3ZH2A

Structure of plasmodium falciparum lactate dehydrogenase in complex with a dna aptamer
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
314
structure length
314
Chain Sequence
PKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
publication title Structural Basis for Discriminatory Recognition of Plasmodium Lactate Dehydrogenase by a DNA Aptamer
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 115
structure length 314
sequence length 314
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zh2A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3zh2A02
5JYEA 3ZHXA 3GN1A 1BRMA 1X0VA 4Q3BA 3F4LA 4NDNE 4CLHA 4RJTA 4XD2A 4AJKA 8ADHA 1Z7BA 1EK5A 2GR9A 4FFPA 4XDZA 3RASA 1P3DA 1U4OA 1ENYA 1K2WA 2J3JA 4NR0A 3C7AA 4DGSA 1GZ3A 4ZA2A 1DOHA 1A71A 4GSLA 2DBQA 1U3WA 3WBBA 1PGJA 2GRAA 4DLBA 4CLEA 7ADHA 2EG9A 1YXMA 4MKZA 3EGOA 4YJHB 5DULA 4E13A 3WQRA 4J1SA 3U4CA 4MP8A 1LTHR 4K28A 4DA9A 3JQDA 4EDFA 1WVGA 2QW8A 4AJOA 1YDWA 1M76A 1V9LA 4YT2A 1YBMA 1DLJA 3D4NA 1RM0A 2HRBA 4MP6A 3N7UA 3AOEC 1M2WA 2VWHA 3IJRA 3KYCA 2HUNA 3CMCO 4KDEA 4BO9A 4TVOA 4OL9A 1XU7A 1NQTA 3NAQA 1YBAA 3PYMA 1E3WA 4Y98A 1AN9A 3D64A 3H6KA 2WE8A 3RCBA 1FXSA 1XWFA 3DAPA 2FRDA 3EW7A 3I4FA 2JKVA 3Q2KA 3H8VA 1J4AA 1OOEA 1YQXA 4YJGA 1C14A 4WLUA 3VZPA 1UXGA 3ENNA 3OM9A 5JY1A 3BMNA 4WNIA 2A94A 1N92A 4CMBA 4DYDA 1ONNA 5K6AA 4J43A 2WYWA 3FSRA 1ZXLA 2YQ4A 2BF7A 1LNQA 2I65A 3PHLA 3GDOA 2E6UX 4YPOA 4BKUA 3BA1A 4OQYA 5FI3A 3VPXA 2FSSA 2PZJA 1PJLA 4YVFA 3FNHA 1N9GA 3P7MA 1DC4A 2Q50A 1H6AA 1FDSA 3JQ6A 3W4IA 1JAXA 1L7DA 2D59A 2VT3A 4NU5A 1IPFA 5KOIA 4BNNA 5T5QA 3WR5A 3AWDA 4ND4A 4BMSA 1QYWA 3EK2A 3NJ8A 1UXIA 2Q4EA 1ZZEA 4WJZA 4CPDA 4E31A 4A73A 1DIGA 1Y81A 1BVRA 1ZIDA 2F1KA 3CINA 4R16A 2PTGA 4PZDA 2X0IA 4BOYA 3L6OO 2EP5A 1B14A 1NASA 2PWZA 4Q39A 5ER6A 1YO6A 3EVTA 1PWXA 4U0JA 1H0KA 3NT2A 3U49A 4FGWA 3K96A 2EW2A 2WDZA 1HWYA 1HE3A 1LJ8A 4E2WA 2PV7A 3ICCA 3L4BC 4XQEA 3PGJA 1VKOA 3JYPA 1HDRA 3OEYA 4QXMA 3UXYA 3PJDA 3L6DA 4IINA 5L4LA 3PWZA 1DPGA 3INRA 4Z0PA 5JE8A 3RIHA 4CUJA 4FR5A 5HRUA 3ORFA 2EV9A 5FEUA 4NBRA 4WOKA 5IZCA 4ZQGA 1C0IA 2NTNA 1NQOA 1HZJA 1Q7GA 2P9GA 4G65A 1NNUA 3E6AA 1CQIA 5CG1A 4JIGA 5DN9A 5JMPA 4F6CA 1HF3A 1P1HA 3QRWA 1Q7CA 3P19A 4PLHA 4XYMA 3JYOA 4L9RA 2B5WA 1R0LA 4FOSA 3Q2IA 1R12A 1I33A 3I6IA 3U9LA 3TOZA 4WLEA 4CMJA 3ZU3A 2RH8A 3AU9A 4RPHA 1X7DA 1KVSA 3HDHA 2AEMA 1KOLA 2NU8A 4TRNA 1R37A 5I9MA 1E5QA 3E03A 4E6PA 3IDSA 3ROKA 1X7GA 2AMFA 2Q99A 3FBGA 4BO2A 1ENPA 1NPDA 5JDCC 1PJ3A 3S2IA 3B1FA 3L6EA 3KLMX 4LSWA 3QP9A 1KVQA 4PFJA 3DOCA 3PGXA 4R5HA 1HEUA 2I3AA 1P1IA 3JYNA 1KEVA 2Q1TA 4CMEC 1JWBB 3QE3A 2GN6A 4WEOA 5JCJA 2Q1WA 3JQ7B 1KYQA 2DPGA 2AQIA 1FMCA 4FIZA 4BNKA 4XGNA 1ZCJA 3DBHB 2OGUA 4CM3A 4JN6B 3S55A 4BNGA 3F3SA 3WBFA 3BMCA 4Z3KA 1H9BA 3B70A 3G49A 3A4VA 3FR8A 3WYCA 5CG2A 2NSDA 3GOHA 3GZNB 3I9MA 2NUAA 3ASUA 3AUSA 4GMGA 1HLDA 4RDIA 4BO8A 2HMWA 4DBVO 2G1UA 4Q9NA 4RV9A 4XQ9A 3WIEA 2WSBA 3TZKA 5LC1A 4J7CA 3DTTA 4N7RA 4ITUA 1JAYA 2BELA 5DBIA 3ITKA 1LU9A 1QSGA 1GPDG 3I3OA 1XLTA 2IODA 3KV3O 4B8WA 3AOGA 1NFRA 2PFGA 4R3WA 1B3BA 1UH5A 3RVDA 3DBRB 3TOXA 2B4QA 2X0NA 3W6UA 2BKAA 1N7HA 2PLAA 5C7LO 1MG5A 2YZ7A 4Z3DA 3JQ7A 1JVBA 1LC0A 3OIDA 4CM6A 4D3SA 4XQGA 1J49A 4YA6A 1ARZA 3DBHA 1UR5A 1U5CA 4JNKA 1DXYA 3QWAA 2Z1MA 3GFGA 4MIYA 1T2AA 4BGUA 5C5IA 2NM0A 3RUDA 2O3SA 1R0SA 1YONA 2Y66A 2Y0EA 1XGKA 1NX6A 3KETA 1Y8QB 1SZJG 4CM8A 3GZNA 1LLUA 1VRWA 3MJTA 4D3DA 1LSOA 2DM6A 1LLCA 4E5PA 3EC7A 4JP3A 5IDWA 2QHXA 4DPMA 1Y9AA 2O2SA 3WTBA 3PLNA 5EIOA 2OOSA 1QKIA 3AU8A 4F3YA 2CF5A 3K2EA 4OKIA 3TSCA 4IQ0A 4KP7A 4FSHA 2VUSA 2Y0CA 4I8XA 1F14A 5ES3A 4A27A 4ZD6A 4EI2A 3MTGA 4HADA 3H2SA 4CV1A 4BNJA 1CEQA 3VDQA 3JD0A 4XWYA 1ZMOA 5H81A 3DC2A 4HNHA 1TXGA 1PEDA 4NBVA 4HKTA 2VZ0A 5K6AC 3MOGA 3KTDA 1XEAA 5L4SA 3GGGA 3K73O 2O2YA 2ZQZA 3WJAA 3WG9A 5CDGA 3AUUA 2GYYA 3CSDA 4MVJG 3ZWBA 1PJTA 5IDQA 3PZBA 3CIFA 1LI4A 4JJGA 4YWJA 2XAAA 4GL4A 2I5PO 4LGVA 1ZSYA 4QQRA 1ADCA 4BMNA 4ZJUA 1N1GA 1O5IA 2RAFA 2IZZA 3KEQA 1A9ZA 2Q4BA 4B79A 1FDUA 4TZKA 5L4NA 3FCOA 2PGLA 3HDJA 1HXHA 3HHPA 1I2ZA 1DBVO 2BFOA 4LRTB 3ZWNA 4DQXA 1YS4A 3ZNNA 4B7CA 4J0EA 1HE2A 3DWFA 4UEKA 2O3JA 1B7GO 2GO1A 4ALNA 3TQHA 4JBGA 1ZVMA 4DQVA 4CQLB 3V2HA 4P4GA 3F9IA 4NFSA 2DU8A 2F00A 1ZK3A 2Y93A 2QZZA 2Q49A 3EMKA 4BKPA 1VJ0A 2C59A 2H9IA 1CYDA 3ANNA 4FB5A 3PHJA 4RL6A 1I8TA 1B26A 1AHHA 3KVOA 1V3UA 2CSUA 4XQCA 4A5OA 4XRGA 2VUTA 3ROMA 2EKPA 1I3NA 4DL9A 5CDSA 3VZQA 3NTOA 2YV3A 3KYBA 3QVOA 1A4UA 1BG6A 2GF2A 1UXHA 4I9UA 1Q2XA 3VOSA 1NM5A 5IZCC 5TLSA 4K9DA 3A9WA 4YRDA 3DL2A 4U6QA 1KEWA 3U0BA 3C7DB 3GUCA 1PJQA 4WUVA 5DCYA 1A4IA 1D1SA 3DFUA 5TRTA 3LU1A 1L7EA 1R66A 4YCAA 2OZPA 1CRWG 1SCUA 2CD9A 2ZK7A 1TI7A 2PZMA 4Z0HO 4R01A 3B20A 4FJ0A 4DQUA 1PR9A 5G0WA 2IZ0A 4WK6A 4CQLA 4CUZA 1ZXBA 2V6GA 3EHEA 5CDTA 3QHAA 2B4RO 1DC3A 1HDYA 5EINA 4NJMB 2X0RA 2O48X 2EF1A 1C0PA 1GYPA 1R6DA 2NQ8A 3PJGA 2FR0A 4IS2A 4B7UA 4UUPA 5DP1A 1DAPA 2HRZA 4FC6A 4EJMA 1UDCA 2W4QA 3DO5A 4ALKA 4BMVA 2BD0A 2QQ5A 3K31A 4IMRA 2J5KA 3GNTA 4UVHA 5A1TA 2RHRA 4RO0A 1XR3A 1P1KA 5LCXA 5K9ZA 5A02A 4CLOB 2QX7A 9LDTA 1UAYA 1D3AA 5TF4A 5MDHA 1BSVA 1HDOA 2VYVA 3I1JA 4J9UE 2VTEA 3UVEA 4R9SA 2CDAA 3AM4A 4DREA 2IEDA 2YV2A 5HA5A 2BHLA 3ONDA 3GGOA 3ZCXA 3FI9A 3ETGA 1XG5A 1C1DB 3B1JA 5FFFA 3F5SA 3PIIA 1QYDA 4L76A 4DIBA 5DT9A 4BNYA 1MFZA 4XA8A 5TJ9A 1SO8A 3NDJA 1Y7TA 1LDEA 3QLJA 4NFHA 3M2PA 1KS9A 1ZKMA 4HP8A 5F5NA 5KKAA 3GC6A 3RROA 1WAMA 2BGMA 1MXFA 2JCXA 2QZ9A 4NFYA 2EP7A 2BH9A 3SLKA 1A7AA 3RD5A 1KY4A 4QEDA 2YY7A 4N5LA 3KOUA 2JFGA 4E21A 3NUGA 4A0SA 3DB2A 3KB6A 2QRJA 4PZEA 4E30A 4R41A 1LDNA 1CERA 3WLEA 3ZW9A 1YB4A 1PZGA 1QLJA 3FNGA 3RC7A 5L53A 2EHDA 1PSDA 3DZHA 4RVHA 4J6FA 4O0LA 3AY3A 4LMPA 3RBZA 2JHGA 1N5DA 1PS9A 3EVNA 4RDHA 4ZQHA 1V6AA 3LDHA 4GH5A 3UH1A 2GSDA 1W6UA 2Z95A 1YOVA 3W8FA 5B4TA 2LDBA 3KO8A 1KEUA 4RQUA 4C7KA 1C1DA 4Q3AA 1H9AA 1G1AA 1AGNA 2P9EA 3VTFA 1LEHA 3RC1A 1LC3A 4ID9A 1CF2O 5IN5A 2XXJA 2Y1GA 2Y0DA 3QA9A 5G4KB 4MKXA 3P5SA 1QXSA 4BNTA 3E82A 5B4VA 1I10A 3OEWA 4FFLA 4PLCA 3E5MA 1K6JA 3Q9NA 3HE3A 4YJDA 1DIAA 2HK9A 3HJAA 1P31A 4DMMA 4J49A 4A26A 3GNSA 4CV2A 1O89A 5I7VA 3KBOA 1PU2A 1GPJA 3AUAA 5T57A 2O3UA 4YBZA 3DBLB 2Y99A 1PGNA 3O8QA 1QV7A 3OA2A 1F17A 1Q7BA 3E9QA 3WXBA 5BSHA 5FWNA 1VC2A 3WGGA 2UVDA 4OSOA 3WTCA 3PFWO 3R0IA 3OSUA 3IS3A 2PD3A 4PLVA 4CMKA 1YL6A 4E3ZA 1EBFA 3RUAA 3L9XA 2VOEA 4EUFA 5L45A 4C7JA 4IPTA 1GEGA 3ETDA 2X86A 3GMSA 5GMOA 4TSKA 3SC4A 1TT5B 3TWOA 3DHYA 1QV6A 3MTJA 4HFJA 2IEBA 1DIHA 1IZ9A 2ZTVA 3OIGA 5U4QA 3GUYA 4ZHSA 1DFIA 1JWAB 4EZBA 1YB1A 3IOYA 2A92A 4A7PA 1ID1A 1MFPA 2W98A 1LRJA 1MC5A 3EZYA 3QIVA 2YHIB 4N54A 4RPGA 3ZW8A 2GCGA 4CM9A 3WGIA 5B1YA 2ZJ0A 3V5NA 1YE3A 3ZNOA 2D5CA 5A05A 2DC1A 3LK7A 2C2YA 1EFLA 1E6EA 4R68A 4CL3A 1PQUA 1UZNA 2CUKA 3DBLA 1I36A 4G2NA 4OAQA 3ADOA 4W99A 4A10A 3WGHA 1PTJA 4GLOA 2PZLA 5TX7A 2EERA 4WASA 1LLQA 1NR1A 1ZK2A 2O23A 1T2CA 4BNVA 3O26A 3KYDB 5ITVA 4KUHA 4FFRA 5J23A 4PRKA 4QECA 4PN3A 3VVCA 3LT1A 4FBGA 1E3EA 2C07A 4GBJA 4DIOA 4D44A 3ZV3A 4J90A 1E3SA 2P91A 4YAJA 2NVUB 4CL8A 3ONFA 2HK8A 5A9RA 1XELA 3FHLA 1K89A 4DIFA 1N8KA 1SB9A 1BDBA 3JYQA 1P33A 2R00A 2WTBA 3LC7O 4II2A 5IXSA 1QORA 4IDBA 4J4BA 1MP0A 3ADPA 1ZBQA 1EUCA 1MA0A 4XJSA 1C0LA 1E3JA 4MOWA 3GZ4A 3MJEA 4L8VA 4XDYA 1ISHA 4GWKA 3EZLA 1MGOA 1QYCA 4FCCA 4H15A 1I3LA 2HMUA 3COSA 3RWBA 3D3WA 4JK3A 2TMGA 3S2FA 3HQ4O 3ULKA 3IC5A 5AXDA 3K92A 4GVLA 4N5NA 1OMOA 5MGBA 3OHSX 4CM5A 2HKIA 4DXHA 2BGLA 4FFOA 5KJCA 3KYDA 1SC6A 2E37A 1E3WB 4RQTA 1TEHA 1O6ZA 1P9LA 2X6TA 3D4OA 1GTMA 4CJXA 1VJ1A 2I99A 3LT2A 4W7IA 2WWRA 4II3A 1OI7A 5IG2A 1R15A 1ZSVA 2O4UX 2J3KA 2NVUA 1P1FA 2CDCA 4IXTA 1L1FA 4YJGB 4HV4A 4JLWA 3WB9A 1YJQA 4RF4A 3BMQA 3OIFA 4FDAA 3PPIA 4CUKA 3BMNB 4HUJA 3BXXA 3DTYA 1H5QA 4NK4A 3E8XA 5IJZA 5I8WA 1J5PA 3QWHA 3GHYA 4RPLA 5KJ1A 4KWHA 3RI3A 2DQ4A 5H82A 1TA4A 3PHGA 1EMDA 3LT4A 4HFRA 2WD8A 2IDZA 2R2GA 3HZZA 2PZKA 4EBFA 1N9GB 3H9JA 1UXJA 4GMFA 2UUOA 1XCBA 3SX2A 3UGKA 1E77A 3ASVA 4KQXA 5U1PA 3BZUA 4WGGA 5JW6A 1U2GA 4YQYA 3OA0A 4ZU3A 3BHIA 2I6TA 1GCUA 5CPFA 5AYVA 1I01A 3RUIA 4YAEA 3WGTA 4INAA 2PR2A 4J1TA 1DSSG 1HRDA 2VYNA 3TFQA 1GD1O 2ZIZA 3JQ9A 1GV1A 5ENDA 3WX0A 5JY6A 5JO9A 4Y6SA 2DVMA 3B6ZA 2QYSA 1F0YA 4OSPA 2ZTLA 3BAZA 4ALJA 3V1UA 2JL1A 1E7RA 4ND5A 2RH4A 3DHEA 3SLGA 1DO8A 4PLTA 4OM8A 2A4KA 1K5HA 4O1MA 4D0SA 3GVIA 4QO8A 3WNQA 2X9NA 3VPGA 3DMTC 1KIFA 4RF3A 3QY9A 1GEEA 3S1LA 1C1XA 4TQGA 3F5QA 3RU9A 2NU9A 3GT0A 4BGEA 4H16A 3K6JA 5EMHA 2BFPA 4QFDA 2DUWA 4ND3A 4M1QA 5EQDA 2VZ9A 3FD8A 3OFSA 4JGBA 5JCJD 2VQ3A 1EVJA 4KDFA 2RBEA 1MXHA 3JD4A 5GY7A 1DRVA 1ISMA 1Z45A 3EAGA 2EW8A 4D42A 4ZRMA 4D41A 5JSFA 4ONEA 4J7UA 1X7HA 1ZNQO 3C1AA 5G4LA 3JTMA 3ROQA 1M75A 3UHAA 5L7YA 2X5KO 5JC1A 1LSUA 3WS7A 3EUWA 3HWRA 5HBRA 3WLFA 3MJSA 2YW9A 4XGIA 4MJLA 4E12A 1ZW1A 4NH4A 4GGPA 4EGFA 2GN9A 3HUDA 4R1TA 3D4PA 4FFNA 3JQAB 3PDUA 1BW9B 4Z0TA 2Y1FA 4RVGA 1BTOA 3C85A 3UKOA 3D0OA 4TMFA 4DWVA 3QW2A 1LXCA 1SB8A 3LLSA 1FDTA 3AK4A 5CDUA 4GX2A 1U3TA 2P9CA 3ZHZA 5CP8A 4IJKA 2NU6A 5KWEA 1YL7A 4PG7A 3VPFA 1MV8A 4LVUA 3BMCB 1WXDA 1EFKA 4BB6A 4NIMA 4UVEA 3WOHA 1XQ6A 4KTTE 4F46A 3MJ4A 2JCYA 3OJ0A 4BS9A 1J6UA 1T26A 4ND2A 3U3XA 8LDHA 1SOWA 1LX6A 1SBYA 3NTQA 3GVCA 1KVUA 3LVFO 3V8BA 2AE1A 3JQGB 1V3TA 3H4VA 3DHNA 3IUPA 4FFMA 2AG5A 4L73A 2ZTUA 1NPYA 3X2FA 4A2CA 3E9MA 4MKRA 5TIIA 1U8FO 5AQ1A 2ZCUA 4YT8A 2NQTA 4CQMB 4ZGWA 1PGQA 1UZLA 1MB4A 4AL4A 4CR8A 3G79A 2GUGA 3I5MA 3JQAA 3UCEA 1BW9A 2BLLA 3HDYA 4BQRA 2R00C 5K0ZA 1IB6A 4CODB 3JQEA 3MZ0A 4R1SA 3PTZA 1W0CA 3RBVA 3T7CA 4DLLA 1DHRA 2Y1CA 5KJEA 4K1LA 4EEXA 2C2XA 4JP2A 3ZWCA 4YT4A 1FDVA 2QIOA 1H2HA 1UDBA 1X15A 3T4XA 4BNUA 4I5EA 3OQBA 1QP8A 4I1IA 4AJLA 3I23A 4XR9A 3UCFA 4UREA 3H3JA 3DZJA 3O03A 3RUEA 1LBEA 3ZV5A 3PYXA 1CDOA 1F8FA 4CM8B 3KRTA 1EE2A 1JKIA 1VM6A 4RF2A 1W8DA 4TROA 2HDHA 3JQGA 2PD6A 4NZ9A 4OOFA 1X14A 3E9NA 4BNZA 4MVJI 1CJCA 1E1NA 2DFVA 2PY6A 3TRIA 4RPJA 5FI5A 2A35A 2FPGA 4CQMA 3K8ZA 3NT4A 1AE1A 1R0KA 3MOIA 3I9OA 4L0QA 3GR6A 5TT0A 4IJUA 2ZB7A 3LC2O 1GV0A 2IE0A 3MCVA 5F21A 1GQQA 3VAZA 4NMHA 4U8GA 2O3RA 1U3VA 5BT9A 1UP6A 2P2SA 3W1VA 1JA9A 4XRRA 2DAPA 3I4CA 3JD1A 3TDKA 4RVFA 2I3GA 4JBHA 3GA0A 1GZ4A 1EK6A 3M6IA 2VRCA 4NJOA 3GRPA 4UVGA 5EQFA 1NP3A 4BNWA 4CLRA 3WFIA 1T2DA 4FW8A 3CPSA 1Y1PA 5G2OA 2PH3A 4Z6KA 5L7WA 4NK5A 3TFOA 4E5YA 3GHHA 2HK7A 4IJVA 2BGKA 2C20A 3PZRA 4E2YA 3OJOA 1GQYA 3JSAA 5TC4A 1NFFA 5EL0A 2BI8A 2VHXA 1T1RA 3RC2A 5COBA 1LQUA 4AJ1A 5A06A 3IQDB 2Q2WA 4D46A 3E1KA 1E7WA 4N18A 2FZWA 3PQFA 2YQ5A 3LF2A 4LSMA 3F47A 3HB5X 2NU7A 4BVAA 1LDGA 5I7EA 3S8MA 4MVJD 3V2GA 2YDYA 3HDQA 4RORA 3VKVA 5U9CA 1P45A 3JQ9C 3OBBA 4B3IA 2YDXA 5GZ6A 3JQCA 2B35A 3F6YA 5B4UA 3INTA 4NI5A 2JFFA 5JXWA 1YH3A 5FYDA 2D2IA 4WEQA 1O9BA 3ZNQA 3Q0EA 5L95A 4HFNA 4S1VA 3AUTA 3WQQA 4EUEA 3KSUA 3SEFA 4FS3A 4W9NA 2AHRA 1WDLA 3PYLA 5FF9A 1KBZA 2Y1EA 3VH4A 3QVWA 2OFPA 1I3MA 1DDOA 5A4DA 1JKJA 4BO7A 3MEQA 2DFDA 2OBYA 2HO5A 4RLSA 1P1JA 4YACA 4DLAA 3JQBA 3WGYA 4AJHA 3LF1A 5F1PA 1ZK1A 2CZCA 2OP1A 4I08A 1PZEA 3GLQA 9LDBA 2QYTA 1IL0A 2D1YA 3DQPA 4MVJH 4IGFA 1OC4A 1XKQA 5BQFA 3ETEA 3PWKA 2CVOA 3AFMA 3JQFA 5I8ZA 1LRKA 1IYZA 2VNAA 3GN2A 5C3MA 2VYVD 1P44A 7MDHA 2G17A 2J5QA 3GF4A 1BXKA 3HN7A 3H5AA 4QO7A 1YB5A 4RVSA 3FTPA 1LQTA 4MO2A 3G0OA 2EKQA 1TVEA 3TZCA 2VHWA 1CIVA 4ZQBA 2RIRA 1H6BA 1M6HA 2AQHA 2EEZA 4IUYA 2VHZA 1NPTO 1RM4A 4I9HA 1GZ6A 4PLPA 3UUWA 4BKOA 1E0DA 1XU9A 4WLNA 1V0JA 1RM3A 1U4SA 4J2OA 4ROSA 2UUPA 1ZJZA 4D7AA 5CDYA 4BNIA 3F4BA 2YFQA 1A27A 3LYLA 2GZ1A 3H3FA 4BO6A 3N58A 1WLYA 2XOXA 1CETA 1DJQA 2W90A 3FR7A 2I67A 4B4UA 5JDIA 3TZ6A 1AHIA 5JYDA 4PVCA 2G5CA 2DLDA 3WGQA 2E82A 4IQ8A 1P0FA 3GDGA 4I5GA 4A03A 5HS4A 3IL2A 2FSVA 4QFCA 1B8UA 3DDNA 4Z9XA 1H2BA 2J8ZA 4NBUA 4AJNA 2XF8A 2NTJA 4PLWA 3TN7A 2CDBA 4MDHA 3DAFA 4UVIA 1NFQA 1K3TA 3DBVO 4CV3A 4ALLA 1F8GA 4KWIA 2BFAA 4FPXA 3I9KA 1NR7A 1UP4A 1EDZA 4NHEA 1CWUA 2FHSA 3C7CB 1U7HA 4I5FA 1PGPA 2J3IA 4JROA 1E6WA 4DMLA 2O7QA 1PJ2A 3OECA 3U62A 1SPXA 4YAIA 2PA3A 3DOJA 3BTVA 3WSWA 4MPDA 3H5NA 4XYBA 2ZYDA 1M66A 3PJFA 4NBWA 5F3RA 3VH3A 5JS6A 4DTIA 4PVDA 4Z9FA 4L4XA 3GDFA 2QG4A 2I66A 4CM7A 2X1HA 4OYRA 3K2BA 1SEVA 5LDGA 1PJBA 1H6CA 2C7VA 4CLXA 1C0KA 1XIVA 3BHMA 3OJEA 4GWGA 1AXGA 2HLPA 1PQWA 1HSOA 4QSMA 5A5EA 1BGVA 1YOVB 2V65A 1T24A 4RZHA 4EUHA 4CMAA 2ZJ1A 4BO5A 2NTVA 2OO5A 3NKLA 1ENZA 1D4FA 3QSGA 4RZIA 4XEHA 2Y05A 1I24A 1BWSA 2VHYA 1GU7A 4IMPA 4DUPA 2EIHA 1HTBA 3CKYA 4OHUA 1XHLA 3ZHBA 3OF2A 3Q6IA 1IOLA 3P2OA 4ESOA 1I0ZA 5THQA 3L4SO 5B37A 4IDDA 2OP0A 1MG0A 3WGOA 2PGJA 4BUCA 2PKQO 2EJWA 2GPTA 4R4JA 2DTEA 3VTZA 1DB3A 3JV7A 3R3SA 1FK8A 3ZHYA 3GPIA 2DTXA 4GKVA 4F45A 2HCTA 1E7QA 3ABIA 3BTOA 2HSDA 1GDHA 2B37A 5JPIA 1E3IA 4ILKA 1NWCA 3O8QB 3PQDA 4KQWA 3FF4A 4IBOA 1B15A 4DC1A 3TZQA 3KM0A 4BO1A 4CM9D 4WLOA 1W4ZA 2WM3A 4X54A 1I2BA 1E7YA 1PIWA 2EKLA 3VH2A 1GL3A 4WCFB 4QT0A 3AI2A 5CHEA 5CEFA 3M1LA 4BGIA 3GVHA 5DCWA 5BSEA 5JMWA 1GQ2A 4WE3A 2P68A 4YEDA 5TT1A 2WYVA 4Y6PA 4YR9A 2C0CA 5KJFA 2IXAA 5IZ4A 3RKUA 3HG7A 1N1EA 2PGDA 5AVOA 1EVYA 1U7TA 1HLPA 4UAGA 2ET6A 3QVSA 3ZU2A 3D1LA 5B12A 1VJTA 3FWNA 4TRJA 4J3FA 4BHTA 1U2DA 1DRWA 4YJFA 3WQSB 1ONPA 1QYVA 1NAIA 2YYYA 3VHRA 1E5LA 2H63A 4IS3A 2HJRA 3ZZNA 2GLXA 1JLLA 4Y9DA 3GG2A 3GK3A 3OMLA 1NYTA 4PLFA 3WDSA 3H5RA 4NBTA 3AFNA 2GD1O 3C1OA 4WECA 4WCFA 4PG5A 5COAA 1KC1A 3I9NA 1BHSA 3KUXA 1IZ0A 4R51A 4B3JA 3K5PA 3D7LA 2B69A 4E32A 1EVIA 3JQBC 2FWMX 3JQ8B 5AXAA 2AQ8A 2CF6A 2P4QA 1R4NA 1LDBA 4PLGA 2GN4A 1Q1NA 1HL3A 4HBGA 3W8DA 2B83A 3UAGA 2HQ1A 1QMGA 4UUMA 2J6IA 4XJTA 3L77A 3JQFC 3GH3A 4H3VA 3P2YA 1HE4A 3TF5A 1IY8A 3R1IA 3DMYA 3KLPX 4FOOA 2VTDA 1E6UA 5G0TA 5COQA 4KUEA 1HETA 3EDMA 1TT7A 4F6LA 1DFHA 4IQGA 4PIVA 1VL8A 3DZIA 4BV9A 1S6YA 2W2LA 2VWPA 4ZRNA 4RPKA 4WCDA 2NADA 5EPOA 4GKBA 3DZGA 5IXYA 2RCYA 2C7GA 3NRCA 2DBZA 1YL5A 1XSEA 3D3WB 4GLLA 3PQEA 1Q0HA 3QJ5A 3T7EA 4ALMA 4ZQFA 2AEJA 1WNTA 3Q9UA 4HWKA 2OUIA 3R3JA 1DAOA 1NTOA 4OOEA 3GGPA 4LW8A 4JCOA 4GVXA 4Q3EA 1AUPA 1K6IA 2HMVA 3IP1A 4W6ZA 4DRYA 3JQ8A 4LCJA 5JDIC 5IAAA 1RKXA 4XB2A 4MINA 2VHVA 1X13A 3KHUA 2LDXA 3AI3A 3PDJA 2P4HX 3EYWA 3PEFA 3RUFA 4QX6A 3LSYA 1ISJA 1O94A 1YWGO 2JHFA 2Z5LA 4IIUA 2JD0A 3TL3A 3A06A 3PIDA 5ICMA 3BMQB 4BO4A 2YUTA 3QVTA 4FQ8A 5T64A 1VPDA 2IRWA 2ZKLA 2VYND 4K6FA 3U09A 1NHGA 4W4TA 3GQVA 4XGKA 3VDRA 1VKNA 5JO0A 1IULA 2YJZA 1JU9A 3HSKA 4P38A 2ZB8A 3GAFA 3V2UA 2DT5A 4GQAA 3HADA 4MVJM 1SEPA 5G0UA 4BKRA 3ZU5A 4EJ0A 3QWIA 4GI2A 3RKRA 3GAZA 3PFFA 2ZCVA 1P74A 1ULUA 4M55A 1YKFA 2X9GA 4J4HA 4BV8A 2GZ3A 4PCVA 2CY0A 5KIAA 4E0BA 2IXBA 1VSVA 1DJNA 1RYDA 1YBVA 1EUZA 3FPLA 4MIEA 4Z9YA 1OAAA 3A14A 3W6ZA 2FOIA 3RSHA 4ZN6A 2Q46A 4Y67A 2PD4A 1EEHA 2VT2A 2X5OA 3DR3A 4JXKA 4L74A 3SJUA 5KTKA 3KSZO 3ZWMA 3NYWA 4EITA 1UUFA 3WMWA 4XB1A 4CR6A 1ML3A 1ZO8A 1RM5A 1PZHA 4E33A 5BSFA 5CEEA 1C3VA 3CZRA 5BNFA 4B7XA 5TQVA 1VE9A 2CVZA 2RHCA 4AJPA 5DF1A 1T4DA 1QYXA 4HNGA 3H2ZA 5DBFA 1A72A 1G6KA 1E7MA 4UULA 3GPDG 2GDZA 5JAIA 2WMDA 5ADHA 1ZMTA 5KKCA 1I2CA 1S7CA 2C82A 3BMOA 3SXPA 5KVVA 5IN4A 1ORRA 1MUUA 4BO3A 1C1XB 5L40A 2OORA 3GEMA 5F5LA 3NJ4A 2EJVA 1EQ2A 5ENVA 2VWQA 3KXDA 2D0IA 5BSGA 1QLHA 1WPQA 1KVTA 4LVCA 4O6VA 2PH5A 1V8BA 4OQZA 2GASA 3V1YA 4JQCA 4DBZA 3F1KA 1PR3A 2JD1A 5A9SB 4O5OA 3QQPA 3LQFA 3G1TA 4XYEA 3CE6A 5IFLA 4IIVA 3ZNPA 2EWMA 1I32A 5KJ6A 1VI2A 3Q1LA 3WYEA 3RC9A 1E92A 4BNLA 4WLVA 2Q1SA 1NVMB 5T6BA 1MC4A 2ZB4A 2ZB3A 4J1NA 1FJHA 1X1TA 5G0VA 1HKUA 1T4BA 3KZVA 1GY8A 1IE3A 3WIDA 1BXZA 3V1TC 3QVXA 2E4AA 2A9FA 2HJSA 3E48A 2AW5A 1EQUA 3RJ5A 3GNQA 4RLHA 3SBOA 2C54A 3WICA 1NBOA 5DCUA 5HWSA 3INGA 4AFNA 1MLDA 5KNLA 4GPD1 3C24A 4J1QA 1B8PA 1QG6A 1VSUA 2X9VA 1I3KA 5CAEA 5EN4A 2JJYA 3JQAD 5C37A 3HN2A 2JAPA 1UDAA 3ZH2A 1YRLA 2V6MA 3NDIA 3JD2A 1GCOA 4M87A 5A9SA 1DFGA 3Q11A 2H5LA 4DPLA 5I7FA 4DPKA 4YJHA 2O7SA 3I83A 2J3HA 4WCFC 1Z82A 1BVUA 1WDMA 5A3JA 1NWHA 4Q3NA 4OXYA 2BI7A 1PJ4A 2I76A 5C7IO 4W7HA 4AJ4A 5HS6A 1HE5A 2X58A 4OKNA 3UF0A 4CR7A 1ZEMA 4WPGA 2FZEA 4B4OA 4EW6A 4YRBA 2HAEA 4RVDA 3ZV4A 2WYUA 4M89A 3I9LA 2OMEA 3C3XA 4PGFA 3TZHA 3AW9A 4NG5A 1G0OA 4FGSA 1LRLA 1H93A 1NHWA 4KZPA 4O63O 1M67A 1LDYA 4IDCA 3JYLA 4FC7A 4IJWA 1EDOA 5DNAA 1E1MA 4R54A 2VUUA 4CQMD 1HDGO 1Q0QA 1UZMA 1KVRA 1ZH8A 3CTMA 1RWBA 1LUAA 3DZKA 1GUFA 1Y8RB 3NTRA 3G1UA 3TPCA 2BFMA 2ZYGA 4BIIA 3H7AA 3ITDA 4CLDA 5ILOA 3FNEA 3RFVA 4R5MA 4RCVA 4MVJP 1UP7A 1WZIA 4GAEA 3ZWWA 2Y1DA 3WJ7A 2VRCD 4KOAA 1PZFA 3FRJA 3HB4X 5TGDA 3U4DA 4GX0A 4TRMA 1GUYA 4EEZA 1ZK4A 4PLZA 3D5QA 1YQDA 1RJWA 3O38A 1DEHA 1DC5A 1E1KA 4E2XA 1R16A 4J7XA 4TZTA 1W73A 2W2KB 1OZAA 1I30A 3AM3A 4J91A 1ADBA 1SOVA 4MIOA 5C7OO 2B36A 4QTZA 1TLTA 4XX0A 3DONA 2SCUA 4I5DA 4XYLA 4IM7A 1D1TA 1FF9A 4LN1A 4D43A 3TL2A 4NPCA 5KVQA 5CEJA 2DKNA 4AVYA 1Y8RA 1SAYA 4K26A 3DFZA 1X1EA 4YRAA 4CLRB 4WNCA 3GMDA 3K9QO 1XA0A 4XIYA 1OFGA 3RFTA 3RU7A 4D3FA 2NNLD 2AE2A 3ENKA 3ZWPA 3OJLA 3TJRA 3NV9A 3WFJA 5JBIA 3CZMA 3ROPA 3WMXA 2VRBA 3WGZA 1PL8A 4HX5A 3D3EA 1YJ8A 4M54A 4BB5A 1FDWA 2VNSA 4PG6A 1GYQA 3N74A 1ISIA 3G17A 4XCVA 3W4KA 5JAZA 4C4OA 3W4JA 2R6JA 3L9WA 3H65A 4YQZA 2W2KA 1NXQA 3IIEA 5KVSA 1EBUA 2X7HA 3QWFA 3RAJA 3SC6A 2J5RA 1H6DA 4DYVA 4CMCA 4Y8VA 3OQ1A 1HZZA 1T1SA 5F1KA 3HFSA 2CMDA 1OC2A 4J9VA 2IZ1A 1B0AA 3ANLA 5AXBA 1BDMA 4I9NA 4B8ZA 4P4NA 1Z7EA 5TJHA 4BNFA 3ZU4A 1QRRA 5JAMA 3WNVA 2E48A 5JFOA 2NLOA 2JFHA 5I7SA 1KERA 2X0JA 4HY3A 3ZV6A 3ZWXA 4YAGA 1SNYA 5L7TA 4O59O 5JLAA 5DP2A 4UEOA 1Y6JA 3H9QA 1HDCA 2OBNA 4M86A 3HNPA 4CM1A 5L51A 2GNAA 1PWZA 3GRKA 4YXFA 3IAHA 3PI7A 2NV6A 4PG8A 2EXXA 5GZ3A 1KEPA 3BTUA 4AJ2A 2NVBA 4S3MA 3NEPX 3UCXA 4RF5A 4YB8A 2QRKA 1PGOA 4XZ3A 2VCYA 1PJCA 3LC1O 4FN4A 4L4SA 2C5EA 1O0SA 3AI1A 4YYZA 4IZIA 4NU6A 4BNHA 5A9TA 3IKTA 1PS8A 1Q0LA 2VWGA 3E18A 1F06A 3BIOA 3RFXA 3NT5A 3PRJA 4J2HA 1DLIA 4MVJF 3H9EO 1JVSA 4YAKA 3H9UA 4KUGA 4LISA 3ST7A 4IXWA 1LA2A 1G0NA 3CXRA 2DBRA 1JQBA 2YV1A 3OQ6A 3PJEA 1JDJA 3I52A 3IKVA 3U4IA 3DBRA 5T67A 4AG3A 5ICSA 3AY6A 4OMUA 4XR4A 3GEGA 3ZDFA 1N2SA 3OH8A 1F12A 4OXNA 5T8KA 4B4WA 2NACA 1Y9EA 2V6FA 2JD2A 3DOOA 4EYEA 5TNXA 4U6SA 1X0XA 2H6EA 1HDXA 1VL0A 4RGBA 3RJ9A 3BYZA 3E5RA 3U4HA 2CNBA 1Y8QA 3OICA 4OH1A 1WDKA 1OBFO 3VPHA 1VLLA 4ZVVA 2NVWA 5A03A 4M8SA 1Z74A 3PWSA 1V35A 4R3NA 2G76A 1GAEO 1U8XX 4ZQEA 3W8EA 2UDPA 3ANMA 3DEYX 4GX1A 4OXKA 4E4YA 3DXFA 1B2LA 3TNLA 1Z6ZA 4P4LA 2D4AA 4E5MA 3GVXA 3D5TA 1ZUD1 4U7WA 1B16A 4DVJA 1DHTA 3SJ7A 2UYYA 1JTVA 4H7PA 4J4TA 2UAGA 2WEKA 1PL6A 3A1NA 3ZWYA 5AOVA 3DZFA 5THKA 4CMHA 2AG8A 5AXCA 2BRUA 2H1SA 2DUUA 1WMBA 4BNXA 2O3TA 1MX3A 4U5QA 2PKQP 3KSDO 4BQPA 2C5AA 2JCVA 3GEDA 4YDRA 1JN0A 4L75A 4IZHA 3NGXA 2Q1UA 2B0JA 1ADFA 3IJPA 3GVPA 5TS3A 2P5UA 4IDAA 2AEFA 5LDHA 2GERA 1ZEJA 1ULSA 4MVJA 3OJFA 4KTVE 4LMRA 4Y6RA 1LLDA 1Z73A 2CVQA 3QV1A 5GZ1A 5JC8A 3PHIA 3LZ6A 2WD7B 4Q3DA 4AJJA 1ZJYA 1YGYA 3AY7A 2NWQA 1DC6A 5KCZA 4TVBA 2FPPA 4LRSB 4BL5A 1PX0A 1XDWA 4AICA 1GR0A 5DBGA 1Y5MA 1DIRA 3VC7A 4MVJE 1HT0A 4KMSA 5A04A 5JAQA 2OL4A 1GADO 3DAGA 2EGHA 3KEOA 1PS0A 2VZ8A 4WOJA 5G0SA 4BKQA 3S2EA 2X5JO 4PRLA 5BNIA 5EERA 4NNJA 6ADHA 3CH6A 3LLVA 4TKMA 1KC3A 1AXEA 1GUZA 1K6XA 1YVEI 2B5VA 1DIBA 1EE9A 2V7PA 1U5AA 4FD3A 3VZRA 4AJIA 1EVZA 1IPEA 4UUOA 1GYRA 1TB4A 3T4EA 2ZQYA 4XYGA 3IP3A 3O4RA 2DTDA 4GGOA 1H94A 2HU2A 2WD7A 3NGLA 3R6DA 1B3RA 2VOJA 4IY1A 1U1IA 4R9RA 5JCXA 4NQZA 1BMDA 4BO0A 2GZ2A 1VL6A 3WWZA 3UICA 2FPIA 2X23A 3FNFA 1T2EA 4JX8A 3Q3CA 4B3HA 2FY8A 4QUKA 3BHJA 4YJFB 1R4MB 4PG4A 2G0TA 1O95A 4N5MA 1RPNA 4UEJA 4NJMA 3FTNA 4E5NA 4OO3A 1EZ4A 3RQSA 1WZEA 1EUDA 2X22A 3NDRA 1T25A 2HMSA 2DPHA 2WE7A 2YHUA 3JCZA 4WLFA 4D0RA 4E2ZA 1UJMA 2Y68A 4PLYA 2XPCA 1T2FA 2E49A 2W2LD 4G5HA 4IDEA 3VKUA 3UN1A 4OGWA 3AM5A 2I9PA 1JKFA 3MWDB 3WWYA 1ZSNA 5JNLA 3AOEA 4CLOA 3CUKA 1E3LA 1V3VA 4TWRA 3MJVA 1N7GA 1R4NB 2OHXA 2G82A 1O8CA 2TMDA 3H9GA 1NVGA 3UFXA 2D5AA 1U9JA 1WW8A 5I9NA 2FP4A 2FR8A 5TSDA 1D7OA 1E1LA 2ZTMA 2GN8A 5ILGA 3PK0A 1ISFA 3FBTA 5IDYA 2QRLA 3RUHA 1U3UA 2P5YA 1R4MA 4TKLA 3ZGYA 4YT5A 1A9YA 4W9NC 1UAGA 3OP4A 1B8VA 4ND1A 1A7KA 2FMUA 3EY4A 3IUSA 3M2TA 2ZATA 2X4GA 3FWZA 2PKRA 4YTEA 5EJ2A 1IHXA 3GFBA 4CM4B 3K30A 3ICPA 3ZN2A 4IGEA 4XKJA 3ZI0A 1K0UA 3UW3A 3VZSA 3DMTA 3LT0A 3STHA 2D8AA 2ILTA 2POQX 2V6BA 1P0CA 4WKGA 2Y1OA 5A3VA 1ZFNA 5BR7A 4R1UA 3I6QA 1NQAO 1PQPA 3MWEB 2DBVO 3JD3A 4CMIB 3QWBA 2OXIA 5T8KC 4EJ6A 1WWKA 3PP8A 5ER9A 3L0DA 2Q3EA 3IMFA 1ISGA 1ONOA 4IDFA 4JBIA 2AXQA 3WYBA 3VPSA 5F1OA 1UXKA 4AJEA 4W82A 4J16A 2BMAA 4LK3A 4URFA 5G4KA 1U28A 4ALIA 1ZK0A 2IYOA 4BNMA 5DDIP 4FJ2A 5I9LA 1GFSA 3PXXA 1HYHA 4B4VA 5L9AA 1E7SA 3ZWVA 1Y5RA 2Z1NA 2CFCA 3FN4A 3L4BA 1J0XO 1ENOA 1HSZA 4G81A 4RVUA 4CM4A 3FPCA 3O9ZA 2UV8A 1ADGA 3HFGA 4OJNA 2O4CA 1Z75A 1IHYA 1PJSA 1BXGB 2GGSA 1CQJA 3C8MA 1LSSA 3ON5A 1PL7A 1WP4A 2IYPA 3WSVA 4PZCA 3PLRA 4P22A 5KVCA 4UVDA 3L07A 4LCEA 4U0KA 3X2EA 4FJ1A 1WMAA 3S2GA 2FN7A 5ITWA 4CMIA 2EGGA 3ZWAA 4CV0A 2D3TA 2Y67A 3DZBA 5DOVA 1DRUA 3A28A 2AA3A 2FR1A 4UUNA 1D8AA 2Q2VA 3ONEA 5H83A 3VH1A 2HMTA 3RBXA 4L4RA 1HDZA 1KY5A 3UOGA 4DC0A 5HM8A 1NAHA 1XYGA 4E5KA 1TT5A 2W8ZA 1QR6A 4BGVA 5BNTA 1I5RA 5JDCA 1XQ1A 5CFZA 2C29D 3RUCA 2WJPA 3BMOB 4MP3A 1NVTA 4IDGA 4M49A 3U5TA 5DOZA 2AQKA 1BXGA 2XXBA 4ZICA 3GY0A 2YHIA 1LSJA 1M6WA 1P77A 2VN8A 1NQ5A 4R69A 4XIJA 4CMEA 1YDEA 5DZSA 1HYEA 2O50A 4HXYA 1LDMA 5EESA 3NX4A 1RYEA 3B1KA 3OETA 1YQGA 2PNFA 4JJFA 2YFHA 4D45A 4J0FA 4D79A 4JJIA 3GG9A 1IUKA 1A5ZA 1JW9B 1HYGA 1KETA 2Q45A 1P1RA 3BTSA 3ZWOA 4CMGA 3AJRA 5A5FA 5IDXA 2B4TO 3M1AA 6LDHA 2X8LA 4GSKA 5HTOA 4R1NA 2ZYAA 2PK3A 3CEAA 3F1LA 3G3EA 3PVZA 4K6CA 3C1TA 3KYCB 3F46A 3VVBA 3I9JA 4Q3CA 2JAHA 5CPBA 2O3QA 5L3ZA 4TRRA 4HFMA 2Q2QA 3PHHA 4OIMA 3SVTA 3CMMA 3MJCA 4P8RA 5IF3A 1SMKA 4GX5A
chains in the Genus database with same CATH superfamily
1BRMA 2I2WA 4NDNE 2COKA 1IMJA 1SOUA 4YRSA 1P2SA 2YINC 2R6GA 3AESA 3L7CA 4QLAA 1U4OA 1K2WA 1OD6A 2A1IA 2PZ8A 2J3JA 3C6XA 4ND8A 3SIRA 4NR0A 5BSTA 5ITZA 5CAEB 5M3BA 4BCDA 1V5GA 1JYSA 5A4MS 5EHIA 4ZA2A 4WT7A 5KOJB 3N2IA 2WPNA 4GSLA 3IRVA 3T7KA 4QTXA 1QH0A 5AKIA 1OAOC 3TAXA 2WOOA 4R8SA 4P9NA 4KRFA 4YJ3A 3EGOA 5DULA 3U4CA 4E3ZA 4K28A 2FEMA 4QJIA 4DA9A 3H5WA 4DBLC 1YDGA 2G88A 3EEQA 2KW5A 3Q8XB 1KFCB 1A9SA 4OK5A 4EG0A 4YT2A 3CBGA 2G70A 2HRBA 1M73E 3N7UA 2DR3A 2WV9A 1M2WA 2NUBA 2QKYA 2W6CX 4OREX 3U56A 5K2MA 4KDEA 3CMCO 3SD7A 2EZ4A 3BBLA 3NBUA 4NV1A 1XU7A 4M9RA 1P8AA 4I3HA 3PYMA 1MTZA 3IT1A 4UOQA 3WYAA 3H99A 3PPXA 2E4YA 2ZRCA 3RCBA 2JIRA 3DAPA 3KXKA 3LX4A 2HM7A 3I4FA 4MV1A 3WGMA 1NNSA 3Q2KA 4GP6A 4X7BA 1G8JA 3GYBA 3LUCA 3QOWA 1YQXA 1KO8A 4XPIB 5FBHA 1OFIA 4RM3A 1I7LA 5J5AA 1VHJA 5IT4A 1IEWA 3DZ8A 3M9LA 1WXWA 2G9RA 1M72A 3OCJA 1UXGA 2R8RA 2ODAA 2ZBRA 3ENNA 4MYSA 3JX9A 4NCHA 1TKAA 2OGTA 2CLLB 4RBNA 4Q9LA 5B58C 4P0QB 2A94A 3G2LA 2I4RA 5KPJA 4CMBA 1Y9ZA 4DYDA 1RC8A 4OHKA 4AP5A 3RAEC 1O6CA 1ZXLA 1DC7A 4DV7B 1ZINA 3GDOA 2FU5C 4Z0NA 4J94A 1UPXA 2I2BA 4BKUA 2XNDA 3BA1A 5DYNA 3A36A 3SF0A 2H1VA 4LY6A 2PZJA 3AETB 1Y8CA 2PG3A 2Q7XA 3P7MA 1QQ6A 1ULAA 4EHIA 2QXTA 5BT8A 3RSCA 1L3BA 2JFYA 4UE3S 1XF1A 2RHDA 1BU8A 3PR3A 1JAXA 1G9XA 2P9FA 2Z04A 2ZROA 2P1RA 3FYDA 5CD9A 2IW3A 2VSNA 1HY3A 1VQ1A 4MKFA 4YLEA 4BNNA 2C96A 5KOIA 3N2KB 4PFSA 2O9JA 4G5GA 3T7SA 4YCSA 4C4TA 1TLFA 2H07A 2O2GA 4IICA 3RIMA 4D9JA 1MN6A 5KNCA 4JBWA 1ZZEA 1C9DB 4ILEA 3DUFB 4DG9A 1GRCA 3ORQA 4Q7JB 3SICE 4KBGA 3OFVA 2MMCA 4JJ6A 4HGNA 4PS1A 4H3SA 3CLSC 5LB4A 1MB9A 2BOVA 4XX0B 1CFZA 1RHKA 3G9ZA 3OZRA 3CINA 1A2KC 4JU8A 4R16A 4GVPA 4FGLA 1IXYA 2PKEA 2X0IA 1T36A 4BOYA 1ZM4A 1NASA 1CZUA 3AHDA 3DE0X 4J03A 1JT9A 4KQ1A 2ZRMA 4Q39A 1H0KA 4U0JA 1U28C 1VSTA 3G5TA 2C5SA 4M0EA 1VG9B 1B42A 2GAJA 4MQ5A 3SKVA 4B46A 2ZIAA 4GMKA 1O87A 4B40A 5AJZA 4XOIA 4KO2S 4OV6B 1KQNA 2H52A 3L4BC 1B6RA 4HWRA 1GGMA 1Q0RA 4ENPA 4BLQA 13PKA 1HDRA 4U63A 4QXMA 4X5OA 1P91A 1E1QD 2IZ5A 3FCSB 4QREA 2X19A 1KBQA 4HZIA 4K1XA 5JE8A 5L4LA 2Z2ZA 3KV1A 5I9TA 2ONKA 2XMBA 5EP1A 1US8B 3W5BA 3N8KA 3UM9A 2IS2A 4WOPA 2EV9A 4OXIA 2L42A 1YB7A 2HJ9A 3KVRA 3RIGA 1IHOA 3UT0A 2PVPA 1T15A 2AZ4A 3LWBA 2B2XA 1C1HA 2J08A 2V9PA 4G5QA 1NQOA 1HYQA 4JUCA 2HO4A 1IWBB 1NNUA 3E6AA 3L7MA 3NPMA 5CG1A 4WZBA 1W76A 2AX3A 3TVTA 3KKLA 1C29B 1TYAE 1FFSA 5JMPA 1FB5A 3PFIA 3WXMA 6GPBA 1N6IA 1R3UA 1YZNA 2XMPA 1OBOA 3QH4A 4B4DA 1KR2A 3SYNA 1WO8A 1A9PA 3DUFA 3UQYS 4EI7A 4PLHA 4OQLA 4YO7A 3DVAA 5HF5A 1TNDA 1I2MA 3E7DA 3N75A 1R12A 1I33A 3TOZA 3IRUA 4EI8A 5LYJB 1RRPA 3RAGA 4CMJA 2YVKA 4KQJA 4I7EA 4Q4AB 3AU9A 1L4YA 1T8SA 4E11A 1FVXA 5FP0A 4E7PA 1KMCA 2HGSA 2QMUA 1JG4A 2P9YA 2WG0A 4TRNA 1KOLA 5CLQA 3E03A 5J58A 4DQKA 2D5BA 2QN9A 3IDSA 2HTFA 3IHTA 3QBTA 1J33A 1GAJA 1DEKA 3BZWA 4HD8A 4XSGA 3ND8A 2JRCA 1RI2A 1EVLA 2AMFA 4TLAA 2JFQA 3TQSA 3FBGA 3L93A 3LKVA 3LWZA 4LAFA 1FYFA 4BO2A 1W85A 2F6RA 4WCVA 1JDTA 4KGZA 1MC8A 1M6EX 4AZSA 3L6EA 1OLOA 2W6IA 3PUWA 5E6RB 1XZKA 4PFJA 4R5HA 3VSAA 1HEUA 3CZAA 3OIVA 5CVEA 3R5KA 5KNBH 1XYYA 3PB3A 3PRYA 4QQFA 2JDIA 3IAFA 3JQ7B 4MLCA 4WEOA 1K7EB 5F2KA 4ZHQF 1FMCA 1FEZA 2B6HA 3LD9A 3LPDA 4NCXA 4BNKA 1OHHA 2Z2KA 3DBHB 2AK2A 2GCPA 3M5CA 1UT8A 3JZIA 3FZYA 2XDAA 4NOLA 4K6MA 3BMCA 5LBIA 4Z3KA 2FMIA 3B70A 3EE6A 3PX7A 2H51A 3SC2A 3DHVA 2OVBA 2V8OA 2A6PA 4MUKA 4OCZA 4RHFA 1ESDA 3EVEA 3FR8A 3RANA 3VR3A 4L6IA 3S0JA 4JYMA 3GZNB 3I9MA 4GMGA 2PX8A 3FOWA 4D2IA 3U4QB 4LRXA 1RAGA 2G1UA 4JZYA 4BPBA 1Q7EA 3DKRA 3O2JA 1JBKA 2OHJA 1U7UA 2IW1A 3ELUA 4RULA 1Y7PA 3CO0S 1VECA 3MS4A 3Q7PA 2WSBA 4GQIA 4XQ9A 3RSSA 1PFQA 3WIEA 2QTVA 3LV8A 1IATA 4TXLA 5LC1A 4J7CA 4N7RA 1U3GA 4EOGA 5CVTA 1JAYA 4BEWA 2H31A 3DDHA 3KOYA 3L46A 3P4XA 2YKGA 5HP4A 2XRMA 1QS0A 2ORYA 3ZS9A 1GPDG 4OBEA 1N7IA 3OZTA 4B8WA 4BB0A 3RO7A 2R85A 3TOSA 4R3WA 3JPYA 4RMJA 2XWBF 4UARA 2D1QA 2B4QA 3IVXA 2D0PB 1C2YA 2BKAA 2H2DA 4LJ8A 4RABA 1XFDA 3NUQA 4LGYA 2E0IA 2FG6C 4Z3DA 5AW5A 3JQ7A 3KVYA 4U1RA 1K97A 3DD5A 1O4VA 2FDRA 5KAMA 4RTSA 4H18A 2Z5VA 1J49A 4AS1A 1R6UA 4YA6A 3B9BA 4P3PA 3DBHA 2QK4A 4G5XA 3R0QA 4ZEWA 2WF5A 2QMOA 3HB0A 2Z1MA 1NW8A 3GFGA 3IERA 3ZLTA 5IWCA 5ESWA 2HF9A 3BAFA 5C5IA 1Q95A 2P2LA 4QU8A 3FJ1A 1QPGA 4ETWA 4KPEC 3S99A 2Y0EA 3EZ9A 1NX6A 5KYUB 1Y8QB 3GZJA 4G26A 5AW9A 3ZDYB 3GZNA 3I1IA 3U4QA 2VNIA 1D2MA 2DM6A 4E5PA 4JP3A 4LDRA 3W5UA 2A59A 4DCOA 4LOJA 5IDWA 1CYEA 3A32A 4Q9HA 5AM3A 4P0TA 3IE0A 1UC9A 2H00A 5CXSA 4IH4A 3PLNA 1TC2A 3DE3X 5ILQA 2V7BA 3AU8A 5SZIA 2ZZNA 5JH7F 2JFPA 4ISBA 5TARA 4EYKA 3CT4A 1IY2A 3A3NA 3P71T 3NVKI 1XDDA 4GD3Q 1BN6A 2XCQA 4DLYA 1Z2DA 2AHOA 1V2GA 5BRNA 2ZJFA 1N57A 1VCHA 2L17A 2IVFA 3HC7A 1CUAA 1F14A 4JVOA 4A27A 1G98A 1PR2A 4HADA 3H2SA 2VHUA 3TAHA 2HL6A 3BORA 5HQTA 4ZHQA 3CRW1 5KC9A 2NXEA 4A6PA 3BJMA 5AW0A 4XLZA 2UZAA 3EGVA 3MOGA 1QIJA 4F3CA 1LPOA 1SG0A 1V6CA 3EGDB 4GZ3A 4ER6A 3M49A 3PX3A 3EMDA 3K73O 3MWYW 2COEA 1O0BA 3GLIA 3WG9A 2C95A 3CSDA 3IILA 3OU2A 3AQ4A 3U13A 1E2HA 1LI4A 5JISA 4BE4A 1J8DA 2QRVB 4LGVA 4XWTA 4NEQA 1ZSYA 3EQ2A 5ESDA 4ZJUA 1RI3A 1N1GA 4ZALA 2D2EA 3KQYA 2IYAA 2RBKA 4KX5A 4COOA 2JI4A 3ZDXB 4G0NA 1I9GA 2HHHB 1FDUA 1YE5A 3EW9A 3U48A 5L4NA 1IMOA 1GNLA 3I4LA 1OFUA 1ZVQA 3FCOA 3BXZA 3O94A 4P98A 4PZZA 3UTCA 3HDJA 5HKKA 3X2SA 1RFGE 1W8IA 1MABA 4HTAA 2O2ZA 5GJVC 3UB3A 1OXUA 3ZWNA 1ST2A 5CDFA 4CCAA 4CKBA 3L40A 1NBEA 3EGIA 2HJVA 4KMMA 4PICA 4DTCA 2AK3A 1QG0A 1I5OA 1N33B 2ZRFA 3LH5A 1B7GO 2AT1A 4F4FA 4R9VA 5D6OA 4OGLA 3D8TA 4DIDA 4CQLB 3WP0A 1PQYA 2LPMA 3F9IA 3I53A 4HT3B 1DV1A 1VJ0A 3GLFB 2Y4NA 3Q9LA 4GXRA 1LWNA 4X90A 5DMHA 1B26A 1NMSA 3G02A 1XDSA 5CT9A 3TD2A 4RTJA 3SM3A 2ZSUA 1NP6A 1T5SA 1L7VC 2C1EA 3OOHA 5FJJA 2C03A 4XRGA 2V6JA 3ROMA 2IHVA 2WJJA 1LPSA 3QVOA 1BG6A 2Q7DA 4YGXB 3TQRA 3V8RA 3EULA 1J1ZA 3IAXA 2W11A 4TMKA 5EJFA 1Q2XA 1M8JA 1KIMA 1T5HX 2M32A 2BGUA 3OZAA 4LHVA 3I28A 3OCUA 2HSWA 3GFRA 1EK0A 1CUDA 4U6QA 3IR7A 4EG6A 4FDLA 1NBWB 1D1SA 2QTRA 5TRTA 1BMQA 1VLZA 4G8DA 3THOA 3HV2A 4W6QA 2OUKA 1TI7A 1Y89A 1G3RA 4MHOA 4R01A 1IN5A 3B20A 4Z0HO 1Q21A 5FCDA 1S8NA 2E4WA 3H0CA 1QGUB 4IHAA 2ZSEA 1TQ6A 3A37A 4MR8A 1A2OA 3RTGA 4LDJA 4CQLA 1QVRA 3D0KA 1PFYA 1EB8A 5AHKA 5K4AA 2V6GA 5SZKB 4TL9A 3GLFA 1SC3A 1KDOA 4OQNA 2Y8EA 3OEHD 4TTAA 5EINA 4A0QA 2X0RA 3GLGB 3IP7A 5FULA 5JNWA 1HT3A 4OU4A 2VF7A 1GYPA 1C0PA 3A8TA 3PJGA 4IS2A 1YB2A 2GYVA 3IBGA 2EZ8A 3KR0A 4B7UA 3GB9A 5EUMA 3TZBA 3ZI4A 5I7WA 2OV6A 3FCXA 2QN1A 5IANA 2W4QA 3BT7A 3LVBA 2J1LA 1IRXA 2XUDA 4IMRA 5A1TA 2XHEA 4AY5A 1K8QA 4BVGA 4XTRA 2Z98A 1RQ7A 3V6LA 2ZUFA 5LCXA 2GD6A 1MIHA 2RHMA 4MS1B 1W2HA 4IQ4A 4YN3A 5FRDA 2IYEA 1F51E 3PUJA 3STYA 4I1PA 2JGKA 2YHAA 2WU1A 3G13A 3HZRA 3KG2A 3OCYA 1JU4A 2RB5A 1BSVA 4CEHB 4J9UE 5TDHA 3TQQA 2VTEA 4R9SA 2CDAA 4Y2SA 1PR4A 4G0YA 1UXOA 4WBSA 4BQFA 3TX2A 3OO1A 4LX8A 1IDOA 1F9EA 3F6PA 3AFHA 3FI9A 3UAOA 1O6BA 2NMVA 1D6NA 1CFJA 5FFFA 2GFIA 3GCWA 2HQBA 3HXTA 3BXGA 3VI3B 1QGUA 4Y7DA 1QP4A 3N6VA 4KN5A 4BNYA 3U7HB 4PIPA 4QLOA 3CBQA 3LA8A 4XA8A 4AF6A 1FFGA 2Q4OA 5TR9A 1GG8A 1Y7TA 4R1OA 3QLJA 3MC1A 2Q3DA 2V7GA 3M2PA 5KNDD 2WJVA 3GLGA 5F5NA 3RROA 4NFYA 2H9AA 3QGMA 3TQTA 5AI5A 2CDRA 1KY4A 3RD5A 4B85A 2OQ2A 2QN7A 1VLHA 3AL0C 1HNNA 2Z30A 5IFKA 3KJGA 5FO1A 5IC5A 1IZYA 3SHQA 4FXPA 3VKWA 3KB6A 4F5DA 4BTVA 5DHQA 4E30A 4EY3A 3KQHA 2XZLA 2R4UA 1W36B 3U4GA 4OLBA 3GCGA 2NP7A 2GBFA 1ZWKA 1GKYA 5L53A 3BGWA 3DZHA 4GNRA 5JYCA 1SVUA 3AY3A 4LMPA 3A1FA 4JBNA 2JHGA 1JL3A 1UC5B 4GOMD 2JS7A 4RDHA 4ZQHA 3UH1A 4XM0A 4CEHA 5CLFA 5DM0A 1GKUB 2BP7A 2Z95A 1A98A 3N76A 2VNKA 1PUJA 5KHLB 4H3HB 3NMUF 4JOBA 3KO8A 2NYRA 5H9VA 1G1AA 2I8LA 3FCEA 1MVNA 2GEDA 2PX5A 3TEMA 2NYVA 1NXSA 1U02A 2Y1GA 3U5ZB 4TWBA 3WGUA 2V0CA 2QYOA 3HJBA 4G1CA 1RRMA 2EATA 1UQTA 1VI5A 3P5SA 3QPWA 4K81B 1U9ZA 4BFYA 1KTVA 2ILVA 3E82A 4CIXA 4FFLA 2JCGA 3KQWA 3K70C 3E5MA 3E1SA 2JH9A 3Q9NA 1WDTA 4QC2A 3NB0A 4YJDA 2Z6AA 2VDUE 3L3BA 4DXDA 5K0SA 5AVSA 1Z07A 5B1HA 1YVDA 2OD9A 2Q5HA 1P31A 4MIKA 4ZAVA 1FFHA 3JALB 4M0CA 3KUDA 3DE5X 1G2PA 1O89A 3I5AA 3K20A 4NY1A 2MHCA 3UMVA 4CV2A 3ZD7A 3JWIA 3O0DA 1GPJA 2CHUA 3N39C 2GCOB 3MXOA 4UBOA 2PYDA 4YBZA 3FPHA 1KYZA 5J2TF 4FP9A 5CNIA 2WIKA 1DTEA 3PGMA 3OA2A 4D96A 2R8BA 3PNPA 4BRSA 3WXBA 4CGYA 4DC9A 2IGTA 1AIPA 1MVOA 1Q50A 5DNEA 3A1TA 3WGGA 4H08A 4MWDA 2YR0A 2YIJA 1V8PA 4UHBA 1QDLB 3PNLA 3WE7A 3WTCA 1WP9A 3P9ZA 1X8LA 1FYDA 1GQRA 2PD3A 3R9XA 4IYRA 1X8XA 4FOLA 5FWYA 1LW7A 1Q17A 1KPHA 2ZXEA 4C89A 1PD1A 2GKOA 1SA0A 4NKRA 1SUDA 1VE1A 3UJNA 1GEGA 3PXDA 3ETDA 5KC8A 5ALYA 2GBGA 3GP3A 3GMSA 1GA6A 4C2BA 4TSKA 3T06B 4BP9A 3NIBA 4MEBA 1TT5B 1GVHA 1M34B 4MAAA 1QV6A 3MTJA 5IMBA 1DIHA 1IZ9A 3O8RA 4J8PA 3GUYA 4B75A 3RS5A 4EZBA 3MNFA 2O8EB 4FYPA 4TT3D 2GEBA 2G0AA 3ADCA 1PFVA 1U9IA 4NRDA 3SQOA 2KSQA 5CB4F 1ID1A 2W98A 4RPGA 1EFDN 4G63A 3ZW8A 1R7RA 4HGPA 5EP2A 2CSXA 1T8UA 1EUCB 2GCGA 3JALA 4CM9A 2ZJ0A 4CTKA 5BURA 4KKVA 5J2TB 1XRMA 2OO7A 1LPPA 5GJBA 2GCOA 3W5HA 2CUKA 3OOEA 4YUVA 3IJ5A 4OQQA 1E2PA 2ZSBA 3I01M 4TS9A 3OPQA 4XUCA 1KBOA 1Z37A 2K2QB 4A10A 4KPUB 4JHLA 4KVFA 3WGHA 1EWRA 4HQNA 2PH1A 2FUKA 3ZR4B 4LS3A 5AVZA 5TX7A 2QZ4A 1XRNA 3VR5A 1MV5A 3HS3A 3FHCB 3N0XA 3DP7A 4EB6B 4MW1A 1EXVA 3D7SA 3PKIA 4IV8A 3V1LA 4Q6WA 1ZD8A 3C3WA 4BNVA 2BW0A 3O26A 2CMKA 2PPLA 1K7FB 5HUJA 5J23A 1GUDA 2C99A 4PRKA 2ORVA 2HHCA 2XKBA 3GD7A 1OI2A 4GHWA 4PN3A 4LF5B 4IIXA 2C07A 2YWDA 4GYYA 1KYIA 3L0BA 3BD8A 3MERA 3ZV3A 2ZUWA 1DWPA 4DIOA 1M34A 3KHSA 2XIQA 3KQPA 5KSOA 4DCGA 2PMKA 4POOA 2J9YB 4DIFA 3GWGA 4NH0A 4XFDA 4DM3A 2O8EA 1N8KA 4OJYA 2R00A 2WTBA 4RZUA 1UBCA 1Z4QA 4IDBA 2PM8A 1FDIA 3OBIA 2GA9A 4DY6A 3QU5A 1EUCA 4LYFA 3F49S 4XJSA 2QPOA 1C0LA 2Q9AA 3DXXA 1W5BA 3A6LA 3MJEA 3OTOB 1XE3A 1UK6A 4EGQA 5I5GA 5T41A 3ROEA 4F4HA 4KQCA 2V03A 1MGOA 2W43A 1UJBA 3FGOA 5DEIA 5H3CA 2JLAA 3D3WA 4OHFA 4WJKB 1UJNA 2VSYA 5D00A 3S2FA 3SJCA 4EHDA 3FWPA 3LBIA 1QFJA 4X6YA 3SSAA 4CM5A 3IELA 1IG3A 3U16A 2NZUG 1BDJA 5KJCA 1YQEA 3VR6A 3W9BA 1HTWA 3FG9A 3WL3A 4AKGA 5BORA 5E2IA 3N2EA 4RQTA 3SN6A 2DMRA 1P9LA 2H4YA 1GTMA 2O1WA 1JQEA 3D4OA 3I12A 2VHTA 2I99A 3LT2A 1G19A 1P0PA 1PE0A 4GYJA 1OI7A 2CK3D 2J3KA 1CLEA 2J33A 1P1FA 3OE7D 4IXTA 4MV3A 4Q18A 4W8GA 4RZSA 4YJGB 5CB4A 3NOVA 2IU4A 2WFMA 3OEED 4C88A 4CM1A 3F6CA 3SLRA 4CN8A 1YJQA 3P94A 4LHWA 3V97A 1R0ZA 3BMQA 5LQUA 4FYXA 3CNBA 4FDAA 1YOBA 3FHJA 4MW9A 3V32A 3OUTA 2QS9A 4HUJA 3BXXA 4NG4A 4NK4A 5IJZA 1J5PA 4DR3B 4N7BA 1BROA 1V47A 3PDCA 1RABA 1VLVA 4R9UC 1C3JA 1M8GA 4AROA 4YRFA 3PHGA 3RSQA 1EMDA 1F3OA 5LB2A 2BBOA 1TO2E 3HABA 2FZ4A 1EK1A 1A9TA 2J5BA 1OWPA 2K6GA 3HVHA 3SZGA 2WLTA 3H9JA 1TVKA 1UXJA 3AHHA 3LX6A 3QFSA 4N9WA 3E4CA 4ZOCA 5GONB 3RU3A 2UUOA 3LT5A 4F72A 1AXRA 1RBQA 3BXOA 1V1RB 1E77A 1MD9A 1LBIA 3BA6A 1UJ5A 4P5DA 4W9MC 4RESA 1H8HD 2E9SA 4ZU3A 4HQRA 1GL7A 2I6TA 1GCUA 3ECAA 3KAJA 4EYOA 2EU8A 5AYVA 2VEDA 1I01A 3FW1A 4YRQA 3RUIA 3AUKA 3C8DA 3ZOKA 2ZBEA 1DSSG 1A5TA 4RK4A 4P33A 1OH7A 1TOAA 2QD2A 1N77A 1UMBB 1RWPA 1LWOA 3RT9A 2EWVA 1W52X 4HH3C 2NYUA 4BLPA 4TLLB 1GD1O 4TLCA 3E9EA 1KK3A 4PTZA 3UWKA 2H3HA 1LPAB 4INJA 5DYIA 4WKCA 5EIBD 3B6ZA 5KSPA 5C4MA 4FQ5A 1F0YA 4RW0A 1E2KA 2EOAA 2ZTLA 1HG0A 2E3JA 3AEQB 3O4IA 2BHRA 3EODA 4YAFA 4ZVSA 1E7RA 5JAPA 2W83A 1G3MA 2RH4A 3A4NA 3DHEA 4MVCA 4PS0A 2X4LA 1DO8A 1J09A 1Z0IA 3TLKA 4FMDB 2YN2A 4NZNA 3WDLA 3WLQA 4CI9A 5HZHA 2M6SA 2C58A 4QQNA 1PYGA 3ESRA 4IX9A 3M81A 5K8LA 1PV4A 1ODCA 3N1UA 3WNQA 1NSTA 1XJQA 2VJLA 4DWJA 1F2UB 4TL8A 3VX3A 3ZN2A 1KO7A 1W581 4U7FA 3MUEA 3QY9A 2PEZA 2EGUA 4H9GA 5FIUA 1V1RA 4YP5A 3ZQ6A 4L57A 2CXNA 3RU9A 1EEXB 4QZVA 5DFAA 2YWHA 1H0RA 1JX6A 2XGSA 2NU9A 3LL7A 5JRZA 3OWOA 1E58A 5CW2A 3KZCA 3PX2A 3RH0A 1IRIA 5HFJA 5E7MA 4FFBA 3EPRA 2ZYUX 3EZ2A 2JIBA 3OFSA 4D8UA 4ENSA 2HEGA 5JCJD 2VQ3A 1N8TA 2AJ8A 3IMEA 3J80A 2RBEA 3BXPA 2KWIA 4X65B 2XMRA 5D5PA 4DFDA 1PBTA 4RTKA 3MMPA 4D42A 3T3IA 4WNAA 4JI8B 1RHJA 3WKEA 4Y0VA 4F7WA 1GSIA 3ROQA 2EQ5A 1M75A 2GD2A 3G2OA 3UHOA 3AEQA 1VXOA 3L1KA 1KDRA 4CMKA 1NV9A 4ZT5A 2XB4A 3UMBA 1A82A 1E18A 4GGPA 3HUDA 3WNZA 1XXHB 2ZOSA 2W93A 3D4PA 1L7OA 4DN6A 4EENA 2O19A 1JZQA 1K4MA 3PDUA 2HRDA 1KJZA 1BW9B 1F2UA 4JITA 5CNKA 2W2XA 3LVQE 1U9IC 1UJ2A 4QGAA 2IYUA 4RVGA 1ZZGA 3UKOA 3UV6A 4HNTA 5A7GA 4DWVA 1QWSA 1NMYA 4KI0A 1EA7A 2E89A 2F59A 3Q2OA 4P81A 5CP8A 3TW8B 1ACMA 1MO5A 2WHYA 3EXHB 5EXSA 5HFAA 1KYWA 4DY4A 5KWEA 1L5GB 3EHDA 1KAHA 3VPFA 4N39A 4V0ME 1ZD4A 1GSHA 3NIFB 4LG1A 4PZYA 1KJJA 5FNZA 1WXDA 5IVDA 3HJRA 4BB6A 7GPBA 2WM2A 4LYYA 1IHDA 4KTTE 1BD4A 2JCYA 3OJ0A 2XMZA 3OESA 4ZP1A 1J6UA 1VPTA 4ND2A 3HCRA 5DTQA 1SOWA 4Q1AA 1AY0A 1K75A 4MULA 3LVFO 2QDKA 1V3TA 3BKWA 2XB9A 3JZDA 5REQB 3DHNA 4DSZA 5EZQA 3MLAA 4FFMA 2QBYB 2GPYA 5A62A 3OUZA 5FLEX 4XX1A 4II7A 2NO9A 2DT8A 3TD6A 4GR5A 3RKSA 1DKUA 4RZ3A 3ZVRA 4EPVA 4I6GA 1FSFA 3Q12A 5AQ1A 3ZHTA 2ZCUA 5TIIA 1XXHA 3R5XA 5KHOC 3B3GA 1XMIA 4IIJF 5AJTA 5ALMA 1I80A 1UZLA 4ZGWA 3HM2A 5DLPA 2DJIA 3UCEA 1BW9A 2BLLA 1CUCA 4R7ZA 2R00C 2WW8A 4RS4A 5CA1A 3IDOA 1ZHFA 4R1SA 5D51S 4K87A 3D02A 4I3FA 4JB3A 2R8ZA 4JKIA 1SVIA 2PGAA 3T7CA 2QZSA 2O07A 1AG9A 1OU4A 1FTSA 3C41J 5KJEA 4Z3OA 3QBVA 5KU7A 3TW8A 1YT5A 4L51A 4EEXA 4YT4A 3EXHA 3U7GA 4H77A 1X15A 1YDHA 4I5EA 4NCJA 2ZE8A 4WA7A 4JLSA 3IALA 3M4NA 3CG0A 1L5WA 3I23A 2H17A 4NATA 2REQA 5JY1A 3UCFA 3HCFA 3G5UA 1KI4A 3DZJA 3O03A 3P52A 2A5GA 4UREA 5D2CA 3UV7A 4Z4GA 3JXEA 4Z2YA 5C0OE 1XVIA 2ZIFA 3KP1A 1LPBB 3MMNA 4MQLA 3KUKA 1CUFA 3PQ8A 5REQA 4OOFA 5ARBA 3VDMA 4EHKA 1T0UA 2QBYA 2HGZA 2XLBA 4IIJB 3UY4A 2G09A 2QTHA 4MVJI 4BNZA 2MINB 3TTTA 5C52B 5DLDA 3TRIA 4RPJA 2GN2A 2A35A 3LP5A 5FI5A 4AZ0A 4MLPA 3ETNA 4QDZA 1A9QA 3K8ZA 2E6KA 3NT4A 3LFTA 4TKUB 4JLAA 1BS9A 2J45A 3A4IA 3MOIA 4L0QA 4P08A 1UKCA 3GR6A 1P5HA 4ETNA 3T5AA 2XCTB 1MO4A 4CQNA 3TQCA 2JZOA 1XQYA 3LC2O 2FG7C 2IDMA 2V59A 4PONA 4JBLA 2PVCA 3PA6A 3GP5A 3S7TA 3W1VA 3W34A 3PQ4A 4XRRA 3MIZA 1Z0JA 2WLSA 3ZHQA 4RVFA 4B83A 2I3GA 4IILA 4JP8A 1CUHA 3LQ4A 3PUXA 5FDFA 3GA0A 3VU9B 4GICA 3M6IA 2IIVA 4LWOA 3L0SA 4WZ6A 2VSXA 2ZAGA 2FRVA 3EFOB 3UWDA 1Z17A 2I6UA 4IMJB 4RIHA 1ZICA 1T2DA 1TZCA 2J3QA 3CPSA 3FLMA 3IOCA 1KPGA 4LOAA 1GTG1 3D2CA 1EVKA 4NK5A 1V9CA 1UZAA 5KNBA 4I6JA 5JLJA 3KR9A 2HK7A 4HDRA 3HKCA 2WTAA 1DO0A 2BGKA 3QOYA 6ABPA 1Z2EA 3JSAA 2IXDA 2C94A 5TC4A 4DUZB 1TQ4A 4LF6B 1BOOA 9ABPA 1T1RA 4GZMA 4PC2A 2Q2WA 5ES4B 3C6KA 3ORRA 1UFQA 4IIJA 4D46A 4OA8A 1XO1A 2L0XA 1GT6A 4LSMA 5EJ9A 3HB5X 1WXGA 4KAAA 4BVAA 5I7EA 2MSCB 3S8MA 4ANFA 2WJ3A 2YDYA 3HVJA 3N7TA 1EVEA 5BN5A 4TKUA 5H16A 3TGLA 2FSPA 4LHYA 1ODSA 2ATVA 3ZCQA 1BAPA 5FYDA 5D85A 2D2IA 2IUFA 3ZNQA 4BU0A 2C92A 2V7QA 4HFNA 4S1VA 1YRBA 5BUSA 3WQQA 4EUEA 3KSUA 3J7AC 3QIAA 2YMMA 2QRQA 4UFOA 2VJKA 3PYLA 3P27A 4MW2A 1J7JA 5FF9A 2CV1A 2ALJA 2FW7A 3C4JA 1JR4A 4Y2RA 5DSTA 5EYPB 5J2UB 4AY4A 2C7QA 2VJBA 3AUJB 5DE3A 3O4JA 3QKUA 4PM4A 1D8TA 1U63A 2IZ6A 3TTXA 3MEQA 1KRHA 2XMSA 4MQEA 4RLSA 2HO5A 3PKJA 5EXPA 1W29A 4D98A 2R1ZA 3MHPA 4KE6A 3WLLA 1N32B 1B2RA 4AJHA 2QVYX 9LDBA 4I08A 1PZEA 1QK3A 3C16C 1NC1A 3JAWA 1YK1A 4TZ0A 1LTQA 1OWMA 5FTJA 2SHKA 3FZQA 4KQ9A 1G1MA 4QOGA 1BFDA 4ZCRA 4Y1FA 4Q02A 1KAEA 4I0WB 3IEUA 3NP7A 2CVOA 1YU9A 2ZT8A 3A0RB 1FS6A 1L8AA 2GVZC 3UO8B 1ZAKA 4ZDIA 2JGEA 5GIOE 1IYZA 2VNAA 5C3MA 1HT1E 4QUIA 2ZP1A 4MWBA 4RQAA 1F2TB 7MDHA 4HXGA 1RJGA 2K7ZA 2VAMA 3CO5A 3KOXA 4IO0A 1T4MA 5F51A 1WNFA 2OLJA 4BZXA 1FTQA 1BDIA 4DA0A 3FTPA 1LQTA 4MO2A 2ISQA 3G0OA 1TVEA 1KAQA 2V54A 4NSNA 3R9IA 5HIAA 1S89A 1BC5A 2Q21A 1XLUA 1H6BA 2E2WA 2XYVA 1S3IA 2EEZA 4LDZA 2HZ7A 1OI3A 2VHZA 3H11A 2F8SA 1TK2A 2GBIA 1JHQA 4H2DA 2ID7A 4BKOA 3UXEA 4BNDB 1RM3A 4AC9A 1NBME 2UUPA 3R7DA 3BE5A 3WIVA 5JTUA 3RADC 3JATA 5J5CA 3MJDA 1A27A 1TUGA 4P6VF 5JRDS 1VG8A 2FJUA 1Z13A 1DJPA 1CQWA 1ZG3A 4OLHA 3EIEA 3DTVD 2WM8A 4JEUA 4QNMA 5LNK6 3LLUA 1HH4A 1Z0UA 1UCFA 3NFRA 4TM8A 3SJBA 3ZEIA 1RQLA 3JASA 2Q5OA 4V2IA 1PW5A 3QG5A 2WY2D 4M7OA 1KHTA 3FIUA 5SICE 3ZE2B 5HJEA 2FMXA 3TSOA 2LUOA 2BEKA 4FYHA 2E82A 5HS4A 4I3GA 3IA7A 3VZDA 1DJMA 1NVFA 2IY8A 3AT1A 4U7GA 1H2BA 4Z9XA 2HA6A 2CV2A 4NBUA 4IYJA 4WZAA 5F2OA 2R1UA 2WJHA 3BCUA 4ITRC 3DAFA 4M7PA 4UVIA 1OFHA 2IV3A 5I4KA 3WAJA 5T7BA 3DBVO 3VKFA 1PUXA 4CV3A 1WUHS 1F2TA 3PNOA 4KWIA 2FETA 4OGFA 4PSVA 4IDHA 5D5HA 3GRFA 4YREA 1CWUA 4U2CA 2FHSA 3ZHRA 4Y9SA 3QKSA 4I5FA 1Z5WA 4JROA 3IA2A 1JBQA 1PJ2A 1ZOOA 4HVTA 2B9VA 2Q2NA 2PA3A 2JIOA 3WSWA 1NRWA 4PINA 4XYBA 1SXGA 4D1YA 4BNDA 3CJQA 1N0HA 3VH3A 3HZOA 4MUFA 4OHVA 3KXPA 3MLEA 3OCZA 3FFAA 3OZIA 4X00A 1DIOB 5IJ0A 2QG4A 4FCTA 2DLNA 3D7NA 2I66A 4IGAA 4Q9AA 3UAWA 4TX1A 7MHTA 1IQ0A 3PQCA 2DCMA 5LDGA 3ZLJA 1PJBA 2QJWA 3LHFA 4LWPA 3S70A 2HXSA 1C0KA 1XIVA 2NXJA 1MOZA 2Q5QA 3EXHC 3OJEA 4GWGA 2GX6A 1AJEA 2LE0A 4RZHA 4MRPA 3QVVA 1XZQA 2PDAA 3B7GA 2SBTA 3IEKA 3NFYA 3L7AA 1ITZA 4RHYA 3ANSA 4CMAA 2MR5A 1HNXB 3LKZA 3NKLA 1ENZA 1D4FA 1I2AA 1VE3A 4RZIA 4XEHA 2Y05A 1H65A 2VKQA 1DUVG 1RYNA 1VDZA 4IMPA 5A3SA 2EIHA 1VCNA 3KLNA 3CKYA 5DTJA 4JP5A 1AGRA 1XHLA 1W4CA 2Y0BA 2ZGVA 3HYNA 4CG3A 5C80A 1VBNA 4P36A 4E1VA 1RAIA 1UOPA 3CF2A 4UAJA 4KNVA 2WWWA 3QFHA 4LJRA 1MG0A 3WGOA 2Y0PA 1TQ8A 1WG8A 3FSGD 1AX9A 3MTEA 5DWDA 3IPAA 3A6FA 3RFUA 2C7PA 1K7SN 1Q2UA 2HHJA 3B3FA 3B6KA 3R44A 3K70B 2CXHA 2EJWA 2HEIA 1CEEA 4RMIA 2GMWA 5IK2A 4XB6B 3VTZA 3NRJA 4OKSA 1GAQA 1NMZA 3E3AA 3FLEA 4FI3F 2V7XA 4E6EA 2EKBA 4R2LA 1FY2A 2B92A 2DTXA 1NE2A 1E7QA 5L6MB 2HSDA 1GDHA 3QHQA 2B37A 2R7LA 1Z5GA 2ZM6B 3STXA 2I7TA 2GAIA 3VJKA 4TKVB 3J81A 1E3IA 1S01A 2EFDB 3UA4A 3AVQA 4ODIA 4OX9B 3TW4A 1BGWA 5A7FA 2C97A 3G82C 3TZQA 1OLSA 2GETA 1ZCBA 2ENWA 5JS1A 1G63A 2WM3A 2VTBB 4X54A 1E7YA 4HS4A 3IPLA 4MA5A 3U39A 4AP9A 2WG1A 3AI2A 2IEIA 3EA4A 1K4YA 1RQPA 3H86A 2AN4A 3M1LA 3GOQA 4HDOB 4HHEA 4BGIA 4E51A 1VSQA 2ACKA 5KNDH 4AF8A 4YCCA 1GGNA 2P90A 2XT0A 2L2QA 3IO5A 2ECPA 4WE3A 2P68A 1NVDA 3RVPA 4TXNA 5LQCA 1AKRA 1T5TA 3FVQA 4MJXA 5DNVA 1XAIA 3T9CA 2X77A 4O4LB 5ALIA 3U3OA 1N5JA 2HHAA 1AKVA 4RGVA 3U3RA 4F3RA 1MO6A 2EG5A 5C35A 1JH8A 4DV6B 2ET6A 2C3PA 4ZYZA 4NULA 4BY9E 4CIVA 1Q5PA 3I09A 3ZU2A 3CPEA 4ZV9A 1Y7HA 1MEJA 4TRJA 4WRRA 5HCUA 3LLMA 2O6HA 3K6SB 3BVPA 4BYMA 1CNMA 2KYRA 2L82A 1XZJA 2XJ4A 4LXGA 4YJFA 5EJ4A 2O8FB 3TCKA 2FFBA 1TM5E 3IEVA 2HQSA 1E5LA 2MYPA 5EPUA 4F4IA 3G85A 4TKVA 3PEWA 4MW7A 4Q00A 3W5JA 1EUQA 4JXZA 1WUJS 2PZGA 1UBTS 4Y9DA 3GK3A 5BQ5A 3PXAA 1NYTA 5JIBA 1M5TA 3BFPA 3KJQA 5JANA 3TQOA 1U99A 3RDPA 4GOLD 3ZD6A 3OKCA 1G5PA 1PNQA 3C1OA 5COAA 1W6RA 3TBKA 1BHSA 3KUXA 4JJEA 1JDUA 2D62A 3K5PA 4M1KA 2B69A 2P5TB 4RPIA 4UQPA 4B3JA 5JD5A 3OTHA 3FPGA 5AXAA 1XU4A 3NHSA 3NZEA 1ZYUA 3K0AB 4BUZA 1TC1A 2KI5A 3CPJB 2QUHA 2GN4A 1Q1NA 1V11B 1AS2A 1V37A 2GJSA 3TMAA 2XCSB 1N5IA 1VRVA 4I4TB 4NX2A 5DHAA 3TSAA 4DEYA 2EL7A 1JFFB 3B85A 3E3OA 5FWAA 4TV8F 1QMGA 1DKOA 1U2SA 2J6IA 3O47A 4XJTA 3L77A 3OF5A 1ZC3A 1AGXA 2DWPA 3P2YA 2YBDA 3I92A 4KSBA 1IY8A 3R1IA 3DMYA 5CT8A 4CTNA 2WZCA 4C5AA 2ZSIA 4ZVPA 1RVV1 4A16A 4G0XA 1GAWA 3DXZA 1MJ5A 3KZMA 3K6SA 3CLKA 1HETA 3EDMA 2ETVA 1A8PA 4IXDA 1FYVA 2WSMA 4OI0A 2O8FA 2PE5A 1S6YA 4H1TA 3GAAA 3IMKA 3FMFA 3LGSA 4ZRNA 1CNEA 2YRXA 5KYXB 3LBAA 1ECPA 3R41A 5CK4A 3SBDA 3KQTA 3NHMA 1V7CA 3PQEA 3R0VA 4GLLA 4QUAA 4MRMB 3UBTA 3T7EA 4YDSA 3W8NA 5BWNA 1JFTA 2CMHA 2Q5IA 1FFCA 1ZUWA 3QELA 3T94A 2IFTA 5EJMA 3HJTA 1ORHA 5T4HA 5IUNC 3O90A 3U19A 3PA8A 1EM8B 3PEYA 1I7DA 3IVRA 1ZD1A 2PN1A 2WFLB 3K0AA 4DR7B 3V34A 1BEUB 1WU8A 1UBGA 1WHSB 1B74A 2ZYSA 4XASA 5DXFA 1RJDA 4P83A 3L1VA 2YMPA 4A23A 4E94A 2FK8A 4HK4A 5C5DA 1QQTA 2LDXA 4K5QA 1T6XA 2KM1A 2IYYA 2N42A 3RUFA