4AJ1A

Rat ldha in complex with n-(2-(methylamino)-1,3-benzothiazol-6-yl) acetamide
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
330
structure length
327
Chain Sequence
ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 123
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4aj1A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4aj1A02
4Q3BA 4XJTA 1EE2A 3MJTA 4DBVO 3RUAA 3I52A 1VC2A 1GUFA 2D8AA 3QWIA 1LNQA 4H3VA 1P3DA 1IHXA 3Q1LA 5IZCA 1XR3A 1BXZA 1DC4A 2V6FA 2X9VA 1RYEA 3QP9A 4TZTA 2AHRA 5I7EA 4GGPA 3UCXA 3SC4A 1LSOA 2E4AA 1GCUA 1YDWA 2PGDA 4LW8A 2NUAA 4DPKA 1R37A 1M66A 2AQKA 2Q99A 4KTTE 2A35A 2JAPA 3QE3A 1XCBA 4WJZA 4WLVA 3H9EO 3GY0A 1C14A 1E7SA 5CPBA 1EMDA 1M6HA 2BF7A 4GWGA 3S2IA 2PH3A 1ZO8A 1KEWA 2I66A 4CM3A 3ZDFA 3OEYA 1XDWA 2OGUA 3EC7A 2O2SA 2ZTUA 1YOVA 3C7DB 5A9SB 2EP7A 4YJHA 5H81A 4IDGA 4INAA 3BHIA 1OOEA 2Q1SA 1U3VA 1HXHA 1UZNA 4WCFA 3UCEA 1EK6A 2Q49A 3QQPA 3ROMA 4P8RA 2DTXA 1YJQA 2XPCA 2UUOA 2ZTVA 1JAYA 3LQFA 3WYCA 3VZRA 4YJGB 1E0DA 3M2TA 1W73A 1GV0A 4ALJA 4BKRA 2ZQYA 4PGFA 2JKVA 2FRDA 1UXJA 1YDEA 1WZEA 4YT4A 1UH5A 4D46A 4GKVA 5CEEA 3ROPA 4HY3A 3DMYA 3VPSA 1ZSNA 1CERA 4LRSB 3I6IA 1I8TA 3GVIA 4K26A 5TSDA 4DRYA 1E5LA 1U3UA 1SO8A 1CQIA 1ONNA 4I9UA 2DC1A 5A9TA 2PZJA 1E7QA 2YHUA 2PH5A 3ZNNA 5A1TA 2J6IA 2VWGA 1X1EA 3NDIA 2NTNA 2QRJA 5IN5A 5K9ZA 3JQ8B 4ND5A 2EHDA 1RJWA 3EZYA 3P7MA 4QXMA 4JBHA 1SOWA 1WVGA 2IZ0A 4JBIA 3UXYA 4E0BA 3V8BA 2FPGA 1EQUA 3JQAA 4FPXA 2NTVA 1Q7GA 2VUUA 3GOHA 1LSUA 3NDRA 3DHNA 1TXGA 2Y1DA 1GEGA 1DB3A 3W8FA 4CR8A 4CLOA 4CMGA 4XR4A 1DLJA 2DAPA 4JN6B 2BFMA 1PEDA 1CF2O 3OJ0A 4ALIA 3DMTA 3OJLA 5KIAA 1E3LA 2VRBA 2VWHA 4NBWA 2PTGA 1HE2A 2R2GA 2PGLA 2VQ3A 1ENYA 4NBTA 1P1RA 3MWDB 3GNSA 2PKQP 4U8GA 5KKAA 1R6DA 2AA3A 5IXYA 1KVRA 4HFJA 1Y8QA 1RM3A 4XDYA 1ZK0A 3GZNA 1KC3A 4UUPA 3C24A 1JA9A 3P2OA 3PHGA 1HEUA 3WQSB 1UXIA 2ZB7A 4RQTA 4FW8A 5B4TA 4IJKA 4ND1A 1DRVA 3DAFA 5L53A 5I7FA 3H2SA 3DB2A 1LSSA 3LT4A 3DZGA 3PGJA 2DKNA 3JV7A 4NG5A 3RUHA 2ZB8A 4J1QA 3G1TA 1E7WA 2IEDA 5EESA 2YHIB 1CJCA 4DMMA 3QIVA 3RKUA 5FFFA 3L4BA 3GA0A 4BO8A 2B0JA 3RQSA 3TZHA 3L9XA 1FDUA 3VZQA 1F17A 3OA2A 1NP3A 3LC2O 3N74A 4UUMA 5JCJD 4W9NA 5TT1A 1XYGA 4L4SA 2EJWA 3BMNB 4UEKA 2O3TA 4E2WA 1C1DB 4IJWA 5G4KA 1RPNA 1V3TA 2ZATA 4IIVA 2GZ2A 4A73A 4CL8A 3G49A 3NEPX 4DQVA 1E1KA 4RJTA 3CZRA 1T1RA 3K2EA 4PG6A 4NR0A 5B1YA 2VTDA 3TZKA 3Q2KA 4I8XA 5A9RA 2XXJA 4D41A 4AJEA 3BTUA 4BQPA 3NT5A 1H9AA 1Q0HA 4A27A 5C7IO 2DBVO 5I8ZA 4M1QA 2GN8A 4RVGA 3WLEA 5DOZA 4YAGA 3W8DA 2IEBA 4ALNA 4B79A 3K8ZA 1BXGA 3MOGA 2CDCA 5KNLA 4I9NA 2NU8A 1J5PA 5F5LA 4GX0A 4TRJA 1I0ZA 3HADA 4BV8A 4Z0HO 3FN4A 1B8VA 2VNSA 1PGOA 5FI5A 3GMSA 2VRCA 5A4DA 4J7CA 3ZU3A 1VSVA 5GZ1A 2E48A 1B0AA 4HUJA 2DU8A 3QHAA 2V6BA 3HJAA 4XRGA 1VPDA 2YY7A 3RU9A 1EEHA 1IB6A 2V65A 4LGVA 2HU2A 3C1AA 4R9RA 4ND3A 3PRJA 1NVGA 1H94A 5F1KA 3VVBA 4A0SA 4CR6A 3A06A 2CMDA 3H6KA 4DGSA 1ISGA 4PLYA 4ONEA 3H9JA 3VZSA 3V5NA 3F47A 3HDHA 2VYND 4MP3A 2JCYA 4JJIA 4EW6A 3INGA 3DZJA 2EWMA 1U4SA 4QX6A 3SJUA 3FNFA 3G1UA 3ZGYA 1NTOA 4GVXA 1CIVA 1LLQA 5AXAA 5T8KA 2UUPA 1XWFA 5G4LA 3BHJA 2PR2A 4PVDA 3GFGA 2HK7A 1TT7A 2WE7A 4WLOA 3QSGA 2GN4A 4R1UA 4ALKA 3D1LA 2X6TA 3L4SO 4O1MA 4YR9A 2WWRA 1NX6A 4BMVA 5L4LA 3QV1A 5HA5A 1JWAB 4KQXA 3H8VA 5B12A 4ZQBA 1PJLA 3G17A 1C0LA 3PHJA 4D0RA 2Y0CA 4MVJA 3RUIA 4XX0A 4PZEA 3CEAA 4OKIA 1XHLA 4TQGA 5CPFA 1EQ2A 1DFHA 1F14A 3NKLA 3HDYA 4N5LA 1A4IA 3JQEA 4J9VA 3KEQA 2BI8A 4WNIA 4DC1A 1ZMOA 2X4GA 3ONFA 4Y98A 5CEFA 1DIHA 3IP3A 1DFGA 5C37A 2NU6A 2WM3A 5JBIA 1PL7A 1JU9A 3PPIA 3UW3A 1QXSA 2O7QA 3IKVA 1WW8A 2JD2A 2YDXA 1M2WA 1A9YA 1DJNA 3WJAA 5B4UA 5JMPA 4DPLA 3IP1A 2AXQA 1KC1A 3JQ7A 2ZKLA 1DO8A 5G0WA 2Z95A 4YB8A 5FYDA 5L95A 1MG5A 4IQ0A 4HNGA 3LK7A 2GDZA 3IJPA 4J4BA 1E1MA 3SXPA 1GDHA 2NU7A 2X5KO 2VHXA 1HF3A 1SPXA 4BIIA 4CR7A 1UXGA 1NQOA 3U9LA 4WLFA 1DXYA 1NYTA 1LDBA 1PU2A 1UP7A 2CVQA 5GMOA 3GRPA 4E32A 2W4QA 3CMMA 5B4VA 4PRLA 2HRZA 1QG6A 4YWJA 4YPOA 4EDFA 4ZICA 4YJHB 1V3VA 1SC6A 4RZHA 1U7HA 4YCAA 3TL3A 4BUCA 3I3OA 3ADPA 5TX7A 1HZZA 4QEDA 4FN4A 2WYUA 5TIIA 4PZCA 1NQ5A 4HNHA 4JIGA 2HMVA 4CM8A 1HYHA 1YB4A 3C85A 3MWEB 4Y67A 1IZ0A 3CKYA 3PQFA 1UAYA 2GCGA 4OQYA 1KIFA 4OYRA 3O8QB 4BNUA 1KY5A 5KVCA 1SCUA 1H6BA 2NV6A 4JK3A 4BNZA 2V7PA 5HS4A 1S7CA 3KSZO 2OP0A 1B8UA 4WUVA 3DC2A 1E3SA 2A4KA 3PQDA 3SEFA 3WDSA 3KV3O 3W4IA 5B37A 3TSCA 2I65A 2J3KA 4PZDA 2GO1A 4ZVVA 4J4TA 2ZB3A 1BG6A 3DHYA 3DTTA 3JTMA 1C3VA 3BMQA 5IXSA 2VWQA 1Q1NA 3HNPA 4FJ2A 3NUGA 1HKUA 3ITDA 4R68A 4PFJA 3JQAB 5AXDA 2R00A 1VRWA 3PYMA 1A9ZA 1EUCA 5BSGA 1JN0A 4YBZA 2QYTA 4ZU3A 1JDJA 1JLLA 3F4BA 4JGBA 2Y1CA 1ADBA 3AK4A 5U4QA 2CZCA 2ZYAA 4RVSA 3VVCA 4BHTA 4EUEA 3OIFA 2O7SA 4ZQGA 1OC2A 1EVIA 2DBZA 3AY7A 2WDZA 4A7PA 3JQBC 3DTYA 3PYXA 4UULA 3B1FA 2VZ0A 3GF4A 4TWRA 4CV2A 1U9JA 1KY4A 4FIZA 1BRMA 4D43A 2CF6A 4BB5A 1PJTA 2J3HA 1OC4A 4WASA 4XYBA 2RAFA 4FFPA 1HETA 1E77A 1EFKA 5GZ6A 3WYBA 3T4EA 1GAEO 2TMDA 3IMFA 3W4JA 1ZK3A 3GLQA 3JQAD 3M2PA 4J0FA 4ND4A 4XD2A 3E48A 5BR7A 4YT5A 3PP8A 4BNNA 4P38A 1U4OA 4HXYA 5ENVA 1MA0A 5JDCC 4FC6A 4JNKA 4KUGA 3AFMA 2Z1MA 4A10A 4CMIA 1E1NA 4LMRA 4EZBA 4CM4A 1PS8A 2J5QA 5JNLA 1H6CA 3TN7A 4URFA 1WMBA 2QRKA 4PLWA 1NNUA 1B14A 2GRAA 3ZWBA 7ADHA 4BKOA 1DRUA 4XQ9A 4N5MA 3OIDA 4PLCA 4ZGWA 4QO7A 4QFCA 2NLOA 3HB4X 3G0OA 1YQGA 4CMEC 3DHEA 4I9HA 3HDQA 4OXKA 3CUKA 1R4NA 3PWSA 3V2UA 1PJBA 1OZAA 1P1FA 1DRWA 3NRCA 2Y0EA 3KYDB 4FOSA 2G17A 2GN6A 1BWSA 3SLGA 1DC6A 2NVUB 2PKQO 4DUPA 2AE1A 1NPTO 3K96A 4I5GA 5KJFA 2ZJ0A 1MGOA 2BI7A 3GQVA 2XOXA 4GPD1 1WDMA 3I9LA 1VLLA 5DF1A 4XQEA 1OBFO 1MG0A 3WBBA 2EP5A 3L6OO 3I9NA 4Z0TA 3PDUA 4J1SA 3DBLA 2QZZA 3PQEA 1ZEJA 1HT0A 1Q7BA 3ICPA 2X22A 1L7DA 1BXGB 3LT0A 1DIRA 1D8AA 2PFGA 5EERA 5KKCA 4NJMA 5EQFA 4FFNA 1DEHA 3S2FA 3PJGA 1P74A 3PFFA 4RVDA 4UVHA 4DYVA 5F1OA 5L4SA 4PLGA 4R5HA 2DUUA 1B3BA 5COAA 3OP4A 4NU5A 1E6WA 3QVTA 2FZEA 3C7CB 1ZSVA 3IS3A 3PLNA 2CVOA 3LDHA 4MVJG 2EGHA 1PWXA 4D45A 1PR9A 3RC1A 5C7LO 1PGQA 3RU7A 5U9CA 4MIOA 1CDOA 3CPSA 2JFGA 1T25A 5A04A 3BMCA 4RPKA 5U1PA 4D44A 3AOEA 1BHSA 1N7HA 3H9GA 4F6CA 1FDTA 5ENDA 4ZHSA 1TT5B 4JBGA 4RVFA 4PN3A 2VT2A 1PQWA 1KETA 4YT2A 1X7HA 1LU9A 2OOSA 1QP8A 3TFQA 4KWHA 3WS7A 4W4TA 2H6EA 1R12A 1PJSA 3FPLA 4IGFA 5HM8A 3T7CA 2FPIA 3WGIA 3AWDA 3V1UA 1JQBA 1W4ZA 2VRCD 1QLHA 3ETEA 1U8XX 3CSDA 3I9MA 1F12A 1BGVA 1RWBA 5G0UA 1EZ4A 3U3XA 4AICA 5CG2A 1X7GA 3EVTA 3ENKA 1LC3A 1O9BA 4XKJA 3GRKA 2BD0A 2OBYA 3S55A 1I10A 3SC6A 4IY1A 2JCXA 3Q6IA 4G5HA 4MVJI 5TJ9A 3WTBA 1YE3A 3DFZA 1H93A 3L77A 4IGEA 2EKQA 3L0DA 5EQDA 4YAEA 2JHFA 4O0LA 4WCFC 2EG9A 3TZQA 3HG7A 1HZJA 4E12A 1R0KA 1IY8A 3LC1O 4W99A 3LZ6A 3DAGA 1Z75A 4BO3A 1YONA 4FSHA 5JS6A 4M86A 3PFWO 3V1YA 1GTMA 2GERA 4JJFA 4TSKA 2GLXA 2DM6A 2WYWA 4KQWA 2GNAA 5ILGA 4B7UA 4DVJA 2R6JA 5I9NA 2JFFA 3VTFA 4GAEA 4L4RA 3TDKA 4BS9A 1ULUA 5G0VA 3WSWA 1O95A 3JQGB 1FK8A 4FOOA 2PY6A 3GDGA 4CMBA 1M6WA 3DEYX 2O3SA 3D64A 3BTOA 1YBVA 2QQ5A 4WLEA 3TNLA 2P9GA 4E21A 2X0IA 4S3MA 4J16A 4NBVA 4XEHA 4ZQEA 4Z9XA 1SAYA 1AGNA 4PG7A 2AQIA 1QYVA 2ZYGA 5A06A 3IJRA 2Y1GA 2EV9A 3DAPA 3GGPA 5CDTA 3RROA 3COSA 4X54A 4BKQA 4PRKA 3VH4A 2BHLA 1X7DA 5CP8A 5IDWA 5F3RA 5F1PA 5JPIA 3JCZA 3PTZA 3BTVA 3Q3CA 5BNTA 4J0EA 5KJCA 2C5EA 4H16A 3ETGA 4CUZA 1U5CA 3ADOA 3OJEA 4BNWA 2DBQA 2FWMX 3NAQA 4I5FA 1PZFA 1ZSYA 2BGMA 4FB5A 3GPDG 2B36A 3DMTC 1TLTA 1KERA 1R0SA 1E3EA 4GMGA 3KVOA 1D3AA 4ZA2A 3JQFA 4LCJA 4TKLA 1P9LA 4L73A 4ALMA 1IZ9A 2OXIA 2VHWA 4E3ZA 4K6FA 1DSSG 4BGIA 1IHYA 5L7YA 2FN7A 2I9PA 2OO5A 2OHXA 2QHXA 5T67A 3JD0A 1GYPA 3ZWOA 2D5CA 3HFSA 3ZHXA 3QWAA 1D1SA 3N58A 4BNLA 2QYSA 2OZPA 3BMQB 3VH1A 3TZCA 3GAFA 3WBFA 1BTOA 4D79A 5DZSA 4IINA 4Y6SA 1EUDA 1XEAA 4Q39A 2B4RO 2G82A 4KUEA 4IUYA 3NGXA 1TB4A 4W9NC 1I2ZA 3ONEA 2VT3A 3ZI0A 1M67A 1ORRA 5TLSA 2EW2A 1U1IA 1V0JA 3WQQA 2DUWA 3JD1A 4XYGA 2H63A 3PLRA 4Y8VA 2X23A 1FDWA 3WB9A 4HBGA 4BO4A 1A72A 2WEKA 3DOOA 4XDZA 4QUKA 4MP8A 2GUGA 4OM8A 3RFTA 5KOIA 1W8DA 2WD7B 1HRDA 4IDBA 4CV0A 2OORA 5K6AA 2NQ8A 3HHPA 2EF1A 3OHSX 3WXBA 1ADFA 3W6ZA 1I24A 5L45A 4RF3A 3BYZA 3TRIA 3WWZA 5I9MA 4U6QA 4CMIB 4RCVA 1BVRA 1E6UA 1L7EA 2JL1A 3D3WA 4FFOA 5L51A 3I9KA 1IPEA 2QX7A 3UVEA 4L9RA 3NT2A 2RCYA 2ZTLA 1FJHA 3DDNA 1QYCA 5KWEA 3MJSA 1KOLA 4AJ2A 1P1JA 2PZMA 2BELA 5ADHA 3IOYA 4IMPA 1B7GO 3H9UA 4J9UE 3VZPA 5BSHA 1NFRA 2VHVA 1EUZA 2IZ1A 4RPLA 4HV4A 3WTCA 2C20A 5IAAA 2PV7A 1I32A 3CINA 2VHYA 3FRJA 3MJEA 3K2BA 3Q11A 3SX2A 1ZNQO 6LDHA 5IFLA 4MIYA 2NNLD 3ZU5A 5JYEA 3E18A 3R6DA 3BA1A 4IJVA 4GH5A 4L75A 4N18A 3S2EA 4R51A 4F6LA 3OFSA 2C54A 1FDVA 2EIHA 3EW7A 5COQA 3VKUA 4B3JA 5T8KC 4C4OA 3UF0A 2D0IA 1UDAA 4PLTA 4U0KA 2PLAA 1VI2A 3WICA 5TT0A 2PD4A 2IZZA 3NGLA 4NBUA 4E31A 1LSJA 2B69A 1U3TA 2Y1FA 1AN9A 3WJ7A 4FS3A 4U7WA 4IDFA 3LC7O 3NT4A 1E3WB 4M87A 4YAJA 4HADA 4H15A 2O3JA 5DT9A 4YVFA 1HE5A 4OL9A 1H9BA 3JYQA 4K28A 4FCCA 1XQ6A 3V2GA 2AG8A 2C7GA 3MEQA 1CRWG 1HTBA 1EE9A 4WKGA 1P1HA 4CLXA 1G6KA 1TA4A 3DZFA 2X0RA 3F6YA 3HN2A 3DZBA 4PVCA 1A7KA 2XF8A 3JQ9A 4JXKA 1Z7BA 5JCXA 4UUOA 4EEZA 1ZJZA 5I9LA 2AEJA 4Z6KA 3GK3A 1EVZA 4E30A 1SBYA 2CNBA 4BQRA 1DHRA 2AEFA 1DC5A 4WGGA 4QT0A 4R9SA 3BMCB 1B2LA 1SNYA 3AUSA 5JXWA 1X0VA 4J3FA 3RUCA 4CUKA 4ZD6A 4BGVA 4B4WA 1RYDA 2G76A 4AJOA 3CIFA 3PHHA 1A5ZA 1I2CA 5BNIA 4TKMA 4L76A 3ZWNA 5JAMA 4TRRA 1ADGA 1YKFA 1ZBQA 2VOJA 3B1JA 4RDIA 1PJ4A 2Q1TA 3WX0A 1XSEA 2XXBA 3VPFA 4PLZA 2YV3A 3L6DA 2A94A 5J23A 3RUEA 4L4XA 4CM1A 3LLSA 3X2FA 4RF5A 1E6EA 2JJYA 1QLJA 4NU6A 4WLUA 3OH8A 2I3GA 4XJSA 2AE2A 4GLLA 3H5RA 2I6TA 4WPGA 3X2EA 1XU7A 4PG4A 2WSBA 5C5IA 1K3TA 4GBJA 3WIDA 5JAIA 4KMSA 5L40A 3RASA 3BMOB 1KEVA 5EMHA 1Y5MA 2X86A 3I1JA 1M75A 1MP0A 3IUSA 5CG1A 2GASA 1MV8A 3ZV3A 4A03A 1MLDA 4FGSA 4WCDA 1YL7A 1CYDA 1B26A 1MB4A 1QKIA 1NWHA 1P45A 3E9QA 3WQRA 5BQFA 2B4QA 4E2YA 2HCTA 4J7XA 2R00C 3ANLA 3ZHZA 1WAMA 1AUPA 4R54A 3MJVA 4XGIA 3AJRA 1X1TA 2I76A 5LC1A 3CH6A 1Y5RA 1GQYA 2VYVA 2OL4A 1T2DA 3GN1A 5K0ZA 5L7WA 3TJRA 3GVXA 4A5OA 3DOJA 5JO9A 1N1GA 1BVUA 1NHWA 1MXHA 1NBOA 2IXBA 2NWQA 3ASUA 3KB6A 4RVUA 4IDAA 1ZK2A 4D7AA 4AJHA 3FWZA 4N54A 3PZRA 4PLHA 2D5AA 4CM9A 3ZW8A 3HE3A 3QWBA 3FNEA 1DIGA 2DPHA 4YRAA 3R0IA 3BIOA 2ZB4A 1AXEA 3KEOA 4PG8A 3KYCB 1T2AA 1HDZA 1N7GA 1VL8A 2C07A 4O6VA 1MC5A 4C7KA 1P1IA 4J2HA 5HRUA 2O4UX 4BNXA 1NFFA 3U4CA 1UDBA 4J90A 1T26A 4BKPA 4OOEA 4FDAA 1T24A 4MO2A 4NBRA 4GKBA 4BB6A 1JWBB 2FMUA 1U7TA 2Z5LA 1ZEMA 4FD3A 3SVTA 1XKQA 2RIRA 1A27A 2FR0A 1F8FA 3DFUA 5G0TA 3IUPA 3A1NA 3LYLA 3GPIA 3I9JA 3MCVA 5ILOA 4RLSA 3F1KA 5CDYA 1ISJA 4IM7A 2J3IA 1GZ6A 1ZMTA 1Z82A 2WJPA 1P1KA 3GNQA 1C0KA 1O8CA 3D4OA 1E3IA 3EDMA 4Q3DA 4DIBA 4NFSA 3LVFO 3PJEA 3C7AA 1HE3A 5H83A 4HP8A 1NWCA 1GD1O 2VN8A 1EBFA 4RQUA 5IF3A 5FI3A 3GAZA 1LTHR 1YL6A 3IKTA 2G1UA 4KZPA 1SB9A 4TMFA 4R5MA 1YOVB 2W90A 3AU8A 2FOIA 1U3WA 4AJLA 3R3JA 1CETA 4E5KA 3LF1A 4EGFA 2FSSA 4QSMA 5HTOA 1GQ2A 4MIEA 4WCFB 1GZ4A 3E82A 5BT9A 2CSUA 2RH4A 5CDSA 1E7MA 1GU7A 5T6BA 1JVBA 4R4JA 1C0PA 4J49A 4CLRA 3K5PA 4I08A 3TF5A 3HN7A 4YA6A 5KVVA 1VKNA 4R1SA 1MXFA 3RCBA 4J6FA 2Y1OA 3DOCA 3OQ6A 4GX2A 1EDOA 4NHEA 1MFZA 2D4AA 3RC9A 3QW2A 4RO0A 3RJ9A 3WMXA 1KYQA 4B4VA 1QR6A 2D2IA 3BTSA 4IXTA 2WYVA 3ZNQA 1WNTA 4EJMA 3INTA 3UOGA 3AOEC 3MZ0A 2X8LA 4L8VA 4J4HA 3E1KA 4BNVA 2NVWA 2P2SA 3I4FA 1JKFA 4YACA 2C7VA 1HLDA 3PI7A 4RLHA 4AJ1A 3FBGA 1RM0A 2DLDA 1B15A 3HQ4O 1KVUA 4QFDA 3B70A 4KDFA 4CLOB 3WR5A 5TF4A 2VUTA 1ZZEA 1I33A 4XR9A 5DULA 5A5FA 2DT5A 1WMAA 2X58A 3O26A 2DFVA 1NHGA 3GT0A 2X9NA 2YQ4A 3OICA 4G65A 1KBZA 5CDUA 1IE3A 1Z74A 3ABIA 2AEMA 4OOFA 2EERA 3SLKA 3IDSA 3TPCA 1KEUA 2QRLA 3EHEA 3WFIA 2EJVA 4TROA 1Y8QB 2HUNA 3E03A 3GZNB 2O50A 2BRUA 4BGEA 2NM0A 4B7XA 4YEDA 4G2NA 1AXGA 1C1XA 1E7YA 3GVHA 1ID1A 2HMTA 5TRTA 1VM6A 3HDJA 1I3NA 3U4IA 3O4RA 4IQGA 1PTJA 4ZQFA 3KLPX 4MVJP 1GY8A 5GZ3A 3QWFA 1QV6A 3WYEA 3NV9A 4IQ8A 2LDBA 3I6QA 2GF2A 4FJ1A 1N5DA 3PEFA 3O38A 3GUCA 2BLLA 1LC0A 4BO2A 2NVBA 3VAZA 1UXKA 2G0TA 1Z73A 3PVZA 5A9SA 1LLDA 3Q9UA 9LDBA 3PYLA 4NFYA 1U2GA 3WOHA 1IUKA 1QRRA 4O59O 4E4YA 1K0UA 1B8PA 2EEZA 3DONA 1Y8RA 4B8ZA 4KDEA 5BSFA 4OH1A 3WNVA 5G4KB 2SCUA 3GH3A 4DQXA 2UV8A 4AJ4A 2V6GA 1BW9A 4YJGA 3ORFA 3WGGA 2EW8A 1LDEA 1UZMA 4DPMA 1ISFA 3D0OA 3ASVA 3UCFA 4XYMA 2FSVA 4NDNE 5AVOA 1ADCA 3CE6A 3TOXA 1HDCA 1G0OA 4YYZA 3QY9A 4PCVA 5KCZA 1G1AA 3ICCA 4CM6A 4FR5A 2W98A 4M89A 4L0QA 1NPDA 3NYWA 4LVCA 1X0XA 3QJ5A 3FR8A 3ZU4A 4ALLA 1TVEA 2HDHA 3KLMX 1YVEI 3JQFC 3R3SA 2O48X 3JQ8A 3OQBA 3UICA 3KYBA 3LSYA 2HKIA 3P2YA 4OAQA 4WLNA 3RFVA 3RD5A 5KVQA 1T2CA 3WMWA 5JDIA 4DIFA 2YFQA 1XQ1A 3S2GA 2VCYA 1EDZA 4HFMA 4EJ0A 4F46A 3VOSA 2VZ8A 1IPFA 1DHTA 4XRRA 2V6MA 1SB8A 1BXKA 5IDYA 4BGUA 4M54A 3E5MA 1ONOA 1VSUA 2FY8A 2GZ3A 2EKPA 4OO3A 3C3XA 1QYDA 1H6AA 2FP4A 1AHHA 3B6ZA 1N9GA 5JCJA 1FDSA 1GPDG 4LRTB 4BL5A 3L9WA 1LQTA 4QQRA 1PZGA 5IZCC 1ENPA 4TVBA 4GWKA 4MKRA 4HFRA 4P4NA 4M55A 1R66A 1KVTA 2RHCA 2DFDA 1GUZA 3DBRA 5I8WA 4J7UA 1R4MA 3GC6A 9LDTA 4CUJA 4EITA 3RJ5A 3FWNA 5JSFA 1JTVA 3ZWYA 4XYLA 3DZKA 4DLBA 5HWSA 5JMWA 3DZHA 3H5NA 3RVDA 1J0XO 4YRDA 1EVJA 4NI5A 3EAGA 1UR5A 3JYPA 4TRNA 3NX4A 3GGOA 4KTVE 2VWPA 3NTQA 3EMKA 1UAGA 1T2EA 4EUFA 1IULA 3NJ8A 5K6AC 3BZUA 4RF2A 5ITWA 5L4NA 1PIWA 1XG5A 2P9EA 4QTZA 4O5OA 2J5KA 3CMCO 3JQDA 4CMCA 2IRWA 3MTJA 3M1LA 5CFZA 5A05A 4E2XA 1HDRA 5KTKA 3ST7A 1ISHA 1C1DA 4KP7A 1WZIA 1H6DA 4YJFA 4JROA 4CMKA 3G3EA 4J1NA 3KETA 1ZVMA 2DBRA 2YQ5A 5AXCA 1YQXA 3TZ6A 1ZJYA 3EYWA 3EY4A 1V6AA 4ID9A 4RDHA 3VH2A 3H3FA 3RBXA 4BO1A 1CEQA 3UGKA 3W4KA 3JQ7B 4CM9D 5EN4A 4ZN6A 3STHA 4BNKA 1WLYA 4YAIA 4ZRNA 2VYNA 4MVJD 4LSWA 2GD1O 4R3WA 4BNFA 4CM7A 3GEDA 1QORA 2Y68A 4UAGA 4AJIA 2F1KA 5AXBA 2YV1A 3KRTA 5EL0A 4OHUA 1QYXA 4MVJF 4PLPA 1JVSA 5TJHA 3Q2IA 3QLJA 1PJQA 1GQQA 1LBEA 1UUFA 3I83A 3WWYA 3HUDA 5DDIP 3VDRA 4AJPA 4BVAA 1DJQA 4CMEA 5KVSA 3INRA 4HKTA 4FGWA 3I5MA 1FXSA 5ICSA 1OMOA 2A9FA 5ER9A 1YJ8A 4CLRB 5JLAA 1PR3A 4Z3DA 4RV9A 3GEMA 4A26A 1GPJA 5H82A 4XB1A 4CM8B 4CV1A 2YJZA 3AI3A 2D3TA 3VDQA 4ILKA 4D0SA 1PS0A 2IYOA 3DBHA 1KVQA 2Y99A 3JQ9C 1FF9A 3DL2A 4LCEA 4NK5A 3RIHA 4YTEA 2CF5A 2EXXA 1F06A 3RKRA 3U62A 2HJRA 3QVWA 1EBUA 2WE8A 5JC1A 3JD3A 1NVMB 1SEVA 4AJKA 3K92A 1P77A 3DXFA 3RBVA 4CPDA 2Q2QA 3L4BC 5JC8A 4CQLA 2PWZA 4JP2A 3NDJA 3QVXA 2X7HA 3BHMA 3QRWA 2PD6A 1PZEA 3ZWWA 2DPGA 4XIJA 4CV3A 1RM5A 3I9OA 1V8BA 2GR9A 2EGGA 5JAQA 4RVHA 4Q3NA 1UXHA 4UREA 2UYYA 1DDOA 1ARZA 2Q3EA 3Q9NA 5ITVA 1YL5A 3JD4A 3KO8A 1M76A 4IPTA 5DBIA 8ADHA 2E49A 5IDQA 3QWHA 2H5LA 5EPOA 4I5EA 4IZHA 1UZLA 1I3LA 3GFBA 5T64A 1P31A 2W2LA 2Q2WA 4O63O 3S1LA 5EJ2A 1T1SA 1C1XB 3C1TA 2QZ9A 1XU9A 4RPJA 1V35A 4YJDA 1LRKA 1P0FA 3UFXA 4IDCA 3KHUA 2AQ8A 1ULSA 3OM9A 3H65A 3JSAA 3AFNA 1K5HA 3ZHBA 4Z0PA 3OECA 4ITUA 5JE8A 4CM4B 5IJZA 4RGBA 4Z3KA 1LDMA 1B16A 2NACA 3T4XA 4F3YA 2C29D 3DBVO 1JKIA 3AI2A 3AU9A 3ZWXA 3E6AA 5DN9A 3M6IA 1A4UA 4R16A 1R4NB 4GMFA 3K30A 5JW6A 3H4VA 3GVCA 3RFXA 1IL0A 5MGBA 4CLEA 1WWKA 1Y8RB 4NIMA 4DIOA 1Q0QA 1GUYA 1YO6A 1GFSA 2B83A 3UKOA 2Y0DA 4WOKA 4DQUA 1BW9B 1ML3A 2CUKA 3ZU2A 4DXHA 4DL9A 5FWNA 4BMNA 2RBEA 2F00A 4HFNA 3FTNA 4PIVA 3WSVA 1EVYA 1WXDA 3K73O 5HBRA 1E92A 3O8QA 1I01A 2BH9A 3H2ZA 4W82A 4CQMA 2O23A 4KUHA 2HAEA 3DBLB 3O03A 4EYEA 2DVMA 3CZMA 1ZFNA 4OXYA 1B3RA 2BGKA 2O3UA 4W7IA 4BV9A 5BSEA 4ZQHA 4BO7A 1NVTA 4IBOA 4J91A 2NSDA 1VL0A 4R3NA 3SJ7A 3ZWMA 4CLHA 3FD8A 1CWUA 4NJMB 2LDXA 5LCXA 1N2SA 3RC7A 1MX3A 2Q4EA 4BO9A 4MPDA 1YB1A 4J43A 4M49A 3B1KA 4ZJUA 4XWYA 1O5IA 2Q46A 2GGSA 1LDGA 3NJ4A 3WLFA 4EBFA 5T57A 5A03A 3H7AA 5FEUA 5DOVA 4LMPA 1DFIA 3F5QA 4F45A 3GN2A 1ZK1A 3TQHA 3ZNPA 3ITKA 3WGTA 3OQ1A 3HSKA 2UVDA 2TMGA 3FSRA 3LF2A 4WK6A 4HWKA 2C2YA 2ILTA 2CFCA 2VOEA 3DR3A 5KJEA 3HZZA 1PL8A 1X13A 3F46A 3ONDA 3VTZA 1H2BA 4NNJA 2Q1WA 2P68A 4NPCA 1N9GB 1N92A 4NFHA 1AE1A 2VZ9A 5G0SA 4PG5A 3GDFA 1HDGO 3E8XA 1T4DA 1U8FO 2O3RA 2POQX 3PDJA 4B4UA 3BAZA 3DBRB 3PWKA 1MUUA 2HJSA 1R4MB 1QMGA 1NASA 4Q9NA 4RZIA 1T2FA 3NTRA 4IMRA 3JQ6A 3OETA 1TEHA 1PQUA 2JFHA 3LU1A 1LLUA 4YXFA 4MOWA 1VE9A 3PIDA 3MOIA 3F5SA 4DMLA 4DTIA 2AG5A 3OA0A 4JQCA 3ON5A 1GL3A 3ZWPA 1OFGA 2P91A 4E33A 1PGNA 4U6SA 3R1IA 1DOHA 3FHLA 4MDHA 4XQCA 2DQ4A 2OMEA 2PD3A 2PKRA 2Y05A 2DTEA 4XIYA 4YDRA 3ZH2A 5KJ6A 1E3JA 1O0SA 1MC4A 4B3IA 3PXXA 3D5TA 2X5JO 3KYDA 4E5PA 4YJFB 1Z7EA 1HWYA 2Z1NA 2C59A 4UEOA 2NVUA 1QV7A 4HX5A 3DQPA 4DLAA 1GV1A 5I7SA 1DBVO 2I99A 5TC4A 4AL4A 5FF9A 5C7OO 4NH4A 2PK3A 3D4PA 3DO5A 3OMLA 3E9NA 1S6YA 4E6PA 2B4TO 4BNTA 3AW9A 1LRLA 3SBOA 1XELA 5THQA 2PZLA 2GN9A 3U4HA 3H3JA 1LI4A 2A92A 3AM4A 1ISIA 4LK3A 5IN4A 4DBZA 4NJOA 5DP2A 1PWZA 2HQ1A 1Q7CA 2AQHA 1JW9B 3AUUA 1EFLA 4KWIA 1WPQA 2PGJA 2CY0A 1Y9AA 3ZV4A 4EEXA 1ZXLA 1J6UA 3C8MA 3FPCA 4YQYA 5LDGA 1O94A 2CVZA 1HL3A 5A5EA 4WOJA 1E1LA 4P4GA 1DIAA 3ZWVA 3ANNA 4N7RA 2G5CA 3ANMA 4OSPA 5AYVA 4UVEA 4GSKA 4M8SA 3E9MA 1NFQA 2VTEA 3EZLA 5C3MA 1VL6A 4BO6A 3JD2A 4AJNA 5A3JA 3EVNA 2GYYA 2C0CA 4RPGA 4GGOA 4WNCA 3GUYA 1NPYA 2E82A 3NTOA 4R1TA 3WIEA 1R16A 4BNMA 1YRLA 3KSDO 4UUNA 3N7UA 1NQTA 1TT5A 3KXDA 3FTPA 3DBHB 1LLCA 5F5NA 5JO0A 4DYDA 4YRBA 1G0NA 3BXXA 3A14A 1LDNA 1WDLA 2P4QA 3GG2A 1RM4A 5BNFA 3KOUA 1GCOA 1XLTA 3ZZNA 1K6JA 3VPXA 2X9GA 4IDEA 3RSHA 4BNYA 4W7HA 2AW5A 3ZHYA 1P0CA 1E5QA 4C7JA 4XGNA 3ZWAA 2NU9A 1YS4A 4D3SA 2E37A 3KUXA 4J1TA 3RI3A 4CQLB 1Y81A 4WE3A 1YQDA 3PJDA 4BO5A 3QVSA 2C5AA 1JKJA 1K6IA 2GSDA 3U4DA 3U5TA 4P4LA 2EKLA 4IS2A 4Y9DA 2HMSA 1YWGO 1CQJA 4GSLA 1LRJA 1V9LA 1Y6JA 4MKZA 2YV2A 3FI9A 1H0KA 1IYZA 2GPTA 4W6ZA 1SZJG 3IL2A 4IXWA 1ZKMA 1D1TA 1X14A 3OIGA 3U0BA 4Q3AA 1VKOA 5DCUA 4JP3A 3K6JA 3GR6A 4I1IA 3VHRA 3JQGA 2D1YA 3EUWA 4GVLA 8LDHA 5DBGA 3PHIA 1I2BA 4MVJE 2W2KA 4RL6A 3JQCA 4FJ0A 2NADA 4RPHA 4FFLA 4AG3A 6ADHA 4MKXA 2CDAA 2QIOA 3PHLA 4R1NA 3WGZA 4E5YA 2X0JA 4ROSA 2BFPA 1GEEA 1JAXA 2RHRA 1LUAA 3LT2A 5HS6A 5IDXA 5JDIC 3D3WB 4CM5A 2J3JA 5DBFA 5MDHA 2BKAA 1I5RA 3L07A 3W6UA 2WMDA 3W1VA 3OBBA 3LLVA 5TGDA 3VC7A 1WP4A 3FBTA 1XGKA 4MVJH 4FC7A 2BFOA 1D7OA 3O9ZA 4OQZA 1HSOA 4MP6A 4EUHA 3GGGA 3IQDB 5L9AA 5DCYA 4NK4A 1DAPA 3QA9A 4H7PA 4OGWA 4UVIA 4XCVA 4Y6PA 3FNHA 1I3MA 2OBNA 3VKVA 1FMCA 5JY6A 4DA9A 1PJ3A 2B5WA 1GZ3A 1ZXBA 4BMSA 1KVSA 1ZCJA 1DIBA 4R41A 2W2LD 1BDBA 4KOAA 2ZK7A 4UEJA 2B5VA 1A71A 2ZCVA 1Q2XA 4IS3A 1DPGA 1YB5A 4WECA 1DAOA 1W0CA 3D5QA 4GX1A 1H2HA 1LA2A 1ONPA 3GHHA 4LSMA 4E2ZA 2B35A 5EIOA 1RKXA 1K2WA 3KZVA 4CQMB 1U2DA 2CD9A 3Q0EA 3AOGA 4NQZA 3KTDA 3QVOA 1R0LA 1J4AA 1DLIA 2HMUA 3WGQA 3RWBA 2O2YA 2P5YA 3PK0A 5JAZA 4AFNA 2VHZA 3GEGA 2IE0A 4D3FA 2J8ZA 1YXMA 3CXRA 1UP4A 3ZV6A 4OKNA 3EK2A 5AOVA 4AVYA 4K1LA 2OFPA 4DC0A 3EGOA 3FNGA 3KBOA 4FBGA 4CMJA 4UVGA 1K89A 2JHGA 3PJFA 5ICMA 1YBAA 4BKUA 4XGKA 5F21A 4E13A 3FF4A 4EJ6A 1UJMA 2W8ZA 3G79A 4XZ3A 3F9IA 2VUSA 3KM0A 4U0JA 4CLDA 1Z6ZA 2FZWA 3ULKA 5DCWA 4Q3EA 2DTDA 1PJ2A 3OJFA 3UN1A 5A02A 2J5RA 4II2A 4CQMD 3TFOA 2H9IA 4S1VA 4UVDA 4A2CA 3AY3A 3GZ4A 3F4LA 1ISMA 2HK8A 3B20A 4YT8A 4ESOA 3MJCA 1PZHA 2ZTMA 3AUTA 1PSDA 4PLFA 2UAGA 1WDKA 2YYYA 3TWOA 1YBMA 3T7EA 3I23A 2XAAA 3RUFA 1J49A 4L74A 4GX5A 4OMUA 2WD7A 3TL2A 5LDHA 2Q1UA 3UHAA 3K31A 2I3AA 4WEQA 2HMWA 1W6UA 4J2OA 1PJCA 1PQPA 3AM3A 4CL3A 1PL6A 4XQGA 2FHSA 1DC3A 3DWFA 1U28A 3DZIA 4B4OA 1D4FA 5ES3A 1HSZA 3F3SA 4LN1A 1BMDA 1Y9EA 2ZCUA 2BFAA 1OI7A 4GLOA 2B37A 2Y66A 5JYDA 3P5SA 3UUWA 5TNXA 1X15A 3AY6A 3K9QO 2QW8A 4YQZA 3H9QA 3MTGA 1NAHA 4OXNA 4ZRMA 1PX0A 3H5AA 4D42A 5CAEA 1AHIA 5AQ1A 2I67A 2D59A 2AMFA 2NTJA 4DWVA 1PS9A 1Q0LA 4CODB 1SEPA 2FPPA 1Y1PA 1E7RA 1V3UA 3W8EA 4FQ8A 5KJ1A 3OJOA 2I5PO 4BNHA 3JYOA 3PZBA 1P33A 2HO5A 3V2HA 3V1TC 1BSVA 2QG4A 2C82A 3PWZA 3M1AA 4CMHA 1L1FA 1OAAA 4GQAA 3WG9A 3WGYA 2Y93A 1SOVA 1R15A 2P4HX 5L3ZA 5T5QA 5GY7A 2ET6A 1HDYA 4YAKA 1LDYA 2IODA 4QECA 3ZNOA 2OUIA 4QO8A 4TZKA 1GADO 5G2OA 4CMAA 2HSDA 2FR1A 1ZH8A 5CDGA 1XIVA 3ROQA 1F0YA 1E3WA 2Q50A 3ETDA 3WGHA 1UP6A 2IDZA 2JD1A 3JYLA 2IXAA 3P19A 2OP1A 1NR1A 2E6UX 5CEJA 4JX8A 3OEWA 3AUAA 4Y6RA 1N8KA 3D3EA 1TI7A 1QYWA 2H1SA 4NZ9A 5TQVA 3WGOA 4GL4A 3UH1A 1LQUA 4E5NA 2Y67A 5A3VA 4IJUA 1HLPA 1C0IA 2BGLA 4NMHA 2YUTA 2O4CA 2JCVA 4XB2A 1VJ1A 4OSOA 4RORA 4R01A 5EINA 1LEHA 4N5NA 3RC2A 7MDHA 1P44A 2UDPA 1N1EA 2IYPA 5ER6A 2X1HA 4G81A 3LT1A 5JY1A 4D3DA 1HDXA 4GI2A 1GYQA 3GG9A 1K6XA 3A9WA 2YHIA 3FCOA 2Q4BA 1IOLA 1I36A 4R69A 1PGPA 1NR7A 3C1OA 4P22A 3PGXA 4OJNA 3KSUA 4XYEA 3D7LA 1NXQA 5L7TA 4TRMA 3PIIA 4BNJA 2RH8A 4B3HA 4CJXA 2HRBA 1I30A 3BMNA 1ENZA 1QSGA 2PA3A 3ENNA 1HE4A 3S8MA 3TOZA 5IZ4A 1NQAO 4BNIA 3ZWCA 2YDYA 2VYVD 2HK9A 1GYRA 2YZ7A 3RAJA 2O3QA 4Z9FA 2PZKA 3JQBA 5DP1A 5IG2A 2ZQZA 2P9CA 3FR7A 4JLWA 2WD8A 3VPGA 3HFGA 1HYEA 4B7CA 2JD0A 3CTMA 1UDCA 3A28A 1MFPA 2Q2VA 4EI2A 4PLVA 1XA0A 1NM5A 3GMDA 5DNAA 3WFJA 5THKA 1LJ8A 3JYNA 2NQTA 5TS3A 2VNAA 4LVUA 4WEOA 2ZYDA 4K9DA 1LXCA 4Q3CA 3RUDA 4IIUA 4Z9YA 3F1LA 2YFHA 5JDCA 2CDBA 3U49A 3ZCXA 2PNFA 1EK5A 4LISA 3RBZA 3IIEA 4MINA 3A4VA 3GNTA 1NAIA 3BMOA 4ND2A 3AM5A 5COBA 2W2KB 3ROKA 3VPHA 2ZJ1A 2Y1EA 1BDMA 2FR8A 4FFRA 5JFOA 4JCOA 2BMAA 4IZIA 3U09A 1PGJA 2JAHA 3MJ4A 4E5MA 4K6CA 3UAGA 5I7VA 1KS9A 2P5UA 3GVPA 1O89A 1H5QA 1Z45A 3ZV5A 1LX6A 1VJTA 4TVOA 4BOYA 1VJ0A 5CHEA 3ZW9A 4BNGA 1ZW1A 3I4CA 1U5AA 1KEPA 3IAHA 3HWRA 1GR0A 4JJGA 2WTBA 4U5QA 4DREA 4DLLA 2C2XA 3GDOA 1A7AA 2ZIZA 1O6ZA 2X5OA 2HLPA 1Y7TA 3OSUA 4B8WA 1ZUD1 1T4BA 3HB5X 3ZN2A 1SMKA 4II3A 1HYGA 4AJJA 2YW9A 1YGYA 3D4NA 4I5DA 1ENOA 3E5RA 3KYCA 4IDDA 2X0NA 4OIMA 1HDOA 3L6EA 1ZK4A 4FFMA 2Q45A 1F8GA 4BO0A 1YH3A 1I3KA 1ZIDA 3AI1A 4MVJM 3IC5A 4MJLA 3VH3A 4RF4A 3GHYA 3WNQA 4XA8A 2GZ1A 3OF2A
chains in the Genus database with same CATH superfamily
2IEIA 3DL0A 4US1R 3BGDA 3WK8A 5JI3E 4M4SA 4JJKA 2R6DA 2ORVA 1VC2A 5ALSA 1XVVA 1NBME 4KO8A 4H3VA 2UYOA 3AB3A 3ZDXB 1P3DA 2PIDA 1ORVA 4Q18A 1DAKA 5IZCA 2X9VA 3QP9A 1DC4A 5FO0A 1DKMA 1IWPB 2H1FA 4BU1A 4OCZA 3W2GA 2QN8A 1JVNA 3DUWA 4NENB 5E8RA 1Z88A 2O8FB 2EFEB 2VUHB 1XNQB 1G20E 4BLUA 1DPFA 3HSSA 5LWHA 1SVKA 4JJEA 1AOXA 1M66A 5HIKA 2ZULA 3AVTA 2Q99A 4LNHA 2A35A 2I2DA 4D8YA 1Q1GA 5CT5A 1JA1A 1G6Q1 4PHFA 5KX5A 2MDTA 1TPZA 1C14A 1E7SA 4HN9A 4N7JA 1EMDA 5CPBA 2JANA 2BF7A 1UDRA 2FPSA 5LL6P 2OMKA 1XTBA 5HIMA 3GMIA 1JHVA 3QXJA 1ZO8A 2VJBA 2P5SA 3A1FA 4HTFB 4RCYA 4BQSA 3CTPA 4C76A 2A0YA 5KCMA 5EJAA 5CLJA 2ZYSA 2OGUA 3NC1C 3C7DB 4JEMA 3AKYA 1C30A 1TFUA 5H81A 2P0YA 1R6XA 4R2JA 3EZ6A 4C0WA 3BHIA 2Q1SA 2AKEA 4L3OA 1E1YA 1UZNA 4DDTA 2BEUB 1V4BA 3E4DA 1EK6A 3ROMA 1Q1BA 1C4WA 4BX2A 3WHPA 1D0VA 4WZAA 4OK5A 5T4EA 1IUPA 5FWXB 2XPCA 3B9BA 2UUOA 5KNBD 5E4JA 1KHTA 1R9JA 5LU9A 2OXRA 3BQ9A 2GAOA 4RABA 4MEBA 3LRPA 1U94A 4YJGB 3IQIX 1E0DA 4X44A 4LX0A 3AR6A 4Y1GA 3GT4A 4NOJA 5K3SA 1KKUA 2NTEA 4AZVA 5KTYA 1COWD 2VJNA 5K20A 2HW8A 3EGVA 2DHQA 2MOKA 3VPSA 1NW6A 1DBSA 5EE1A 1CERA 4DA7A 5IABA 1I8TA 2PSFA 2G5TA 3HKCA 5TSDA 3VHLB 4JV5B 3CF2A 1O57A 5BSRA 4DRYA 1EGHA 5LIRA 3KZNA 3TIFA 1U3UA 4IQFA 2IZ7A 3CLUD 5C46F 4I9UA 3C14C 2REQA 1NURA 2I4MA 3ZNNA 3OOJA 3PFIA 2J6IA 3ROFA 1XRQA 3KHSA 3WNBA 2C96A 2NTNA 1DQPA 3NDIA 5K9ZA 1QPGA 2AFIA 2EHDA 3EZYA 5JJKA 2WIBA 2IZ0A 4QBIA 3RYCA 3C5EA 1I4LD 3GLHB 2VUUA 4K9RA 4DJJA 2PO7A 3IRUA 2QY9A 3VNVA 1EK2A 2D0DA 3I3SR 1EESA 1C8VB 4UNQA 3A6PC 1E9RA 1XLTC 1QJ4A 1UL1X 1K7FB 3JRXA 5GJBA 1NGSA 3DR5A 2J87A 3UHFA 1F9EA 4MAMA 2HR1A 1PVVA 4JN6B 2YZNA 4NV0A 4ALIA 4HUTA 1ODCA 4MS4A 5KIAA 2UXDB 1E3LA 2VWHA 1JQKA 5AK4A 3W34A 4UC0A 3D8RA 1XWIA 1BS2A 2RHLA 1JFVA 1HE2A 4AZ3A 4C0KA 2PGLA 4ZEVA 3HACA 1SUIA 4XWAA 4RLFA 3BRQA 3K1TA 5KKAA 1NRXA 1KVRA 5DO9A 4HFJA 1XDBA 1Y4DE 2Z2JA 3ICWA 5FWAA 1W0KA 4UUPA 4Z4CA 5KO2A 2JJ1A 3P2OA 3WGVA 3UGTA 1XCPA 2AL7A 1MDFA 1XKTA 3A6ZA 4X6UA 1B76A 3EE6A 4FW8A 3K1YA 3WISA 2LD4A 4RTOA 4AZ0A 2BZ1A 3ZXYA 1P80A 4ND1A 1QHHA 3BFKA 3QUSA 1Y8ZA 1EFRD 2QAGC 2VHEA 1LSSA 1J90A 2QUZA 2X2PA 2G08A 3D31A 3DZGA 3LT4A 3PGJA 3A3YA 4EBBA 3UKJA 1GZ5A 3A26A 3W0LB 1T5OA 2O20A 5K8TA 3TQOA 2IEDA 1GTSA 1OPXA 1QANA 1TCVA 4D4GA 3UAVA 5KYWA 4M1WA 2IYXA 4H4CA 4Y2VA 3L4BA 1F1JA 4IIJF 4IIYA 4L78A 3CLVA 3GA0A 3ABOB 5FFFA 4HYEA 5CVVA 3RQSA 3TE6A 4B75A 4BVKA 1FDUA 3SDSA 1F17A 2Q1XA 4JLAA 3FPEA 3MK31 2WJIA 4P33A 1XEXA 3ZVKA 4K6OA 3LC2O 3N74A 4JAVC 1ZGAA 4UUMA 1J2YA 1USGA 4CT4B 4TLLB 5SYMA 2CHUA 4YK7A 4E09A 2VXYA 4L4SA 2EJWA 1YB7A 1XYVA 3BMNB 1YC2A 1FP4A 1L7MA 1S2GA 2O3TA 4QBKA 4ZPJA 3TMYA 4E5UA 3M5CA 5LR6A 1W1IA 3I2GA 5G4KA 2QLLA 3FOAA 4OA5A 4OXRA 1K8XB 5CRIA 2UU9B 2QN7A 2MSEB 3HYCA 3LQ1A 4DLVA 1RACA 4BFYA 2HJVA 1T1RA 2BR5A 3F3MA 4OYLA 4TLCA 3SN6A 2C1EA 2L42A 2OXEA 3G8BA 5A9RA 2XXJA 3DOIA 3BTUA 5AKGA 3MTBA 1H9AA 3NT5A 1Q0HA 2QN2A 3UKDA 4BWYA 4D3XA 2YWFA 3E22B 1YE5A 2JAWA 1H2YA 1VL2A 3GI1A 1DBRA 2O07A 2W0SA 5CU7A 3WLEA 1RRPA 5DYIA 1QO7A 2GEVA 2OBFA 4I1SA 1JDSA 3FMGA 1QHXA 4B79A 2B4KA 4PSDA 3K8ZA 2XIJA 2D5BA 2WLTA 3D8TA 3ECSA 4I9NA 1TA9A 2NU8A 2XYQA 4MUHA 1E4EA 3IT1A 3OM0A 3UJ7A 4LDRA 2QL7A 4AURA 3W5UA 3AVUA 1ESEA 3CJTA 4Z0HO 3URMA 1PGOA 4NHOA 5FI5A 4C29A 1XMVA 2HA5A 1P8JA 5FOQA 1R9NA 1JEOA 4LSZA 1FYFA 1VSVA 2E48A 3ET4A 1HE1C 1B0AA 1Q1ZA 3O8CA 3S2YA 2V6BA 4XRGA 1ELOA 1PNQA 1VPDA 421PA 4TS9A 3OWXA 4A8JC 1QTRA 5C8ZA 5JATA 2O8BB 4ND3A 4U7HA 4A0SA 1H94A 4NEHB 4AYXA 4KOEC 3A06A 5K8CA 2I8CA 5J2UF 4DGSA 3LJKA 1ISGA 4UU1A 3LUCA 4AW9A 3H9JA 2F55A 1EP3B 4M21A 2XEDA 3UTDA 3V5NA 3VZSA 2CNWA 2ZRKA 3AX6A 5LA6B 3LUPA 1KJIA 4EW6A 1MMFB 1ZCZA 1QGDA 1KKLA 2XDYA 2ZOSA 1IEWA 1UDXA 2GN0A 3DZJA 3LQ2A 3P9QA 4K1XA 3G1UA 4KMMA 4N40A 1NTOA 1NI4A 3O9VA 1CIVA 2QJWA 2QTWB 2VDRB 2ZBPA 4MYRA 1LLQA 1OYYA 4RSRA 4MGYR 5HQJA 4IHJB 1FUYB 2UUPA 5T8KA 1XTZA 2E7ZA 2BLNA 3BHJA 4FBLA 4PVDA 3J81k 1NT2A 4AYWA 2ORED 2WE7A 2XLCA 5AHXA 1JBEA 3SQOA 4YPVA 1E2MA 3M33A 4AP6A 4KE7A 3BSSA 4AQYB 2DPMA 2GKOA 3UFBA 4RK7A 3ZDEA 2QV7A 1JT9A 3S3TA 1D6SA 3MILA 2JGDB 3TECE 2G80A 3TRFA 1MO4A 4ZQBA 3WNZA 4CIWA 5ULLA 4D0RA 2Q7OE 2A88A 3DDZX 4YRFA 4Z8YA 1E18A 3HZHA 2P2LA 1H8HD 1N77A 4PZEA 2VNKA 3CSUA 5BOVA 1SUEA 1USVA 4KBGA 1U2GC 2CXOA 2XNDD 3HVIA 4N5LA 4WNIA 4OM7A 4GRIA 3ONFA 4BXOA 1J8FA 3HVJA 4DLKA 4IG9A 4EI9A 1I1QB 1DIHA 4KIWA 1FRZA 2P9ZA 2R44A 3IP3A 3BRCA 1XX6A 3QEKA 1BX1A 1OB2A 1G1MA 4Y1RA 1O96A 3UENA 5T3YA 3PPIA 3G5UA 2IHYA 3UW3A 1AKVA 1T8TA 3WYFA 1J9ZA 1UOPA 5JS7A 2YDXA 1IPHA 1M2WA 1Q50A 4Z7JA 5AVTA 1A9YA 3WJAA 2N3ZA 4N9WA 3NEJA 5B4UA 5JMPA 2V59A 1ZWKA 4TQ9A 1FRNA 2BFEA 2H08A 2AXQA 2B6HA 1VLZA 1KC1A 3EBPA 1M1YE 3GJZA 3NBFA 4PS1A 4GNRA 2ZKLA 1KJJA 2KWIA 3F8SA 5GJCA 3O6VA 1RIFA 4UBMA 2O54A 1YDHA 4YB8A 1W1UA 4X90A 2WPDD 5B6PA 3LK7A 2F1JA 3PT9A 3SXPA 2C92A 3ZCUA 3CNEA 5TE9A 3UB2A 3M0EA 3WDKA 4ACAA 5A4FS 2B9VA 2CL7X 1JE0A 2NU7A 2X5KO 3NWBA 3EH2A 4JWKA 1KSGA 5ELMA 5JTUA 1GL7A 1P4JA 4U5XA 1MHPA 3IOEA 2Q5QA 3GUUA 2E85A 1LS1A 1WV1A 3WNDA 1WHSB 3HYLA 1LDBA 4NJEB 2CVQA 3CW9A 1HL7A 2EWVA 4NYJQ 5GMOA 4EHAA 4F21A 5BR8B 2ERYA 1F2VA 2W5UA 1RYZA 3P9YA 5CBPB 4FYKA 4JS0A 4EDFA 5E38A 1WF3A 4YJHB 4LQCA 5KQLA 1LCIA 2BBSA 1JDVA 3WMFA 2R4UA 4YRSA 4Y2PA 5LYJF 4MV9A 2W48A 4ER6A 3OY2A 5HNKA 2X42A 2QUIA 3AEXA 1VA4A 1W29A 1J1IA 3FHJA 5TX7A 2PLRA 2YVKA 1HZZA 2J0VA 2H5EA 3CX8A 3L46A 4O2BF 1NQ5A 4G8DA 1DEAA 4FMBB 3C85A 3DEFA 3MWEB 4LF9B 3V7UA 4D6PA 3C5CA 3UG7A 1NT4A 3LXUX 5LB4A 1UAYA 3T7TA 1D2NA 2GCGA 1KIFA 3D6AA 1ST2A 3HJGA 1E2IA 4N49A 4OYRA 4RK6A 4BDSA 2NT4A 3ADKA 3KOYA 1KDRA 1SCUA 1FZQA 1G41A 2NV6A 1T8YA 4GBED 3KDAA 3CRQA 3WL8A 1YACA 3V80A 4B3DA 5JVDF 1AQUA 1SUSA 1E8DA 2HYIC 5BQ3A 4TL8A 3MINB 1CJUC 4AO7A 4XIFA 1FLNA 4ZVVA 2J3KA 2FKAA 4PIPA 3TAXA 4B4KA 1AGYA 4J4TA 4F93B 4DUGA 5BP7A 1CKEA 2BFFB 4MWTA 3BK1A 3JTMA 2V1UA 4GYJA 3BMQA 3EXFA 1XO1A 2VWQA 4IIFA 2WWGA 3F6BX 1GRVA 1HKUA 1WUJS 3ITDA 4NABA 3W9UA 2XMBA 1E5VA 1FNBA 3CLTD 3G2NA 4KX5A 4N0QA 1XVAA 4IIDA 1VRWA 1J56A 3MTEA 1EUCA 3AINA 5SV2A 4NZNA 5BNWA 1AKWA 1CX9B 1ZD2P 2VTKA 2IXEA 3N2GB 2JZCA 1JDJA 4TMKA 2ON6A 4UNPA 1ONBA 3A9RA 3T1TA 1JLLA 1H69A 1I4EB 2J6BA 1KJZA 2ZZKA 1QB7A 2QNBA 4JVMA 4E51A 1ADBA 1IQUA 1XZLA 2FX2A 3AK4A 2CZCA 4RVSA 3SS8A 2D0PB 3R3HA 4HDSA 3OIFA 3SZRA 3EXIA 1OC2A 2C98A 2VSYA 4TLDA 4CTOA 2DBZA 1UEJA 3THYB 3R3VA 4A7PA 3DTYA 3PYXA 3QVLA 3B1FA 3ZDZB 4YUAA 4F91B 5KYUB 4LY3A 1F6WA 4HCJA 4XVQA 1FQOA 1KY4A 1SY7A 1USKA 3LVQE 2RG1A 3PKZA 3D7KA 2CF6A 2HA7A 1PJTA 2I0FA 4UEQA 3KU1A 5FTMA 1Z2DA 3ZTYA 4BB5A 2IH5A 1BN7A 1XP5A 3TUJC 2BTQA 5DT2A 1OH5A 4FN5A 1CVIA 2FFHA 3WJ1A 5GZ6A 3WRYA 2D1SA 1USIA 2AOTA 2PLFA 2ZJ8A 3IMFA 3OPYA 3UH0A 4RJLA 5KDDA 1H3NA 1ZK3A 4ND4A 4XD2A 4F1JA 3AF4A 3GD5A 4CEJB 5JZBA 5KSZA 3JQQA 2WKRA 1HFKA 2BKUA 1U4OA 2QRHA 2CVFA 3MTIA 4I1OA 5ENVA 4EZBA 2Z1MA 4A10A 1C3OA 3K9GA 2IH4A 3OE7D 4URFA 2QRKA 3BD9A 4PLWA 1NNUA 1B14A 1PBNA 2GRAA 2IYRA 4H17A 4HLUA 2O2CA 4JLMA 4DA8A 4CTMA 1BXRA 3NBXX 3UMCA 2FSUA 4N5MA 4ZGWA 4EO7A 5L3SB 2NLOA 2E4YA 1VB3A 4DDWA 1VP9A 5KYXA 4N0DA 2B3DA 2FN4A 4NYMQ 1ECPA 2FAXA 2PX8A 3J80A 1GA4A 3T7SA 4XWKA 3EVZA 1XI2A 2VCHA 2WRZA 2Y0EA 2ZYWX 1FJ2A 3BWXA 4GPEA 1YRYE 1YTUA 3ECCA 4A3SA 2BT4A 3SLGA 3OWHA 4ZOLA 3KLBA 5JSQA 4YUXA 2VEDA 2WBLC 1IXKA 1Z6GA 5A5VA 3GV0A 3K96A 3RVSA 5KJFA 2OFFA 2B78A 5ALFA 5BYBA 1XTRA 4ZI7B 4OHYA 3VSAA 4U1RA 2XOXA 4GPD1 5JXJA 1JR2A 1OI3A 2C97A 3T8YA 1J7KA 3OTGA 4XQEA 1OBFO 1W0JD 1YR1A 3WBBA 2XCLA 3GAMA 2EP5A 4P5DA 4R31A 4DKXA 3V97A 2FN3A 3KQWA 1SKYE 1YUMA 1H2FA 1ZEJA 2P62A 2PEYA 2A3RA 1CQPA 1NY5A 4RXTA 4EG1A 2DHRA 2DSTA 1JP7A 4KPFC 1L7DA 3CNOA 2YVLA 4LZOA 3EOBI 2JFOA 2QAIA 2ZITA 3MJDA 5EQFA 5FKJA 3UPTA 3S2FA 4BRUA 4V1CA 1AGXA 4RVDA 4FZ3A 4HDNB 3LECA 4HDQB 5CB6A 5L4SA 1JILA 1B3BA 1T5LA 5DGHA 3OP4A 1KDYA 2NAPA 2G7MC 3QIAA 3ZE8A 4QLBA 4L22A 3QVTA 3RK0A 4KXMA 1QRDA 4E5SA 3I0ZA 5DNVA 2AI3A 2ZDQA 4MQUA 5BR1A 4UAJA 4FLFA 4MHTA 2OV6A 3WSTA 2EGHA 3IFSA 4TS1A 1N6IA 2GK4A 4Q9HA 4XW2A 4NECA 3S81A 3CEHA 4WY2A 3TI7A 1T25A 1DTWA 5U1PA 3BIXA 1BHSA 1N7HA 3LTNC 4NCJA 1UMCA 2I7TA 5EIXA 1TT5B 4JBGA 1NMEA 4M7PA 2Q7DA 2VT2A 4AMYA 1JH9A 1R00A 1KETA 4YT2A 1X7HA 4PHTA 2WR8A 2OOSA 1QP8A 3JATB 2GA8A 4TN5A 3RS0A 4W4TA 1KI4A 3GLHE 1EAMA 4S12A 4DM7A 1CUHA 1MB0A 3FPLA 3AC0A 4IGFA 2ZJ3A 4ND7A 4OD0A 5ALTA 1E3MA 1M2VB 3MTAA 1QLHA 2M2IA 3WAKA 4Z54A 3RARA 4IEIA 1F12A 3CR3C 1E3QA 1MRNA 2FZVA 3NUZA 5G0UA 3NIFB 4HGYA 5CG2A 2IPAB 2XITA 5HP4A 3DVLA 3ENKA 1Q22A 1PD1A 3ORRA 4NBKA 6REQA 2XI4A 1T9DA 2WSYB 1XRRA 2NU9B 3S55A 2WJGA 3Q7IA 3SF0A 1SBTA 2BEVB 2ECQA 2JCXA 4LX8A 3VSCA 4CCYB 1OLXA 3WTBA 1YE3A 3CX3A 1H93A 3DFZA 3L77A 5JOQA 3S29A 3SKXA 1LFDB 3FSGD 4GVPA 3M4ZA 4O0LA 1NXWA 5CGZA 3KQHA 3ZLJA 1K6EA 1QH1B 5EZYF 3HG7A 3M6MD 2C61A 1HZJA 4E12A 1R0KA 4JC8A 4HLCA 4M0PA 4DQKA 3LC1O 1CUZA 4HAWA 4W99A 2IQIA 1F4LA 4FSHA 5JS6A 3E2PA 2YV5A 2R11A 3MLEA 2X6QA 3KVRA 4OGFA 4KQWA 4RQBA 1Y1TA 2GNAA 5ILGA 4MKHA 4DMRA 2ZAYA 4ISBA 1EXVA 4FMPA 3ZGNA 2PYIA 4TKVA 4GAEA 4L4RA 3TDKA 1OFUA 3V8PA 1ULUA 3WSWA 1V6CA 3JQGB 3PFCA 2O8DB 3E5HA 1KEZA 3L8CA 2GEDA 4FOOA 4JI6B 3W2IA 3RC8A 1M6WA 4N7BA 4LHVA 2I03A 2OLJA 4E21A 1W25A 4KWEA 1G5IA 1K98A 4S3MA 3GCDA 1CUUA 3P97A 3FYTA 3ZY6A 1VCIA 1VBKA 4XEHA 4ZQEA 2PKWA 1G8SA 1X1AA 3QYFA 4IFEA 4XWTA 4Z9XA 3UJAA 3K9WA 2H2AA 4HWGA 2PUTA 5F2KA 2JEOA 3U39A 2WF5A 2VC2B 1WTCA 2WHPA 5DTQA 3DAPA 3GGPA 3DW3X 4PX2A 4X54A 2II6A 5CP8A 4EF6A 2NZ2A 5F3RA 4C20A 1QUEA 3JASB 4EARA 3W9SA 2A0XA 2AFHE 1II8B 3KBBA 2B8TA 2A6PA 2YMLA 4AP5A 1EP2B 2CJYA 4YJ3A 2MSKA 4H16A 1RW4A 2P1DA 3ETGA 4CUZA 1U5CA 3OJEA 5B55A 4H0FA 3L40A 1J2JA 4QLAA 1PZFA 4KE6A 1ZSYA 2V3VA 4RHCA 3B51X 3HJUA 1TLTA 4B3XA 2VP9A 3K4PA 3OM1A 2N0SA 3GLUA 4MQFB 1R0SA 3HEMA 6GPBA 4GOJA 2R85A 3EYAA 4H18A 2GJSA 1QRTA 3G2LA 1JG2A 1RBYA 2PWPA 1D6JA 2H7YA 1D3AA 2PHZA 4EABA 2OCKA 3K0FA 2AZXA 5AUPB 4ZA2A 1C1HA 1M6VB 3JQFA 1BCRA 1XCGB 1H4TA 2R68A 4IICA 5FTWA 3H2IA 3RVOA 5KHOC 4YH1A 5K01A 1Z0FA 1M2JA 2R8ZA 5DMHA 3IEIA 2JEZA 5JJ5A 1CS0A 1KK1A 3STYA 3ESAA 3FE2A 4MMZB 4RANA 3SFTA 2YZGA 4JGGA 1FTNA 4A92A 5B7GA 1TK9A 3FGOA 5ENZA 4CU2A 4DT1B 3JD0A 5EGSA 3RSGA 4YGXB 4KK4A 3ZWOA 3TIIA 5KUTA 3LQKA 3QWAA 1L5KA 5E0OA 2Y76A 1NUTA 4BNLA 4AKGA 2QYSA 1YJXA 1R0YA 3ZOZA 3O4HA 2NZ8A 4QVIA 1XRNA 3EMDA 4NVRA 4E2FA 1XEAA 5FH9A 4OHBA 4RBNA 4TVKA 4FCVA 2EVWX 2IHVA 4HNSA 5IARA 4IUYA 2I62A 1CVLA 1XAIA 2GCNA 5ESRA 2EBUA 1SKQA 3WXMA 1QZUA 1TB4A 1R4ZA 2ERXA 3B2EA 4IGAA 4MV4A 1PI3A 1S2LA 1TZJA 2FQYA 3I45A 4CEIA 1YZNA 4YLEA 5J5AA 4C07A 3U3KA 3SQWA 2AK2A 4EW1A 1LK0A 4S24A 1UK8A 2FI1A 4DDHA 4UTRA 5TLSA 2EW2A 1N9ZA 4BBPA 3V7YA 5AJYA 5JXHA 4LJLA 3IQHX 5HOEA 3QZUA 1J5XA 3PLRA 2GARA 1X1BA 1FDWA 1ZNZA 1A72A 3A1SA 3MHTA 3BX1A 1CZUA 1SOMA 3F9CA 4FOPA 4OM8A 2QSYA 4W5TA 5KOIA 1IC6A 3QU4A 1C9JA 3O90A 3B3AA 2BM0A 3TVDA 1HEYA 1GP2A 3N2IA 4LHYA 4URZR 1KR5A 4AIIA 3C8DA 1Z2AA 1LTKA 3LIPA 3OHSX 3RJMA 3RT1A 4ZZ1A 1I9CA 4Q3OA 1ADFA 2GFQA 1P4AA 1ESZA 2H7CA 3BG5A 3ND6A 3OCUA 5FPSA 3W6ZA 4BFVA 1Z0JA 1T3SA 1V5IA 4RF3A 2X3YA 3OT4A 1X38A 2EYQA 4YX9A 4RCVA 1T9ZA 1L7EA 1SIBE 3IP9A 4MV8A 4F84A 1V2GA 3I9KA 3RIYA 3V8EA 3UQYS 4IOJA 5FPYA 1XL1A 2MR5A 2ZTLA 1L5FA 1L6IA 1SVOA 1QYCA 3ZGXA 5CAEB 3C5WP 3IVRA 3MJSA 5KWEA 1P1JA 2PZMA 4XTRA 521PA 4UOZA 4IMPA 4KHZA 3VZPA 5BSHA 1A9RA 1Z13A 5E2AA 3NONA 4PC2A 3UJ9A 5AOAA 4HZUB 4B35A 2VEOA 3KQOA 1Q0ZA 1WMEA 2QJRA 4M8KA 2TECE 4I50F 1QH8A 1YKSA 1I32A 4JT9A 3ABRB 2VHYA 4PYRA 4DCSA 4DQ0A 1YFJA 3MJEA 4MRAA 4L0CA 2QL6A 3Q5DA 5D3ZA 5DBHX 4TV8F 3IEXA 4D98A 3E18A 3NIBA 4GP6A 4G97A 2J0UB 4IJVA 1YRAA 3TRJA 4L75A 2EZ8A 3BE8A 3Q8LA 2J5BA 5IWAB 3ZLVA 2EIHA 1W5EA 5T8KC 1SQ0A 3I62A 1OVGA 3UF0A 1M1NA 1JALA 1UDAA 4PLTA 2OG2A 1DBPA 3Q1KA 2Q6LA 2PD4A 2IZZA 3NGLA 4UMFA 5TT0A 3MTDA 3S27A 2XJ9A 3CYFA 1PLJA 4XJXA 3BMXA 4O1IA 4DLNA 3DXZA 3E2IA 2ZUSA 3LC7O 4M87A 1IXZA 4YVFA 4OL9A 1H9BA 2VA8A 2H2IA 2UKDA 4FCCA 5FOVA 1XQ6A 3MEQA 1CRWG 1HTBA 4KYIB 1EE9A 3P9XA 1HNWB 1G6KA 1Z4MA 5C81A 4MIKA 5FIUA 4ZXFA 3V4OA 1E59A 3HR8A 2IHTA 2PG3A 4OGLA 3EULA 3TXAA 1FFCA 1SBNE 2HSZA 2XB8A 3GGCA 3HDGA 5HFNA 2X9LA 3E9RA 3K2IA 4Q1EA 2ZVQX 3A32A 4JXKA 1Z7BA 4EEZA 1M0TA 2XUIA 4MO9A 4QC2A 4PAMA 1K7SN 2JAQA 5LP1A 1RVV1 3IR6A 3UC5A 1Q1AA 2PZEA 3LP6A 2CNBA 4BQRA 2AEFA 4IH4A 1H8ED 4R9SA 3BMCB 5AKXA 3VU3A 2HM7A 3L5OA 4O4LA 3K9NA 1TAGA 2B4YA 1B2LA 1YI1A 3SJBA 1SNYA 3EASA 3VJMA 2HIGA 2HPVA 4X66B 2CB0A 5B30A 3NNDA 1KYIA 4M98A 1Y6RA 4RKFA 5FFNA 3TIXB 4J3FA 3HB0A 1F2UA 4F2HA 4F9EA 4QYIB 2HEGA 3U4MA 2VPTA 3CNHA 3G8YA 4B4WA 4JB0A 4NE2A 4MPJA 4V2UA 4E94A 4UKDA 1JTFA 2RKOA 1M2OA 3QMWA 4TKMA 1VI5A 1Q1QA 2IK8A 1FS4A 2BY4A 2KMLA 2O7NA 4XWOA 3D6MA 4LKRA 4Q05A 4QUBA 1R8XA 1ADGA 2VOJA 1ZBQA 4Y9TA 3N8IA 4EJSB 1KDPA 3G8CA 3LPAA 2Q6OA 4I1YA 2TSYB 3KB1A 1WB9A 3AZOA 4ZPXA 1T8PA 1QYIA 3U1VA 3TPFA 5HJ5A 3VPFA 1UBGA 3AR4A 1TZBA 3OHMA 3E9DA 1E1RA 3AF3A 3T1HB 4ZI2A 4CKCA 2JIRA 3KVNA 2BONA 3GD7A 3UMSA 1YRQA 2DSNA 4L6CA 2MINB 4NTZA 2FPKA 4KSYA 4C0JA 2HJ9A 3CXUA 3LLSA 5FXMA 2FDRA 4HVTA 2EOAA 2G1AA 1E6EA 3A11A 1HZZC 3P26A 1IDN1 5KNDD 5DE3A 4MHSA 4XE5A 1NVBA 3H5RA 4NOMA 2GHQA 3O1IC 4WPGA 5TQ0B 1HDIA 2C2WA 4MRRA 1T29A 2IW3A 1K3TA 2PM8A 1CUSA 4NKRA 3VR5H 1UMDB 3KJXA 3ZZTA 4KMSA 1Z5WA 4JDPA 4KQMA 3ZQ6A 5IVKA 3RASA 3F90A 1SRQA 1MN6A 2A84A 1MB3A 5J40A 4KN5A 4F2GA 4YDQA 7YASA 2BF4A 3TLAA 1MP0A 3W3AH 3EGWA 4DNOA 1VSQA 2O5CA 2VJKA 2QP9X 3HCRA 3SF8B 2YIJA 1XZBA 3CVOA 3RFUA 3SI7A 1Y1LA 3IPLA 2NXCA 5AKZA 4ZTBA 4TSRA 5H02A 1B26A 1OAKA 1P45A 1X87A 1YQQA 2X7XA 3KS9A 4MS1B 4PYJA 3I04A 2HHLA 1R5BA 1OIVA 1GCGA 1SU7A 1FUUA 1HMYA 2JHPA 2OK7A 1PEYA 2XYVA 1WULS 3ANLA 3AGQA 3FZYA 3A4YA 3DM5A 4R54A 4LUCA 4UDNA 2HDOA 1X1TA 2I76A 4MTCA 5LC1A 4F4CA 4HJXA 4F38A 1RWVA 3G2KA 1R0ZA 1ZW6A 3CKLA 5K05A 2XWPA 1O0BA 3UEOA 4D8TA 3EF3A 1FYXA 4ZEXA 2HEIA 1Z2OX 3AF5A 1DXHA 2GKSA 2QQEA 3PV0A 4A5OA 1N1GA 1BVUA 2P35A 2IXBA 2YJ6A 1J00A 2JA2A 4IDAA 4KFSA 4UD6A 4XD7A 1UFVA 4RUKA 2D1QA 3FWZA 4RA9A 3SCZA 4YCCA 3AEYA 3PZRA 3NVAA 4NS4A 3GPLA 3EHDA 1K8QA 2A1TR 1WQ4A 2DPHA 3BXZA 4J07A 4QD3A 3TLKA 3VJRA 1GG8A 4OI1A 1JHXA 2NYAA 3Q12A 5EE3A 5GWXA 2JDIA 4F06A 4BVGA 5EKSA 3CHYA 3MT0A 2XODA 3WRYC 1QRUA 4D4LA 3OQIB 2BFDA 1AKYA 3KX2A 3KB8A 3O5AA 1P1IA 3QUQA 3VPDA 5HRUA 3PEYA 1VE5A 4BNXA 2G67A 3TAHA 1TZCA 3EGCA 1T26A 3AGPA 3VYTB 3LKDA 1IY0A 5LYJB 1T5IA 2P6MA 4G0XA 2QRMA 5FRDA 2OGZA 4FDAA 4MO2A 5GV8A 3KHTA 4NBRA 1FUKA 2XWSA 4GKBA 4OHRA 3MOSA 4KQKA 3T5GA 1U7TA 2XBLA 4O2BB 1GZUA 4KXVA 2Z2ZA 3OX1A 2FR0A 1T5HX 2C2KA 4HLUC 3E5NA 4K88A 5G0TA 1FSPA 3IUPA 4MRVA 4AP9A 4Z1MD 2PUGA 2A9OA 3VXKA 3TQSA 1UF9A 3VO8A 5ILOA 3EEQA 1XZQA 5CDYA 1ISJA 4UHHA 1VI6A 2J3IA 2JGMA 3BB1A 3L7MA 1P1KA 5IPFA 1AKTA 2BUBA 1E3IA 5LNK1 1N34B 4Q3DA 5K99A 5C5DA 3NTUA 4UXHA 4DIBA 4EX7A 3DA8A 3KR1A 3ZY4A 1AHNA 4HP8A 4RK1A 2WTMA 1F0NA 1VHLA 2BUAA 2KS6A 2WIAA 3KOWA 3RHSA 3GLGB 1BHJA 2FU5C 3H13A 5ALQA 3VPBA 3WMRA 1EBFA 1F2DA 4MWZA 4PX5A 1UKEA 4QHYA 5FI3A 1EIWA 4XX1A 4RHUA 4TMFA 4R1QA 1OGIA 4R5MA 1YOVB 3AU8A 5IBPA 3RF6A 1O87A 2FOIA 1U3WA 1XB2A 3WLAA 4KW7A 1CETA 1TYBE 2FSSA 3A9TA 4QSMA 3RAEC 1GSHA 3WB2A 3KPWA 4MIEA 1RQRA 5JV5A 3HU1A 2CSUA 2ZYHA 2RH4A 3U44B 5LYYA 3ZTTA 3I39X 2BP7B 1E7MA 1G8YA 3LHKA 3FLMA 3O8OA 4M9XA 2XVYA 4R4JA 3DYVA 2C3UA 4BZPA 3FWPA 3OX2A 2YV4A 4MR8A 4R1SA 5BQOA 2ONYA 1SUWA 2VP5A 3VI4B 3ETNA 1NOJA 2BDUA 2ENWA 3RCBA 3P2EA 1MDBA 3THXB 4F7WA 2DCUA 3OLXA 1KJWA 3OQ6A 1EDOA 1NW5A 1MFZA 3GCGA 3QW2A 2XVAA 4RKYA 1IUOA 2FLWA 4JHLA 2K2QB 3F7TA 4HDRB 3JRNA 4B4VA 3HFJA 1B00A 2OBMA 3PEVA 1YNSA 2XVXA 1TCUA 3GOQA 3L8MA 2WYVA 5BOSA 5LJLA 5FUVA 2C2HA 4DG8A 1Y42X 3JPWA 5FBZA 1NVXQ 1E66A 4X41A 1N5KA 2X8LA 3M6UA 1EP9A 4L8VA 3N2NA 3R4CA 3I4FA 1JKFA 1VJ5A 3MWFA 1QM5A 2BC9A 1QK4A 1DP4A 2G7ZA 3WOVA 4A0GA 4M9RA 3GT3A 1RM0A 5JU6A 1LLFA 2VPQA 2ZE6A 3G2HA 1QTQA 1SC1A 3G23A 4ODIA 3E3LA 1M9NA 2X8JA 4J0KA 1T1EA 1KWGA 3MGCA 4DUYB 3A27A 3WR5A 5TF4A 2EJCA 1XMSA 1P5RA 2PSDA 5I6DA 2DT5A 2RDMA 3FSJX 2G72A 1S8OA 4AY4A 3AL3A 3O26A 5CVEA 4EMBA 1EXDA 3V4SA 3GGSA 2C5GA 2CLHB 4P3XA 5FWDA 3RIGA 1PR4A 5JIBA 2B34A 2C8JA 1AH2A 1M33A 1PTKA 1YS6A 2ABWA 3BGWA 2AEMA 4PXYA 5JRJA 3ASYA 1IY1A 4E6EA 3QXSA 5DM4A 2EAUA 3Q7PA 4IFIA 3TPCA 1XUOA 2QRLA 2GUWA 4JYMA 3CZ9A 4TM7A 4WXYB 3A36A 3G2IA 2EJVA 1NMQA 1GLNA 4TTPA 1WD5A 3A31A 5K2MA 2I22A 1FNMA 2HUNA 2O50A 1J8VA 1YRWA 4F1WA 1C7FA 1EG2A 5CIWA 1I9GA 4MX8A 1E7YA 2Q5HA 3LCVB 4CQJA 1ID1A 3L4KA 2HMTA 3H5WA 4ZP1A 1VM6A 3QJYA 4ZT2A 2LBPA 4R0VA 5JAQA 4FXPA 4RVOA 3O4RA 4N7MA 4IQGA 3VC2A 1PTJA 3IQEA 4G4GA 1RXVA 2JFUA 3RVQA 5H4GA 4NOKA 1GY8A 1LW7A 1QV6A 1IN7A 2IX9A 4REMA 3W8RA 1A8SA 4D4HA 1GL6A 3PEFA 5KTSA 2IDJA 3O38A 4TMXA 4OHWA 3SE7A 2CN1A 2YJTD 4BO2A 1Z16A 5AH0A 3PQ5A 4OHMA 1Z73A 5AVRA 4OU5A 3Q9UA 3QEMB 1XWWA 1NSFA 4YMUA 5EZ6B 5EXEA 4JI0B 4LFBB 1IUKA 1QRRA 1T9BA 3KAKA 2PUDA 4DCPA 2IYYA 4MI1A 4GL2A 1T10A 1N3IA 3WNVA 3FJ1A 3CQ9A 2SCUA 3GH3A 3GQBA 2UV8A 2V6GA 1S2MA 3QBTA 4ASUD 5EJIA 1RZRA 4M9CA 2NXNA 1QNLA 3WGGA 3S1AB 4DPMA 2WDPA 1HOTA 2QP4A 3P9KA 4KN8A 3U1TA 5A5GA 3HRIA 3NCHA 4Q4JB 4W6QA 1HDCA 3IOBA 1G0OA 3MT7A 4YYZA 5TEVA 1RE1A 3BCSA 1RI2A 3QY9A 3OC0A 5KCZA 3OIVA 2QLMA 1Q19A 4FR5A 3HUTA 5KNBH 4M89A 4QOIA 5AW6A 3GX1A 1BAPA 3K1AB 4OV6B 4FE4A 1M7GA 3FR8A 5BQ5A 3SNKA 3ZU4A 4ALLA 1TVEA 3KLMX 5MN5A 1WMFA 2EX4A 4HG2A 1MQ8B 1YVEI 3L6UA 4Q19A 3JQFC 2YC2C 1A96A 3K5HA 1CUEA 1DMSA 2JI7A 1X3LA 3RS4A 2H59A 3HJBA 3R9KA 3UICA 4QZVA 4ON9A 3ZJ4A 1DMRA 2HKIA 4BEBA 2W4MA 3MCWA 1TO6A 2W00A 3ADDA 4PZ9A 3ZCTA 4IMJB 4IIJA 5BXQC 1EFRA 5BYKA 1QFXA 2XTNA 3DT9A 1BZYA 2HX1A 4EJ0A 3A4IA 5SZJA 3EZ7A 4GUDA 1KPHA 2GCOB 2VZ8A 4G8BA 4Q4HA 3UANA 2ZZMA 3C3MA 3PXGA 1DHTA 4LI0A 1QZXA 4XRRA 5ICEA 2XRMA 2D74A 1FVOA 1BXKA 2GFIA 2KBEA 5IDYA 3RTAA 5GIOE 4OLAA 4KO1S 4FOLA 5AVXA 2Q4TA 2AYXA 4B3TB 3H2JA 4HAVA 1FIUA 1VSUA 2GZ3A 1NJ5A 5LPNA 3E0QA 4FKBA 2FEMA 4OO3A 4ZVPA 4G01B 4COKA 3B8HA 3PRYA 4YASA 5JPDA 2C78A 2OV2A 4X85A 1J0CA 1N9GA 1FDSA 4DARA 4PHCA 5F9HA 1LQTA 2VIIA 1PZGA 4HXGA 4QQRA 1ENPA 4TVBA 2OQVA 5DTRA 5UKDA 1KJQA 1LW6E 4ATNA 3CUVA 1N2HA 1QGUA 1R66A 2DFDA 2RHCA 2WJHA 3I1YA 1JNXX 3LWDA 1JSRA 4MW7A 4YO8A 1N6OA 4EHKA 5KMGB 3ORYA 3FWYA 5A4MS 4F92B 1RYFA 5IKOA 1R4MA 1IN8A 1XDZA 4QU5A 2VJPA 4CUJA 9LDTA 3QF7A 2VDWA 3BE4A 4MVCA 4YRCA 4D0NA 2ZJ6A 3EIQA 3JZIA 3KEMA 4O8CA 5JSFA 1OFUX 1JTVA 3TK1A 3DZKA 4QUGA 2I4RA 1I14A 3O8BA 5BT8A 3VYVA 1MNQA 3U7IA 1TQHA 1EVJA 1TNDA 1ZDMA 1CS4C 2JATA 3JYPA 5ARDA 5B2FA 4NAUA 2PSSA 1DKQA 3C48A 5E1MA 5ECYA 3NTQA 4C9BA 2TMKA 4FLEA 3EMKA 4RKQA 1R8SA 4M7WA 5CYPA 5AI6A 1T2EA 5FI0B 3SM3A 3NJ8A 4EB6A 1F4PA 1U1DA 1MTOA 1FLDA 3KKMA 3KKQA 3PIRA 3H83A 3PNLA 4LYHA 3W9BA 1HX7A 2RHBA 1VLMA 5ILQA 2CE2X 3WLRA 2G5GX 1B93A 1NVVQ 3DS8A 2XOKD 1P91A 2IRWA 1E79A 2XE8A 3UMMA 4UASA 5F33A 1HDRA 5TV2A 3ST7A 4EPVA 1C1DA 3AV3A 2RGRA 3DXYA 4JFRA 1WZIA 1H6DA 2G0NA 3M9WA 1R6VA 3LVRE 3OIWA 4P2BA 4J1NA 4YJFA 1O7JA 3UTCA 4IKEA 2WZQA 4CCWA 3KETA 2DBRA 1NXTA 2ONZA 5IJAA 5KNCD 4W5HA 3LX5A 1OGJA 1ZJYA 2Y6UA 3TZ6A 4AKTA 3IBFA 1CYEA 2QBYA 2JGRA 2X0FA 3UMVA 1T3HA 4RDHA 5ED0A 3C45A 4BO1A 2QMOA 4L95C 5ADUS 1CQZA 3KTAA 1A9XB 5EN4A 4ZN6A 2P3QA 3OHPA 1LD3A 2OHJA 1OBCA 4LVNA 4ZRNA 3OCZA 4MVJD 1NSYA 2CFTA 1YZQA 1P8AA 1HRKA 1K4KA 1SC4A 2X14A 3ABQB 4R3WA 1BMFA 4RIEA 1R4AA 3LWBA 3I01A 4RESA 4TLMB 4CM7A 4DUZB 2WU1A 3D8NA 3Q3VA 3H1BA 3EXHB 2Y68A 4UAGA 1FRVA 3KRTA 1KJYA 2B8EA 3VDXA 2CDRA 2MSLA 4MVJF 4HX2A 2WVAA 2OPHA 1OTYA 3CCBA 3BGOS 1QS0B 4LE1