A 3ZE7A 4BC1A 2P40A 2Y1GA 4N40A 3A7DA 2C4NA 2QLBA 4P92A 4UU1A 3SJAA 3ZNPA 4E3ZA 2XRMA 4ZIRB 4JH0A 5K0NA 2JGRA 2V3WA 1LLQA 1IBLB 2BHRA 4NZZA 3JYHA 4BLWA 2QG9A 3JR3A 5D84A 2B83A 4UD2A 4FYXA 5K0LA 1F3OA 1MW9X 1GZ3A 1OVGA 4PX5A 3RYHA 2HBRA 2OXIA 5JRDS 1K6JA 1C30A 2C20A 3BRWA 2GCOB 4IIJB 1ZICA 3WDKA 5AFSA 1T0PA 1SELA 3DBIA 4PYIA 3QPCA 5F35A 2PQMA 5I6DA 2Y66A 2XUJA 1D7AA 1VSTA 3GZTB 3MM4A 3P7MA 1L4YA 3GO4A 1CVIA 3O26A 3QOFA 1XJWA 3OICA 1MAUA 1AGPA 3QEOA 1XKTA 3AZOA 1DFIA 1SZJG 4U2CA 2A5LA 4TV8B 5BRJA 2QTLA 4EHJA 4R83A 3HJAA 3KQYA 3IDOA 3ES9A 5KINB 1H94A 3ZY2A 2GBPA 4IIUA 1I3CA 2NUBA 3MTGA 4F06A 1C9YA 1PZEA 1VIMA 3IDZA 5AHKA 1F6BA 2H11A 5A5VA 3CHYA 1ZITA 3BD8A 2MT9A 3EEIA 4O0MA 3PR2B 3IUYA 4XDGA 3HB5X 1XDSA 5BT9A 1T1SA 1P29A 5AW3A 5HSGA 1UZMA 1S8OA 1MAVA 2QI9F 3SOPA 3TQFA 4HFJA 3VM6A 1H05A 1QZTA 5C3UA 2X0NA 3D7KA 3F1LA 2ZDQA 1FTSA 2BKEA 3JRXA 3EDRA 4L6CA 4AQDA 1UBCA 2GO1A 2JGJA 2XHZA 3FB4A 2FA9A 3EGXB 3DEIA 1R15A 4DBLE 3K53A 1ZGAA 2CK3A 1B1CA 4QDOA 3KYDB 3RUFA 4E31A 3QVVA 3LE8A 3SIWA 4PG8A 3LQRA 1XZDA 3CTMA 4B40A 2HIMA 1KQPA 1KXJA 2YVLA 4LY0A 1GPUA 1FIUA 1R27A 3B1WA 1WUIS 3WWZA 1H0SA 1GN8A 4J0DA 3DE0X 1PSZA 4X7MA 3DBLB 2RH9B 5AVKA 1RR6A 2EZ9A 2O2DA 2WMYA 2XRYA 1LRLA 1T15A 1Z4IA 2CUZA 4UASA 2AF3C 3V1KA 5KU7A 4IIVA 1SHJA 1CNEA 1K66A 3S55A 2A0YA 1A8QA 2AK2A 4UM5A 2JB9A 1AKRA 3SYMA 2ZB4A 4RAOA 2QYOA 1GITA 3ISVA 4EMSA 3P5BA 3PXDA 2P4QA 1Z8FA 1HPLA 1QUEA 2JIMA 4P36A 2JGMA 5LKAA 1IVSA 3K9NA 2M9MA 2ECPA 2Y0BA 1I2BA 5HJ2A 2IIQA 3AY3A 1LF5A 2I6FA 4LXIA 2W6ZA 3L1KA 1QZXA 1U9IC 2FPMA 4JBHA 1VL2A 1ZUD1 2BR5A 2WJJA 3AQ4A 3T4PA 5JXWA 4UFOA 5EUQB 2RBEA 4HEHA 1AX9A 4UHFA 2RBKA 3ULKA 3COJA 4J3JA 1X1SA 3ZYZA 2D3TA 3GAMA 4M8IA 1WF6A 5C8XA 1Y6FA 3M4ZA 2I62A 4ZCSA 3USCS 1RQ7A 4NAVA 4HAZA 4KH1A 1J2TA 1ZESA 3AI1A 4B81A 2X3UA 4M87A 2G0NA 1U2EA 3A9TA 121PA 3K1ZA 4RS3A 1KARA 2AHOA 3WQRA 2B5WA 1D4AA 2OHJA 3KKQA 1B76A 3B82A 3I32A 3LKBA 1KOLA 4JA2A 5CFPA 1G4HA 1DC4A 3HZRA 3TZLA 5CFMA 1JV2B 4PHHA 4Q24A 4QNRA 5LA6A 2O2SA 1I6WA 5FJJA 3PNVA 4JYBA 4TKVA 1JIXA 3Q2OA 1KFBB 3PKIA 4LGMA 3DMDA 3H2JA 4QG7A 4IDAA 1U7WA 1TMGE 4LOJA 4WY2A 3GPBA 3OVMA 4ZALA 1ZD4A 4BRSA 1NUSA 1EDZA 1E8MA 4ZOAA 3VNSA 4Q3KA 2XT6A 3FVWA 4KW7A 4X1OA 4U5QA 5HP4A 3DNPA 2A86A 4RWZA 4DANA 4LWPA 3K8OE 2GETA 1P2VA 3A4NA 2HK9A 4N03A 1FDUA 3R3JA 1QF9A 4NMMA 4ME6A 3GDWA 4N0PA 3BORA 4BMDA 1G55A 3CZ4A 3E8XA 4XIGS 1KJ8A 4DM3A 4AYWA 1R4MB 4E70A 5JNUA 4RESA 1D4OA 4F6LA 5KYXA 3PX2A 2IBSA 4E07A 1S5PA 1GGFA 1DNPA 4MDHA 5B36A 5ELMA 4PLCA 3ON5A 3RVRA 1BA2A 3PC6A 4IEEA 3SLKA 4HS9A 5LZ9A 2BM1A 1M0SA 2PJUA 4N5IX 3LI2A 2Z6QA 1PTKA 5FTMA 4FKMA 1TCCA 1I14A 3LLMA 4EB6A 4RX1A 2C8VA 2VP2A 4MVXA 2BZ1A 1BN7A 4NIMA 1IDOA 5FWYB 3P9ZA 5JAHA 3ZWBA 2QRJA 4PQFA 2CMKA 2PZBA 3ZHVA 4PLPA 2V98A 4KO2S 4EGQA 5IT9A 3BVPA 4HYQA 4I8DA 3BE8A 1MO6A 3LX6A 1M5TA 1TC1A 4YI3A 5JHGB 1I13A 2J0EA 3GVCA 3TFOA 4EJSB 3WGOA 1NQ5A 4ZICA 2ECFA 1U8EA 1EZ4A 4NMXB 4QC2A 1W85A 3MSCA 3SJZA 5A6VA 4YROA 3HKDA 1LBTA 3N75A 4Q7JB 4QQNA 1BW9A 3AR9A 2B7CA 5SV2A 4EHKA 3QELA 5JI3E 1K75A 2JBAA 1KAMA 2J5RA 3GPCA 4AO7A 2PEYA 3HRIA 4JGBA 3ZZMA 1QGED 3BMOA 4EJMA 2F8LA 2IQIA 3T94A 1T2FA 2H1SA 5AICA 1YO6A 2IYFA 3CPSA 4IXTA 5C4GB 4D9FA 4IZIA 3CGWA 3GJ8A 2MSEB 1U80A 3LC2O 2CDRA 1K7FB 1ONSA 3JD1A 3MJVA 4UM9B 2Z9CA 2CV2A 1V3QE 2WTAA 3ET4A 1ABBA 2IA5A 4ITRC 4KK3A 1B0AA 3TQTA 2IOYA 3WK7A 5I4IA 2OHXA 1TM4E 3DLCA 1FDTA 3UQYS 4KN5A 4AUMA 1A72A 1M1XB 1NV9A 1Y34E 2OE2A 3H9JA 1P9RA 3HLKA 1SRRA 3IUJA 4KLCA 4AICA 4HDRA 1A7AA 4OHOA 2VJCA 4JVMA 3V8MA 4BAUA 3I5YA 1VHWA 2BR3A 5DJ5A 4L7QA 4D3ZA 1QFYA 4QLOA 4Z1MA </