4AJ2A

Rat ldha in complex with 5-(2-chlorophenyl)-1h-tetrazole
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
330
structure length
327
Chain Sequence
ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 117
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4aj2A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4aj2A02
2Q2VA 2FZEA 2YW9A 1H6DA 5IDYA 3ZV6A 2QZ9A 1H94A 4IQ0A 3OETA 2HK8A 3CINA 3GPIA 4N5LA 4QUKA 3ZI0A 3OHSX 4AJJA 1WZEA 4B79A 5L53A 1ZCJA 2CVZA 2E48A 3PXXA 4TSKA 2P68A 3ZHYA 4IIVA 3TZHA 3DMYA 4WGGA 1P45A 5JC8A 1FDTA 5AXCA 3SJ7A 4NBRA 3BA1A 4NIMA 4L4XA 3ITDA 5L4LA 2I67A 4BNYA 2AQHA 2VRCD 1ZNQO 2D2IA 4U7WA 4XX0A 1IE3A 1YGYA 3GUCA 1CIVA 2I3AA 5CHEA 2C0CA 4PFJA 1GUYA 3WYEA 3OJFA 2UDPA 3U62A 5KNLA 1R0LA 4I8XA 4QFCA 3PHIA 5KJCA 4ZQEA 1GADO 3JQ8B 3CSDA 4YB8A 3MJ4A 4CV3A 1YB1A 2NV6A 1JVSA 1W6UA 2XF8A 4P38A 4J7XA 4J9UE 1TT5A 3G79A 5JDIC 4AJ2A 1B14A 4TWRA 3OF2A 2PGJA 4ZHSA 2HU2A 3WWZA 5TIIA 3LVFO 3OEYA 2IYPA 2J5RA 4G65A 1TT5B 2EP7A 1JTVA 4WK6A 4Y67A 2NVUA 5J23A 2HK9A 3WWYA 2PH5A 2BGLA 4MVJD 2FOIA 1A9YA 3H5NA 4ROSA 5IDQA 4J2OA 4IDFA 1E5QA 3WOHA 3UOGA 3FTNA 1HWYA 3EC7A 4RQTA 1CERA 5G0TA 2VTEA 1H2BA 3NT2A 5BNIA 4BNJA 4E31A 5CDYA 3KZVA 4DLLA 2YV3A 3QQPA 4GVXA 4M49A 4MJLA 3C7DB 4EYEA 4IGEA 3QWBA 4BB5A 5TF4A 4HNHA 3JQCA 3H9GA 1PGPA 1P9LA 5JYEA 5A3VA 1HRDA 1Y5RA 5ER9A 2X0IA 1N7GA 4IS3A 3NTRA 1O95A 2BI8A 4E5KA 3VPHA 2ZIZA 4J1NA 4DPLA 3AI3A 3VZQA 4BS9A 4HXYA 1P0FA 4ZJUA 1QV7A 4JIGA 1K6JA 1BXGA 1TVEA 2NUAA 1ZK1A 1G0OA 2Y68A 5JMWA 3F5SA 4AICA 1UAYA 5EQDA 2D59A 3RASA 3WFJA 1XHLA 1C1XA 3WBFA 2YQ4A 5JC1A 3L6DA 4O5OA 3CZMA 3FBTA 4BKRA 4IIUA 1MFZA 2QIOA 3FPCA 1ULSA 2FWMX 5IFLA 4IDBA 5BNTA 1LRJA 4A27A 4PZCA 2B35A 1UP7A 1E3WB 4FR5A 2EKQA 3I9LA 4MVJM 5I7SA 1M2WA 1E5LA 1M76A 2H1SA 4IZHA 3OEWA 3VPXA 2NVBA 3KBOA 3QVTA 4L73A 3MWDB 5HM8A 2VYND 1LX6A 1LSSA 1MG0A 3ZNPA 1GYQA 2YV2A 1ZMTA 4CM6A 1YBAA 3D7LA 4AJKA 4TRMA 2VT2A 5K6AA 2Q1SA 1I2ZA 1NXQA 1DBVO 3C1TA 1NHGA 1WLYA 2Z5LA 3FTPA 3R6DA 1V3TA 3CXRA 2HQ1A 4Z0TA 3U9LA 1P1IA 1SO8A 5F3RA 4C7KA 2RH8A 1LQTA 3LF2A 4YT5A 3LC7O 1ZUD1 3RU9A 1JQBA 1MGOA 3NEPX 4K9DA 2R2GA 2QZZA 4BO1A 5KJEA 4J4TA 2DFVA 4YA6A 1BVRA 4OSOA 2AHRA 5I9NA 3QVXA 1NVTA 4HBGA 4CQMB 2OOSA 4CLDA 2I3GA 1O89A 1FDWA 2OZPA 3TN7A 1GAEO 1P74A 3G1UA 2XXJA 2EXXA 4G2NA 1NWHA 1QYXA 2W2KA 4RF2A 2IXAA 3JQEA 3IAHA 3QWAA 3VVCA 5CG2A 4I1IA 2IEDA 2ZK7A 4LMPA 3GVIA 2Q2QA 2D5AA 2X9NA 4PLYA 4WLNA 4AJHA 1HTBA 2VUTA 1PL7A 2HUNA 1C14A 4D46A 1PJ3A 1LA2A 2PFGA 3ORFA 4CLRB 1H9BA 4PZEA 2EKLA 2DU8A 4J1QA 3A4VA 2Q99A 3I9JA 5KKAA 1V3UA 1N8KA 4QFDA 1DIGA 3NX4A 5EJ2A 4AJEA 3KYCB 3RUHA 3ZGYA 4XRGA 4E2ZA 4YT4A 3UCXA 4NBUA 4GX0A 3GHYA 1ENZA 3AY7A 1MC4A 1M66A 2YDXA 2JFFA 4K6FA 5GY7A 3JQAA 1ADCA 4IGFA 5JO0A 5HWSA 1R0SA 2W90A 1RWBA 3BTUA 2OORA 4M54A 4PRKA 1AUPA 1U2GA 1HDCA 4I9HA 3BMQA 4NFSA 3WMWA 1JWAB 4YJFB 4B4OA 1P1FA 3CPSA 3TQHA 1W4ZA 2RCYA 4R1SA 5KTKA 3JQ6A 2B83A 3D3EA 1R12A 2ZB4A 2EWMA 3RUDA 3DHEA 1ZEMA 4CM4A 1QXSA 2A4KA 4TKLA 3ZW8A 3A06A 3O8QB 3PRJA 4S3MA 1PJ4A 1R15A 3JQGA 4Z0HO 2VHWA 1PS0A 3VVBA 4CLOA 3K30A 4II2A 1JVBA 3KYDA 1Y1PA 3ZWMA 3QJ5A 1DHRA 4RPJA 3ZNQA 2EJWA 1PEDA 4XQEA 3L6OO 2VWQA 3PHLA 3TL3A 4BNUA 2O3QA 1GV1A 4ILKA 3PJDA 4HFRA 2GN4A 3IP3A 3JQDA 4D44A 2AA3A 3OBBA 5IN4A 1E0DA 3ENNA 2DLDA 4MVJE 1C1DA 1P44A 4CM7A 3HQ4O 4D3DA 2JFHA 3AFNA 5F21A 1YB5A 3WFIA 4UVHA 4QX6A 6LDHA 3HWRA 4P22A 1C1DB 3IDSA 5BSGA 1U4OA 2Y0DA 3PWKA 2PD4A 2IE0A 3T7CA 5JSFA 2NTNA 2C2YA 3FRJA 3PIDA 3AW9A 2O7SA 1E6EA 1RM4A 3TJRA 3DOJA 3EHEA 4RJTA 5L7TA 3IMFA 1DC3A 4FB5A 2J3IA 2PZKA 3WYBA 4RF5A 1OC2A 3E18A 1R16A 4FFLA 3GH3A 4J2HA 3P5SA 4GMGA 1VL6A 5IZ4A 1I32A 1NWCA 2GUGA 3HDQA 2WYWA 4HFMA 2NSDA 4PLCA 1NBOA 4L4RA 1E7YA 1H2HA 1UDCA 3AOEA 1V6AA 2JD0A 3TOZA 4OQYA 4BV8A 4JN6B 1H0KA 4GLLA 3WGOA 4K6CA 1M75A 3QW2A 4KWIA 1EE2A 3OP4A 2PKRA 3WR5A 1DXYA 4KZPA 2JAHA 4BNFA 3A28A 3P19A 4P4NA 4WLVA 4D3FA 4DA9A 4E30A 1LDEA 1KETA 2O3UA 1LI4A 1QYVA 3BMOB 1Z82A 3EZYA 3V1UA 5JMPA 1TEHA 3L4BA 3LU1A 3OIFA 4GI2A 4DREA 1A72A 2X9GA 4RO0A 1QKIA 4QO8A 4RVSA 2BFAA 3JQFC 5A9SB 1R37A 1VKNA 3PDUA 5F1OA 5G0VA 4AJ1A 2IODA 4CMGA 4Q3NA 4WNCA 1LUAA 2EG9A 2VHVA 2NLOA 4PVDA 1DC5A 2OP1A 4ZRMA 1GFSA 2V6GA 3AUSA 3WJ7A 1NQAO 5TRTA 3CH6A 2X86A 2I66A 2JHGA 4N5NA 5DCWA 1QSGA 4DIFA 1E7QA 1U2DA 3PWZA 1HE4A 4INAA 1NVMB 4UUMA 3DFZA 3QWHA 3B1KA 4W7HA 3GPDG 1CJCA 1YQXA 2E4AA 3PLRA 2AXQA 1NM5A 3BHIA 3DTYA 4CV0A 2JFGA 2QRLA 1KY5A 2C20A 1BW9A 1ADBA 4XDYA 1VJ1A 1KIFA 5HTOA 2OP0A 5TSDA 4N5MA 1EFKA 3H4VA 1HYHA 4BQRA 1NAIA 4R5HA 1BW9B 2R00A 1Z6ZA 5G4LA 4DPMA 3GAFA 3GEGA 3E48A 4B8ZA 1PWZA 1PWXA 1DC6A 1L7EA 3OQ6A 5JNLA 1I01A 3ZWPA 4M55A 3LT2A 3KSUA 1HEUA 1LDGA 1LU9A 4LRSB 5K6AC 5K9ZA 1BDBA 2YZ7A 3WJAA 1CWUA 4WECA 3VH1A 1UXKA 1HE2A 2P5UA 1YJQA 4Y6PA 3VHRA 5ICSA 3WGZA 1H93A 4LN1A 3RQSA 2DVMA 4E0BA 2BFPA 2OBYA 2Q46A 2VWGA 5EMHA 3ASUA 4L74A 1B2LA 3NTOA 3LSYA 3RVDA 1GR0A 2JJYA 2W8ZA 1GV0A 3ONFA 2PY6A 3W6UA 1Q1NA 1F17A 1GEEA 1QRRA 3LT1A 4BO8A 2PA3A 5JDIA 1Q0QA 3NKLA 2ILTA 3D4PA 3GNQA 5ICMA 3GVXA 2H5LA 2X6TA 3FF4A 2RAFA 3DFUA 2AEMA 4UUOA 1VSVA 1AGNA 4HNGA 4U6QA 5A9TA 1F8FA 4ALMA 4CPDA 2ZCVA 4FS3A 1J5PA 1HDOA 3QVOA 5ENDA 2P9EA 3ETGA 3PQDA 2C2XA 5A02A 1U4SA 3IJPA 2PNFA 1DRVA 3WTCA 2VZ0A 2X9VA 4YRAA 4DGSA 1PL8A 3HG7A 4R51A 2FRDA 3AI1A 4Z0PA 3B20A 3H5RA 2UUOA 2VZ9A 3NT4A 5ILGA 2GD1O 4AJIA 2XXBA 3AM3A 4DMLA 4IDEA 5DBGA 1HF3A 4GKVA 2EHDA 1VPDA 3BAZA 3BHJA 4BHTA 2OFPA 3ZHXA 1ZFNA 1PZHA 2OL4A 3AY3A 4P4GA 3WNQA 4EDFA 2ZQYA 4FPXA 2O3RA 1YL5A 1LTHR 1LBEA 1XLTA 3MEQA 2NU9A 4ZQBA 5TLSA 5DF1A 4WPGA 4BO7A 3A14A 3PWSA 3F4BA 3ZWBA 5CPBA 1U8XX 5KVQA 3L9XA 4J3FA 3RUAA 2DBRA 1EBUA 2HLPA 1I33A 4R68A 3VH4A 4A73A 4ZICA 3BTOA 5L7YA 3U09A 1HSOA 4CM8B 2YFHA 4FOSA 3V1TC 2B5WA 4IQGA 1H5QA 3EVTA 2ZJ0A 2I76A 4BQPA 4G5HA 3VPFA 5JO9A 3RC7A 4DBVO 4XIJA 4UVIA 5DOZA 5FYDA 3P2OA 3KOUA 5I7VA 2WMDA 2QYTA 3LC1O 2JD2A 2B5VA 2P4QA 1BHSA 4JJGA 1QV6A 2NM0A 5KCZA 3HB5X 3CUKA 1JW9B 4EITA 3WSVA 4S1VA 2GRAA 2PK3A 5T5QA 4WEOA 1GCOA 5A1TA 4BGUA 2DAPA 4RZIA 3RBXA 4MVJH 3PHJA 1M67A 4ID9A 3Q6IA 1Y8RA 2X0NA 4YYZA 1LEHA 3GFGA 4ZD6A 1YE3A 4FBGA 3JD0A 1I30A 4IBOA 1BMDA 3DHYA 1MG5A 2D1YA 4O1MA 4YXFA 2X0JA 3QLJA 1F8GA 3FPLA 3RJ9A 4UEKA 3NT5A 1KY4A 2CMDA 2VHZA 2UAGA 2FR1A 4ITUA 1E3JA 1NAHA 1GD1O 1WMBA 4YVFA 3NUGA 1M6HA 1Y9EA 4FD3A 3JD4A 3VKVA 2JCXA 1I2CA 3H2ZA 1MA0A 1TB4A 4E2WA 4ONEA 4E5YA 3GDFA 1ZSYA 2Y1OA 3AOEC 1O8CA 4AVYA 1ISMA 3WBBA 4LCEA 2FHSA 4KDFA 4W9NC 2C29D 3DZBA 1QYCA 4R3NA 1T2DA 2GGSA 3QP9A 3VTZA 4QEDA 4WLOA 1XU9A 1ENYA 3U49A 3ADOA 4OOEA 3DL2A 1UXGA 4RVDA 4I5DA 4FFRA 5LDHA 1WDMA 3P2YA 3WG9A 2FP4A 3ZZNA 4RDIA 3DOCA 3PYXA 2NNLD 1DJNA 1LNQA 4AJOA 3I6IA 3UUWA 3GQVA 3PJEA 1P1JA 3ZWVA 3GC6A 1GPJA 1XDWA 3GN2A 3ONDA 1R4MB 3MWEB 4JROA 3U5TA 4BO3A 3JQ7B 5A04A 1V9LA 4DTIA 4GWKA 1IHXA 3AI2A 5KVCA 3ZDFA 1NFQA 4UUNA 5DBFA 1I3KA 1O6ZA 1VRWA 2AQIA 3G1TA 3HB4X 3K73O 2FSSA 4JLWA 4BB6A 2C54A 5G4KB 1PZFA 3PI7A 5FFFA 5HRUA 3FCOA 3PEFA 3V2HA 3ZV3A 4ZA2A 1B7GO 4RORA 3VH3A 2EF1A 1NFFA 4P4LA 4A0SA 2FMUA 4UUPA 2ZYAA 3TZCA 3RUCA 2Q4BA 4E5PA 1N2SA 2Q4EA 3VPGA 4B4VA 5U4QA 3PJFA 5AQ1A 4KUEA 1EQ2A 3SLKA 3MZ0A 3MTGA 2ET6A 3AUUA 5C7LO 4OO3A 1KEUA 4CLHA 2EIHA 4CR6A 2HDHA 4ESOA 1P33A 7MDHA 3C1AA 4GGPA 1N9GB 2R00C 1MV8A 3CEAA 5TJ9A 2YYYA 3KETA 4AJNA 1SB9A 2ZYDA 4MP8A 3OA0A 2PZJA 3GZNB 5GZ6A 1D4FA 1O0SA 2V6MA 4XYEA 5THKA 4CMCA 1VSUA 5AOVA 3SJUA 1NPTO 1B16A 4PG5A 3JQ8A 1F06A 4FQ8A 3A1NA 1KC1A 4WE3A 1J0XO 3CKYA 4KMSA 4CM5A 4YRBA 5IXYA 4ND5A 5C5IA 4H7PA 3GT0A 3QE3A 4IINA 4I5EA 3W8DA 5B4TA 2CD9A 2HMVA 3WXBA 1YKFA 3GEMA 3RROA 1NPYA 4IDDA 3GG9A 2GZ2A 4GLOA 2QRKA 1YL7A 1WWKA 3AK4A 4NJMB 1QYDA 1LSUA 4YPOA 3F4LA 4WLUA 5ER6A 1PTJA 4MP6A 1E77A 2ZCUA 1GZ4A 4GAEA 1NASA 3JYPA 4L75A 5DBIA 1LSOA 1LXCA 4BO0A 2ZKLA 3IP1A 5I7FA 1SNYA 2OBNA 1ZEJA 5U9CA 1T4DA 4ALJA 3QWFA 4CMBA 4GBJA 1EK5A 1EZ4A 4Q3AA 3E5MA 2ZTMA 5BSFA 3B70A 4BNGA 1HDZA 4E4YA 5JAZA 5CP8A 2WD7B 1XKQA 5JCXA 5A05A 3WMXA 2VHYA 3BMNA 1K2WA 1E3SA 1XEAA 5KVSA 1I3MA 2V7PA 4PLHA 4OM8A 4RLHA 3S2EA 1VI2A 4CMIB 5IDXA 1EMDA 2CDBA 1KYQA 3INTA 5U1PA 5HBRA 5A3JA 1HZJA 2YHIB 1MC5A 3BMNB 4NK5A 3JYOA 1A7AA 1X0XA 2Q49A 2IDZA 3JQFA 2AEFA 1E3IA 2RHCA 4NZ9A 4XD2A 4EEZA 3WICA 4AJLA 1ZO8A 3TOXA 2PD6A 3QHAA 2J6IA 1N92A 2DQ4A 4MP3A 4YACA 4IJWA 3F6YA 3MJEA 4KQXA 3RIHA 1C0IA 3L77A 4WCFB 3OMLA 2Q3EA 3MJCA 1RYDA 4BOYA 4CV1A 4G81A 3NDIA 1U9JA 5CPFA 3WGTA 4QSMA 1EVJA 4NG5A 1DFGA 4R16A 3X2EA 3EZLA 4L9RA 5JYDA 3F3SA 1E3WA 2VRCA 4AFNA 3WIEA 2GCGA 3CMMA 3RJ5A 1LDNA 3ZW9A 3GK3A 1NFRA 3Q1LA 3GLQA 1U28A 5L40A 1NP3A 1YB4A 4E33A 2GASA 3D4OA 1XU7A 3TPCA 2GZ1A 1BWSA 2W2LA 3RFTA 1GZ6A 5IDWA 1OBFO 3M1AA 5K0ZA 1IUKA 1Q0LA 2B4TO 4Y8VA 4R1TA 2R6JA 3HNPA 1Q7CA 1P1RA 5G2OA 5DN9A 4PG4A 4QT0A 3UCEA 4CM1A 4PVCA 4XQ9A 1OAAA 2NTVA 1NX6A 2DBZA 2YQ5A 4XB2A 1PL6A 4ZU3A 4BNLA 4XQGA 3HZZA 4NNJA 5JDCC 5IN5A 4RZHA 3C3XA 4XGIA 3TFQA 3V1YA 2NQ8A 3IS3A 2PWZA 2BGMA 5G0WA 4J6FA 1XWFA 2IRWA 2ZYGA 3PFWO 3ZHBA 2EW2A 2QG4A 4E12A 4CQMA 3WB9A 3ZU5A 1ZJZA 4CMEC 4MVJA 4OSPA 4BNTA 4CM3A 1K6IA 3O26A 1HDXA 1GU7A 2HJRA 2FN7A 3Q2IA 5JAMA 4NK4A 2FR8A 4BO4A 2UYYA 4XJTA 2POQX 3JYNA 4BNKA 2BLLA 3KEOA 3HFGA 1LC0A 4N7RA 1EDZA 5ES3A 3F5QA 1DLJA 4YR9A 3RC2A 1PJQA 4A5OA 3RCBA 5BSEA 4FJ2A 4FCCA 1EVIA 3AWDA 1PSDA 2X4GA 3INRA 4D45A 3ZU3A 1GQ2A 3N58A 1HL3A 4GGOA 3IOYA 4A10A 3RSHA 4F3YA 3KSDO 4CLRA 3DONA 4E2XA 1EK6A 4KTVE 5CDGA 3K8ZA 3VZPA 4FJ0A 1WXDA 1RM5A 4MPDA 2RIRA 1LLQA 3I9MA 4PLVA 3WGQA 1ZZEA 4BGVA 3KYCA 1ZIDA 3PZRA 1P1KA 1EUZA 1AE1A 2X8LA 4OGWA 3R0IA 3SC6A 2Z95A 4XR4A 3DQPA 1X0VA 1VC2A 2JL1A 2C7GA 1T1RA 2GNAA 3KV3O 1KVTA 4EJ0A 3ITKA 2A92A 4GQAA 2Q1UA 4GX5A 2Y99A 3LK7A 3PQEA 3G49A 2PV7A 3HADA 3CZRA 4YJFA 2IZ0A 1PJBA 2G1UA 4WLEA 4D0SA 1PQWA 2QQ5A 5GZ3A 4U0JA 1Y5MA 2O4UX 3L07A 1EE9A 4PRLA 1ML3A 5I9MA 3W4IA 2D8AA 2VNSA 4TZKA 2TMGA 3UAGA 1MXFA 3O8QA 4YJGB 1Z7BA 3ETDA 1IL0A 4PCVA 3AY6A 2HCTA 1KVSA 1VE9A 2HAEA 3M1LA 3U0BA 2VYNA 3KM0A 1JLLA 4GX1A 2G5CA 3ANMA 3U4HA 1YVEI 1HKUA 2RH4A 3SC4A 1JKFA 3ON5A 2Y1CA 4R69A 1LC3A 2LDXA 3PJGA 3MJTA 3OJ0A 2CFCA 2HRBA 2WSBA 4A2CA 4FGWA 4MVJP 3FNEA 4I5FA 3KO8A 5EL0A 3DDNA 2C07A 3D3WB 2O3SA 1PJTA 2GYYA 3SLGA 3ZWCA 4MVJG 1T2EA 3VAZA 1T1SA 3NJ8A 4CUKA 5KKCA 1PU2A 1Y8QB 4OAQA 1K0UA 3JD1A 3RBZA 3D5QA 2HRZA 1ID1A 1DIHA 2BD0A 2PTGA 4WLFA 3UCFA 1X1TA 1XA0A 1LSJA 3OH8A 3D64A 4DQXA 4FJ1A 3BXXA 1B8VA 4TQGA 4XYBA 3H6KA 1HXHA 4PLTA 3UHAA 1B3RA 3DXFA 1NPDA 1E1KA 4RV9A 4D43A 3FN4A 2OXIA 1X13A 2ZQZA 4WASA 4FFOA 4UVGA 3D1LA 5IF3A 1LDYA 2P9GA 4XRRA 5DDIP 3H2SA 1XCBA 8ADHA 2WEKA 2BI7A 3FI9A 5C3MA 1BG6A 1YO6A 3IIEA 4R5MA 4B4UA 2HMSA 4CMJA 5A5FA 3VZSA 1ZKMA 4GX2A 4ZVVA 5B1YA 4JQCA 1GPDG 5CEEA 1FDVA 4W9NA 2A94A 1EBFA 4R1NA 3LT4A 1Z75A 4A03A 2RBEA 3UVEA 3BMOA 2I65A 4AJ4A 3LLSA 4U5QA 5JS6A 1DFIA 1U8FO 1NYTA 1ARZA 5L9AA 4OJNA 2AQKA 1RKXA 4NQZA 4DVJA 4GVLA 2EERA 5A9SA 5F5LA 1HETA 3JD2A 4IMRA 4CR8A 2Y0CA 3I5MA 4F6LA 5AVOA 3RFXA 4XZ3A 1GZ3A 1DDOA 4BNNA 4E5MA 1JDJA 3ABIA 3KXDA 1D1TA 2X5OA 2DPGA 2O48X 4WCFC 4YJHB 4BNVA 1UXJA 1D7OA 3DB2A 1H9AA 5CG1A 1DEHA 1NQTA 4BO6A 4DBZA 4DQVA 3KUXA 4RF4A 3JD3A 4UAGA 3BYZA 3DOOA 2CVQA 3S2FA 2GERA 2VUSA 2O7QA 4JGBA 1J6UA 4PLWA 1O5IA 1DIRA 2B4QA 2FPGA 1ENPA 1Q7GA 4Y9DA 4Z3DA 1P3DA 4PLZA 1T24A 2PZLA 3W4KA 3H3FA 4FC6A 3K5PA 1SEVA 1VLLA 3GGGA 2YV1A 1I24A 1YRLA 5TQVA 4HY3A 3K31A 2VN8A 3I83A 2P4HX 3JSAA 3SBOA 4JBHA 3ULKA 1KC3A 2WTBA 1O9BA 3ZV4A 3EK2A 4CM9A 5BSHA 2YY7A 1K6XA 1U1IA 4HKTA 1YWGO 6ADHA 1IYZA 1DRUA 1LRKA 2VYVA 5G0SA 2AE1A 3GEDA 3IJRA 3RUIA 4MIOA 4EW6A 2DBQA 4U8GA 2BELA 2PKQO 2YJZA 4NBTA 1WMAA 1EUDA 5AYVA 5CEFA 1GQYA 1W8DA 1R0KA 1SB8A 5EN4A 1E7SA 2V65A 4BMSA 2DUWA 1B0AA 2WYUA 5H83A 2O23A 1LLUA 3HDHA 3RWBA 3OIGA 4O0LA 5TJHA 1KVQA 1HYEA 1TT7A 4UEOA 4R4JA 1P1HA 2W4QA 3QRWA 3WQQA 4OIMA 3ST7A 1KEVA 2BF7A 1Q2XA 1Y81A 2XPCA 3TSCA 3H65A 1YDWA 2VTDA 2WD8A 5H81A 5ITVA 1A71A 1C0LA 1ZJYA 2O4CA 3ANNA 3C24A 4JJIA 3L0DA 5L95A 1H6AA 3C7CB 3WS7A 4OHUA 4E32A 1UDBA 2HSDA 5AXBA 3DBRA 1XQ1A 1R4NB 4M8SA 5IJZA 4OH1A 1P77A 3HN2A 3AOGA 1UZLA 3K2BA 5DNAA 4R54A 1UP4A 3HJAA 1XYGA 2YFQA 3DBRB 1B8PA 1F14A 1PJLA 1QYWA 2BH9A 3FWNA 4MKZA 2V6BA 4QECA 1E7WA 4CODB 4FSHA 4J16A 4HADA 2QYSA 3RI3A 5A06A 3UKOA 3WYCA 4F6CA 1TLTA 2CUKA 3S8MA 4E13A 2BKAA 2G17A 3PQFA 3P7MA 3WLFA 1GDHA 3FWZA 2H9IA 1DB3A 1ZK2A 3WQSB 4OYRA 4I9UA 2Q2WA 2HMTA 3DZKA 2QX7A 3W1VA 2BGKA 4C7JA 1EUCA 2Y0EA 3MOIA 1T25A 4E21A 3E6AA 2X22A 2DUUA 3KEQA 4TMFA 3W8EA 1QORA 3I3OA 4CM8A 4LISA 4KUHA 5TGDA 5JPIA 3DZHA 3V5NA 4BGEA 5L7WA 1C0PA 5AXAA 3EMKA 3I1JA 3RAJA 5A4DA 2CF5A 2DM6A 3VTFA 4WOJA 2CNBA 5L3ZA 3DZFA 1E7MA 4IMPA 4EUFA 3D5TA 4IZIA 2O50A 4IUYA 3FNFA 3DR3A 1VJ0A 1X7HA 2X1HA 3IC5A 2G82A 1PZEA 4B3JA 1HDRA 1Y9AA 2BRUA 5LCXA 4Z3KA 4OMUA 1G6KA 5KOIA 3VOSA 3NJ4A 4CLEA 4DC0A 3GNSA 4PLFA 1ISHA 5L4NA 3V2UA 5I8WA 1PJ2A 5JCJA 2X58A 4RPLA 1UDAA 1LDBA 4WKGA 4B7UA 1ZXLA 5TS3A 3LF1A 2PD3A 3H9EO 1W0CA 2ZTUA 4GWGA 1ENOA 4YJDA 3OICA 1E7RA 2E37A 3PIIA 5JDCA 2HMUA 1GUFA 4N54A 5JE8A 1PGNA 2X0RA 4UVDA 1AXEA 1NNUA 1XQ6A 1IZ9A 4IJVA 4E6PA 4PG6A 2YDYA 1D8AA 4RPHA 4B7CA 4TKMA 4IDCA 4CMEA 4F46A 5ILOA 4D79A 4M89A 1DIAA 2NTJA 5T6BA 3KTDA 2GF2A 5THQA 3DBVO 1GCUA 1EVZA 5JBIA 1WDKA 1E3EA 4K26A 1IY8A 1I10A 3Q11A 3GF4A 3C1OA 3PTZA 3KSZO 4HFJA 2ZB7A 4RF3A 3X2FA 4ND3A 1OZAA 2EGHA 2WDZA 2Y05A 1ZSNA 4M86A 3PZBA 1EEHA 4UEJA 1DOHA 1BXKA 1IZ0A 3PHGA 3DZGA 3ZCXA 1BSVA 1HYGA 3HDYA 1X1EA 3N7UA 4BL5A 2VT3A 3PP8A 4CV2A 4D41A 4XA8A 5BQFA 3BHMA 3H9JA 1FK8A 2GSDA 3K92A 5IG2A 5HA5A 2HK7A 1T2CA 1U3VA 1SEPA 4RVFA 3GAZA 3F1LA 3E1KA 3BMCB 1R4MA 1ISIA 3ZU4A 5T64A 4GH5A 3VZRA 3JQ7A 1G1AA 5EPOA 3PGJA 1Z7EA 2O3JA 1SCUA 4BGIA 9LDTA 3JQBC 4CQLB 1IOLA 4PIVA 5HS4A 4IM7A 5COAA 3H9UA 1FMCA 4LSMA 1NQOA 1K89A 5G4KA 4WJZA 1PIWA 3GVCA 1T4BA 1YOVB 1ZXBA 2F1KA 4EZBA 4N18A 1DPGA 2AMFA 1CEQA 3C8MA 3UN1A 3QV1A 3IL2A 1G0NA 4R9RA 4EUEA 2QRJA 3GDOA 1FF9A 1Q0HA 3STHA 4XR9A 2B37A 3QVWA 4XGKA 1CQJA 4ALNA 4CL8A 5EESA 1SMKA 1VL0A 2RHRA 1WVGA 1YS4A 2OHXA 3UW3A 2JKVA 4YT8A 1QLJA 4P8RA 3Q9NA 2Q50A 2HJSA 1N9GA 4J1SA 3ANLA 5KWEA 2C82A 3H7AA 1F12A 1RJWA 3WTBA 5F5NA 4EGFA 2WJPA 2VZ8A 5C7IO 3L6EA 1N1EA 1U5CA 4YRDA 3KB6A 1RPNA 1IULA 3GZNA 1XELA 3GHHA 3FR8A 4XCVA 2AW5A 4DMMA 5JLAA 1B26A 4XKJA 1T26A 3DEYX 4W6ZA 2GO1A 1UR5A 3WLEA 3V2GA 2Z1MA 2H63A 3B1FA 3A9WA 4GL4A 3TWOA 4XQCA 3R3JA 4OXYA 1HLPA 1MXHA 2AEJA 3AM4A 3FSRA 3H3JA 1E1LA 1H6CA 2Y1DA 2BFOA 2D3TA 4NJMA 4CR7A 3OQ1A 3DMTC 4MVJF 4J1TA 4DYDA 5B12A 2A35A 3R1IA 3COSA 4J9VA 1CDOA 3E8XA 3O03A 4H15A 4MO2A 3HE3A 4YAIA 3EVNA 3OECA 3RC1A 4R41A 4RVHA 1QMGA 2W2LD 2E6UX 3ICCA 2JAPA 1U3UA 5DULA 1JAXA 4RDHA 3INGA 2WD7A 1CETA 3MJSA 4FFMA 5A03A 2VHXA 3PGXA 3HSKA 4TVBA 4IQ8A 2CSUA 3ZWNA 4IDGA 4ALKA 4CUJA 1A4IA 4YQYA 1ZVMA 4MOWA 9LDBA 4CMIA 2J3JA 3IUSA 4E3ZA 2NWQA 1R6DA 2C59A 2YHIA 3LLVA 2P2SA 2SCUA 4ZQHA 2GLXA 2Y1EA 3ZHZA 2OGUA 4NJOA 4Q3DA 4Z9FA 1Y6JA 3HN7A 2UV8A 1TXGA 3HFSA 2BMAA 1BDMA 4Q3EA 4RVUA 4ALLA 4OXKA 4L8VA 4XYGA 4B3IA 4NMHA 5GMOA 5I8ZA 2DPHA 1QG6A 5DCYA 5JAIA 1U7HA 4CQMD 4BNIA 3NRCA 5B37A 1VJTA 4LMRA 2ZTLA 4O59O 4U0KA 4NBVA 5MDHA 1OOEA 2NVUB 3PHHA 3O4RA 3BTVA 3G0OA 4PLPA 4WCFA 4DPKA 3GA0A 3JV7A 3U3XA 5I9LA 3GMSA 1MP0A 4Q9NA 2CF6A 4TROA 4AJPA 1T2FA 1I3LA 5T8KA 1B8UA 1J49A 3M2PA 4XDZA 3MCVA 5TT0A 5FWNA 3IKTA 4K1LA 1X7DA 1PQPA 1AXGA 4NU6A 2I99A 1DHTA 3NV9A 3T4XA 4J49A 5T57A 3OM9A 4GSKA 4XIYA 4D42A 4BKQA 4FDAA 3TDKA 4Z9YA 4J43A 1JAYA 1M6WA 4BKUA 4NHEA 5KJ1A 5G0UA 1I36A 1ZK0A 5JW6A 5JXWA 2FR0A 1YH3A 2ZB8A 4Z9XA 5CAEA 4IS2A 4FGSA 4BO5A 2B69A 3RUEA 4KWHA 1JU9A 5TC4A 3ZWOA 2JCYA 4Q39A 1HLDA 3E03A 1RM3A 2X5KO 2WE7A 4PG7A 3LYLA 4LRTB 3GNTA 5TT1A 5MGBA 3GVPA 1UXIA 3K2EA 3UFXA 3F46A 2FSVA 4PLGA 1SPXA 2CY0A 2IZZA 4QO7A 2VQ3A 3DAFA 3Q9UA 3E5RA 2P9CA 4UREA 1A4UA 5FI5A 5C37A 3OA2A 1BXGB 4XJSA 3IQDB 4M1QA 4XGNA 3Q0EA 2GN9A 3JQAD 3ZN2A 1C1XB 3WX0A 3ROPA 4L0QA 4CMHA 4FFPA 4TZTA 1FXSA 5COQA 4L4SA 2PKQP 2IZ1A 2Q45A 4WEQA 3LZ6A 3SEFA 4RGBA 3UH1A 3VDQA 5B4VA 1DFHA 1KS9A 1YQDA 4Y6SA 5DP2A 3GMDA 4ZRNA 5EINA 1JN0A 4GSLA 2BHLA 3C85A 1E92A 4RLSA 1U3TA 1I0ZA 3I52A 4ZQFA 3TFOA 1ONPA 2A9FA 2NQTA 2JHFA 1IPFA 3RU7A 1V0JA 2IEBA 4LGVA 2CVOA 3FNGA 4NFYA 4WUVA 4X54A 1A5ZA 1GY8A 2B0JA 3ICPA 1ISFA 4JNKA 1BVUA 1F0YA 2Y1GA 2GN8A 2GN6A 3UXYA 3GVHA 4HWKA 1E1MA 1DAOA 1K3TA 2DTXA 4BNHA 4RPGA 1PR9A 1NTOA 1DAPA 1X7GA 2GR9A 3AUTA 3W4JA 4UULA 3JQ9C 4CUZA 1KVRA 3K9QO 3NDJA 1NHWA 3WSWA 2D4AA 4F45A 3D4NA 3EAGA 3RKUA 4GPD1 2CDAA 2WWRA 5CDSA 4YCAA 1P31A 5BR7A 1E6WA 1NVGA 1OI7A 2P5YA 4IJUA 3O9ZA 3DBHA 5DZSA 1OC4A 3GFBA 3GOHA 3JCZA 3S1LA 1ISJA 3D0OA 3ZH2A 2GDZA 3HDJA 1DRWA 3DBHB 1QP8A 3GRKA 2EW8A 1FDSA 2H6EA 2J5KA 2W2KB 2DTDA 3DO5A 3PYMA 4URFA 4ZQGA 3GDGA 1GUZA 4CLXA 4B7XA 1IB6A 4YJGA 3LC2O 1TA4A 2DKNA 5ITWA 1PGQA 3F9IA 2GPTA 4YAGA 1MFPA 1IHYA 1SZJG 1VKOA 2BFMA 3F1KA 3VPSA 3RFVA 5DP1A 4NDNE 4BMNA 4J91A 4YQZA 1AN9A 2DTEA 1RYEA 3ZU2A 1I8TA 2O3TA 1YQGA 3GN1A 4EBFA 1UP6A 1EDOA 1LLDA 3D3WA 2EV9A 3JQAB 2G0TA 5LDGA 1E3LA 1T2AA 2O2YA 4RQUA 3I9OA 4RL6A 1NR7A 4MIEA 1ULUA 3WGIA 1EQUA 3UICA 4YDRA 3BMQB 1Y8QA 2CZCA 4ND1A 3RKRA 1H6BA 1HE5A 2X5JO 3I6QA 4LSWA 4PN3A 1BTOA 5DCUA 4I08A 3GY0A 1PGJA 4MINA 2VUUA 4IPTA 1BRMA 3GR6A 3I9KA 4CM4B 2I6TA 4OKIA 3NAQA 1RM0A 4FW8A 3DAGA 3JQGB 2NU6A 3WNVA 3H8VA 3L9WA 2Z1NA 4CLOB 4FIZA 3KYDB 3LDHA 4L76A 5EQFA 2DT5A 4EJMA 1GYPA 2C5EA 2PLAA 3OIDA 3OJOA 2NADA 4KQWA 4A7PA 1JKIA 1I5RA 1YONA 2B36A 4DLBA 2DC1A 1HDGO 4CL3A 4E5NA 1HE3A 4K28A 3FD8A 3ZV5A 5CDTA 4TRJA 5F1KA 1I2BA 4EEXA 2Q1WA 1BGVA 3PVZA 2FPPA 7ADHA 4DIOA 3OQBA 3B1JA 3BZUA 4QXMA 3ETEA 3LQFA 4LVCA 3G17A 1A27A 2QW8A 4FFNA 5T67A 4OQZA 3TRIA 4B4WA 4BVAA 5KIAA 2PR2A 4NI5A 5COBA 4CM9D 4HV4A 1WPQA 4JJFA 4DIBA 1KERA 5LC1A 2VYVD 3L4SO 3SX2A 2B4RO 3I23A 3CMCO 3N74A 1ISGA 4A26A 4YAJA 4LK3A 3HUDA 4RPKA 3NGLA 3CE6A 4II3A 4TRNA 5GZ1A 1ZK4A 4C4OA 1X14A 4BNZA 5KJ6A 4NU5A 2NVWA 4DWVA 2G76A 1AHHA 1XR3A 2HO5A 4J4BA 2TMDA 3H5AA 4YJHA 1ADGA 1L1FA 3ONEA 3JQBA 3T7EA 2AQ8A 1WDLA 4J7CA 1CYDA 2LDBA 2WM3A 1GYRA 2DFDA 3KHUA 3IUPA 1WAMA 4WOKA 4YBZA 2J5QA 5T8KC 4EUHA 1Q7BA 4JXKA 1DC4A 3ASVA 2OUIA 2WE8A 1GL3A 3GUYA 4BKOA 1ZMOA 1MUUA 4Q3CA 1Z73A 3DTTA 4DRYA 1GTMA 3WGGA 4XB1A 3WGYA 1UUFA 1A7KA 3DZIA 2IYOA 4EI2A 1WZIA 3PFFA 3RC9A 2EJVA 4I9NA 4JX8A 1B3BA 1WW8A 3KLPX 1PZGA 5FI3A 3K6JA 4YTEA 3WQRA 4DLAA 5FF9A 1X15A 1ZK3A 4AL4A 3ZWAA 1KEWA 5KJFA 3E82A 3ADPA 1SAYA 3EUWA 4QQRA 4M87A 4ZN6A 1DSSG 5IZCA 4DXHA 1PJSA 1N1GA 3MOGA 1XGKA 1QLHA 3O38A 5L45A 3U4CA 4RVGA 2HMWA 5I7EA 1GQQA 1S6YA 3OSUA 1FDUA 1MX3A 1GEGA 3G3EA 3DAPA 2YHUA 3BIOA 2CDCA 4IDAA 4Q3BA 5A9RA 1B15A 4WCDA 5ADHA 3EDMA 2I5PO 2EP5A 3KLMX 1HZZA 2VWPA 3DBLA 3DMTA 4XWYA 5CFZA 1ONOA 3I4FA 4GMFA 2C5AA 3ROMA 1DIBA 1UXHA 3MJVA 4ALIA 4MDHA 1PQUA 1PX0A 3CIFA 3VKUA 5EIOA 4R3WA 3DBLB 1PGOA 3S55A 4ZGWA 4KP7A 4OL9A 3KVOA 4Z6KA 2ZTVA 3RBVA 1R4NA 3U4DA 2PH3A 5A5EA 1U7TA 3VDRA 2FY8A 3GGOA 1V3VA 4MIYA 3S2IA 3EGOA 1C3VA 4UVEA 3AU8A 2ZATA 5BNFA 3TL2A 5JCJD 3UF0A 3WDSA 4BIIA 1OMOA 4J0FA 3CTMA 3PLNA 3S2GA 1ADFA 2DBVO 4H16A 1PR3A 5FEUA 4XYMA 1PS8A 2XAAA 4KDEA 4TRRA 4W99A 3VC7A 2AE2A 1NR1A 1JA9A 5JY6A 1U3WA 4LW8A 4XEHA 1N5DA 2VWHA 1XSEA 4DL9A 1Y7TA 3QWIA 2ZJ1A 4R01A 3MTJA 3C7AA 5H82A 3T4EA 2EKPA 2QHXA 1E1NA 5DOVA 3DHNA 1YXMA 1V35A 4IY1A 1KOLA 5C7OO 1D1SA 3TF5A 2WYVA 4E2YA 2UUPA 2Y66A 3ROQA 1D3AA 1SC6A 3K96A 4JK3A 4OXNA 3V8BA 1AHIA 2EGGA 5TX7A 4CMAA 1WP4A 1PJCA 4PZDA 5EERA 3IKVA 3W6ZA 2OMEA 4BV9A 3Q3CA 2NU7A 4JCOA 2AG8A 2UVDA 2X23A 1ZSVA 4RCVA 4J7UA 4KUGA 4O6VA 1WNTA 2JD1A 1LJ8A 1Z45A 1OFGA 1UAGA 4DYVA 4BMVA 2PGDA 5IAAA 2V6FA 2AG5A 4U6SA 2C7VA 3AFMA 4J4HA 5JY1A 3GGPA 1LDMA 1LRLA 3DWFA 1KVUA 1BXZA 1SOWA 2I9PA 1I3NA 3BTSA 1V8BA 4MVJI 4NFHA 2D5CA 4NPCA 5JFOA 2PGLA 2D0IA 4I5GA 4FOOA 5DT9A 1DLIA 4LCJA 5IXSA 2EEZA 4DQUA 2PZMA 1Z74A 3GZ4A 4YWJA 1K5HA 2VCYA 4HFNA 4JBGA 3QVSA 5KVVA 3I4CA 3JYLA 2NU8A 3RD5A 1CRWG 1ZBQA 3SVTA 4O63O 4CMKA 4YT2A 4DC1A 3DZJA 3QSGA 5CDUA 1YBMA 3UGKA 5L51A 1DJQA 1XG5A 1YJ8A 2ZB3A 1ORRA 4HX5A 4ND2A 3PDJA 2HKIA 1SOVA 3WIDA 4YAKA 3VH2A 3FNHA 4D7AA 2VRBA 4NR0A 1O94A 1UJMA 4NH4A 3B6ZA 4Y6RA 1UH5A 3I9NA 3EW7A 4J90A 4DUPA 4FC7A 3M6IA 4WNIA 2W98A 2E49A 4J0EA 5CEJA 2FZWA 4BO2A 4BNWA 1HDYA 4W82A 3TZKA 4LVUA 1TI7A 3HHPA 4QTZA 4R1UA 4D3SA 4YEDA 2X7HA 4B8WA 3PYLA 3W8FA 4AG3A 3LT0A 1HSZA 3AM5A 5HS6A 1VM6A 1C0KA 1QR6A 4IJKA 3NTQA 4B3HA 1S7CA 1Y8RB 3TZ6A 1FJHA 3KYBA 1R66A 2XOXA 3DC2A 3PK0A 3PPIA 4ND4A 3FR7A 4BNXA 4MKRA 3QY9A 1N7HA 3EYWA 4TVOA 1E6UA 3QIVA 2O2SA 3M2TA 4HP8A 3TZQA 4D0RA 4BKPA 1U5AA 3JQ9A 4R9SA 3QA9A 2Y1FA 4EJ6A 1LLCA 1P0CA 3E9MA 4H3VA 1MB4A 1ONNA 3H9QA 4IXTA 2VNAA 3EY4A 3BMCA 4YAEA 1EFLA 1XIVA 1SBYA 1IPEA 4Y98A 5JAQA 5L4SA 2JCVA 4OOFA 1J4AA 5TNXA 2J3KA 2Y93A 4W7IA 4CQLA 1YDEA 3R3SA 3Q2KA 2IXBA 3ZWXA 3F47A 4NBWA 1L7DA 4KOAA 3FBGA 2Q1TA 3OJEA 4CJXA 4XYLA 4BNMA 1YL6A 3NGXA 3KRTA 1EVYA 1YOVA 3OFSA 3GRPA 3OJLA 5F1PA 4MKXA 4JBIA 3ROKA 4JP3A 3U4IA 1LQUA 1UZMA 2FPIA 3GG2A 3NYWA 1VL8A 2F00A 5ENVA 3ENKA 2E82A 2P91A 1W73A 3AUAA 4PG8A 5BT9A 2YUTA 3L4BC 1UZNA 3E9QA 1PS9A 4W4TA 1YBVA 3JTMA 3ZWWA 2Y67A 2OO5A 2VOJA 4FN4A 3TNLA 1NQ5A 1JWBB 3AU9A 3JYQA 3RUFA 4BO9A 3AJRA 3FHLA 2NACA 4KTTE 1DO8A 3E9NA 3SXPA 2J3HA 4GKBA 1JKJA 1MLDA 3ZNOA 4BUCA 2J8ZA 1ZH8A 5IZCC 3ZWYA 2VOEA 4JP2A 1HT0A 1ZW1A 2GZ3A 5B4UA 1CF2O 3WGHA 1CQIA 4PGFA 4OKNA 1A9ZA 3ZNNA 3NDRA 8LDHA 1KEPA 1KBZA 5AXDA 4IXWA 4HUJA
chains in the Genus database with same CATH superfamily
1H2EA 1VYTA 2ZSBA 3MN1A 3ADCA 4MQ6A 4TKUA 5EP4A 1NJ5A 3C6YA 1H94A 2LP4Y 3AL3A 5IT9A 3QEBZ 1OVGA 5J59A 4E09A 2B30A 2H8KA 4KAFA 2A9VA 2YVQA 2WC1A 3AB3A 4MMYB 4QUKA 3BMXA 3VZBA 2HHLA 4B79A 1ZICA 3BQMB 1ZCJA 2CVZA 2P9ZA 3GGJA 4WZAB 3LY7A 2YASA 2P68A 5ICFA 1N6HA 1W94A 1JSCA 3A1VA 3EAFA 1EM8A 2LNDA 1XQXA 1E2KA 4OB6A 4ZXFA 3TZHA 3TVDA 4B6PA 1P45A 1PWHA 3TGWA 3CF6R 2Q5LA 3I39X 2RGRA 5HM6A 2XUQA 2BM9A 3H16A 4X90A 4I2NA 3BA1A 1YJBA 5DTMA 5EJ7A 4EEKA 2JH8A 2X5XA 4AX8A 4OMCA 3U3MA 2I67A 3JR3A 3NHAA 3GDHA 3L06A 2VRCD 2VG8A 1B76A 2D2IA 3VI3B 1IONA 3GUCA 1Q0RA 1FTGA 3I3SR 1H3FA 4LE2A 5C4MA 3F9CA 2Y1KA 1GUYA 4PFJA 3WYEA 4ASUA 3OJFA 1AO0A 5DSZA 3U3RA 1PW5A 2C42A 1GQOA 4KRGA 4URYR 4NCNA 4JJ6A 4KWCA 5CITA 4ZQEA 1GADO 3CNNA 3CSDA 4TPKA 3N86A 4X0EA 5IJAA 4E4RA 5DGCA 1WIWA 4YB8A 4G8CA 3TGPA 4TTTS 1P7WA 2GM3A 1VIVA 2XNKA 4HWOA 5IAKA 4K88A 2BR5A 2ZVPX 4UM9D 1V5FA 2XF8A 4TMVA 4M37A 3RAPR 3W1EA 3NDBB 2VQDA 3G79A 2AWOA 1SKQA 2J46A 3Q0TA 3COJA 5F4BA 4RKRA 3TKYA 5GM2A 3DVRX 2G06A 3O5AA 2BKEA 3NIBA 4QPNA 3OEYA 1JQ3A 2IYPA 2VK2A 3VR4A 4A82A 3AILA 2E3JA 4G65A 3VSBA 4IH1A 3GRCA 4WK6A 4Y67A 4YGYA 5HXAA 3A6HA 3F0TA 1XZPA 3ABOB 1YUNA 3LZDA 4QTYA 1EVQA 3I2HA 1N6PA 2FEMA 1MX1A 4AZTA 4ZYTA 3V4RA 1X8KA 4ISBA 4Q16A 3I01M 4J2OA 3EMBA 3RC3A 5BRNA 2H1IA 2JHCA 3NWEA 3LQ2A 5KU1A 3BHNA 3JALB 3LO8A 3ZBQA 1S3SA 4JP5A 2JJMA 3EC7A 3OX3A 1RZVA 4B17A 1PWYE 2V7BA 2C5BA 3OQMA 1SCIA 2PJDA 4RQTA 5EVJA 3EQ6A 3NT2A 1XTIA 1WU8A 5BNIA 4P92A 2VH2A 5CDYA 2YYAA 4LNHA 5BMVB 1E4EB 2YV3A 2YIDA 3OLWA 4DLLA 5BV2P 3C7DB 1SU6A 2BFEB 3OQPA 1TMOA 3MXTA 1K3FA 4WKNA 3ZDZB 4BB5A 1DMSA 2Q9AA 3L40A 4G1EB 3WK5A 3ND9A 4HDRA 2COEA 1HRDA 1MO6A 5A3VA 5J5CA 3RVQA 1C29B 2P3SA 3NTRA 4IS3A 3BK2A 1SC9A 2ZIZA 1OV4A 2HYDA 3ONWA 1LNZA 2CHQA 2B8TA 3VAYA 3N8HA 3W5SA 5A4JA 1J2JA 1CD5A 5BWOA 5HVNA 4KYVA 1TU4A 1K6JA 1DQRA 2DFKB 3M3PA 4OQQA 1TFRA 1ZK1A 5CT9A 4O1IA 5EQDA 2VSQA 3IDAA 5AIAA 2WSLA 4BUZA 1UL1X 1I1HA 2YQ4A 3RG2A 2ZYUX 4RKYA 1SCDA 5FNVB 2WF7A 1CTQA 3V9AA 1U81A 4HVLA 2I6GA 4O5OA 3CZMA 1S02A 5LIPA 5IUKC 2X2PA 3OIVA 2JFXA 2QYHA 1ZN9A 5TEWA 1T3ZA 2C31A 3GP3A 3HSYA 1JI3A 2WA1A 2JZNA 2H2WA 2B35A 2VHUA 3NEYA 2EKQA 4EKNB 3I9LA 1US8B 1NNSA 2RDMA 1T5OA 1BCSA 5P8WA 1C8BA 2WUEA 4LZLA 1R74A 3NCTA 3R3XA 4AMYA 2H1SA 2O8EA 5T4FA 3KQHA 2JFQA 3OEWA 1QE3A 1H1LA 4OA8A 4PO8A 5DWDA 4Q1EA 5EQJB 3CEPB 3VPXA 1E2HA 3CH4B 2VYND 3ILVA 4YUWA 1MG0A 1W76A 2YV2A 4CIYA 2QXYA 2B4YA 3D7LA 1F6BA 4GBED 3ZOZA 2VT2A 5AM0A 2V6JA 3GRRA 3NPAA 1C3LA 1I2ZA 1J20A 2Z5LA 3FTPA 2RHWA 3CXRA 1T4CA 3NV7A 5EWMB 1BEUB 4UM9B 4IRMA 4KR9A 3LDAA 1P1IA 3G5UA 4FVTA 2RH8A 4IIHA 4MW5A 3L0IB 2CJFA 3FHCB 4YT5A 4BFWA 5JPCA 1KYZA 1WCYA 3FSGD 4PXSA 3V4SA 3BL8A 4K9DA 1QGDA 2QZZA 1P4HA 1Z5ZA 2G36A 4MPPA 5CIYA 2CNNA 2DFVA 3D2AA 5IDVA 1Y3IA 2ZBVA 4FCWA 4NAHA 3SKVA 3RRYA 5K0TA 1XMQB 2O2IA 1MO4A 3F71A 2OHFA 5F51A 1U31A 3BCHA 2WKWA 2QD1A 3QVXA 4P4UA 1GFWA 5J1SB 3KSAC 1CEEA 1PYOA 1DEAA 4QRHA 2NSHA 1FL9A 1B0PA 1M6YA 2I3GA 4QDXA 4RAOA 4TM8A 5JVDB 1FDWA 2YWXA 3L6CA 5AI9A 1PAUA 3UM9A 3LI2A 3M1YA 2V5UA 4O4JA 1HBJA 4OI0A 2A59A 2I8LA 3OT4A 2XXJA 4OHKA 2H7XA 4P81A 4WTOA 1DKOA 4E3WA 4DZZA 3P26A 4MJXA 3UG6A 1D1QA 3OX1A 3L43A 3D6UA 5I9TA 3GLTA 3ESAA 4V2UA 2IXAA 5B7NA 3IAHA 1SQSA 3THRA 2F17A 1RC8A 5E3HA 2C5GA 5KREA 4MTCA 2ZK7A 2V0CA 3KAPA 4LXHA 1IPHA 2Q2QA 1VHLA 2Q6VA 4LECA 4PLYA 3KWMA 2XGOA 3CH5A 4EVSA 4D46A 1C14A 2J0EA 4R31A 4Y2HA 2IQ5A 3DLIA 3IQFA 3I2KA 4ZOLA 3VO9A 4H35A 1PLLA 3ORFA 5CA0A 1E8DA 2EKLA 1V9SA 1AX9A 5DYIA 3TR6A 1QAMA 1P19A 3I34X 3OZFA 1SCAA 1XNHA 1E60A 2Q99A 1RFGE 4LDAA 4O2BA 5KKAA 3OKCA 3WLJA 3EXAA 4BASA 1PHPA 2V7UA 2VJCA 1L9XA 4DR6B 1WETA 3LXMA 4F2GA 4NENA 1E3DA 2GZMA 2C7RA 4C7OB 3O47A 3KT6A 4ZT3A 4P1ZA 2ZE7A 5KOHA 1QONA 3TZLA 4KE8A 3CUSA 1ICEA 4DLVA 2AZXA 1M66A 3Q3GE 2EFEB 4K6FA 1OZFA 1Q16A 2Z98A 5GY7A 4WFIA 4N3CA 1ZCBA 5JO0A 2YHSA 1CUEA 3AR9A 1EFUA 2CHEA 1RWBA 2M32A 2OORA 2JGDA 2VZEA 3HWWA 1AUPA 1U2GA 4HWGA 3W2FA 3NFYA 1U0BB 4LJRA 1UKVY 5HJ2A 2WYHA 3DE0X 2YOHA 3TJZA 2HOQA 3K9FC 1G8JA 4EL0A 3G2OA 4B4OA 1P1FA 3TQHA 4EMUA 2X4IA 4NDZA 3ZVKA 3NAMA 4QPZA 2PZFA 5ALQA 4HRXA 2G70A 2FPUA 1H2YA 3LVQE 2HQBA 4MVCA 4MUHA 1KO8A 1QXSA 2A4KA 3GLVA 4PWZA 4TKLA 3ZW8A 1JIQA 3A06A 3O8QB 4S3MA 3W9BA 5IP5A 3SZGA 4B34A 4F3NA 3QFHA 2VHWA 3F7OA 1IK4A 1PS0A 1ECLA 2C3PA 4S1PA 3VVBA 1ZIXA 4L8WB 3ND8A 1DHRA 4UJ3A 3HO8A 1BMQA 3ZNQA 1O4VA 2EJWA 3FVRA 4PFSA 5E6SB 1OHHA 1Z0ZA 1PKEA 3FLMA 4I4CA 5DT2A 3T99A 4Z2AA 1AVTA 1ORWA 3B1WA 3QA3E 4Q34A 2FG6C 1GOTA 2G8NA 2GN4A 3I2IA 5JI3E 3JQDA 4LFBB 1BHO1 2D7JA 1L5KA 4CM7A 1Q7TA 1P44A 1E2IA 3FKJA 2MOKA 2IYQA 1GJRA 2DUMA 3AFNA 4QAQA 5J4HA 5F21A 1HY3A 4RK4A 1YB5A 3WFIA 4MV8A 1ZD1A 3ANXA 4QX6A 1OFUA 4P22A 2C7PA 1JHQA 2PKWA 4E5SA 1JP7A 5BSGA 1U4OA 2C0QA 3PWKA 4FS8A 3FUWA 4KEAA 2ZAMA 3OIWA 5JJCA 4EVQA 5JSFA 5LD2B 1GARA 2NTNA 4N8SA 1D2NA 2AFIB 3GDWA 4LHZA 1L5SA 1V47A 3C43A 1E6EA 1RM4A 1FRFS 4OK6A 1E1CB 3EHEA 3RF7A 1Q3TA 1KZGB 2H2DA 1XNRB 4FB5A 2ZRFA 2J3IA 1SVKA 1UADA 4EYOA 3QLVC 4RF5A 4BQFA 1OC2A 3LQ4A 5T3UA 3KKKA 5H4GA 1TEVA 1QQ7A 2ZE5A 3TPZA 4BFLA 1ZL2A 3CVVA 3EDCA 4NL4H 3GH3A 4GMGA 5CB8A 3UGQA 4IRXA 4ZEWA 2G5PA 3HDQA 1TIKA 2ZWVA 5AJVB 3SYLA 3IXMA 1LX7A 2NSDA 1NBOA 5DI3B 2QVGA 3V4OA 4BLOA 1Y1KE 3ORRA 1A97A 4PPQA 3AOEA 2OWDA 2Y76A 3HXTA 3BJZA 3TOZA 1QIDA 5I7RA 4RTQA 2PFKA 1EWYA 1VCMA 2GFQA 5DXAA 4EKDA 1W88A 2CWDA 4GSYA 4HPWA 3QVUA 3SR3A 4WCFA 1GAQA 4DBLC 2ICAA 5H68A 2JAHA 4K40A 4BNFA 4DM4A 3DMPA 2V7QD 3A28A 2IYLD 4P4NA 3MS2A 1RADA 4DUGD 2QJFA 2ONZA 5FWAA 1OPXA 3EQZA 5DPMA 4ZVMA 5HQJA 1LI4A 1AKVA 3CONA 3E2MA 4YAOA 3DTVB 1FP7A 1IIBA 1EHCA 1OWMA 3KR2A 3KTAA 4D5GA 5JADA 4FINA 3EZNA 4ZK6A 1JSRA 1CX9B 2ZRDA 1CY6A 3HKBA 4M1KA 3L4BA 2CNWA 3LU1A 3OIFA 5C3UA 1B8NA 2RHJA 2X9GA 1GL9B 3FVQA 3T1NA 3R3WA 1QKIA 4RVSA 2AI2A 4MI3A 2XYVA 4U7GA 1QS0B 3L79A 3JQFC 4LPSA 1VKNA 4PFKA 3GT3A 2AN9A 1TPYA 3PFGA 2YYSA 4Q3NA 1U0OC 2QQGA 1XCPA 1JR2A 1X42A 2CFSA 3HBLA 1COWA 4JS0A 4UTXA 4WNCA 5AUQA 1PFWA 4ECAA 4Z9AA 5KWVA 1CY7A 1JPJA 1NQAO 1BZYA 3DP7A 5C53B 3FGZA 2X0DA 2J9YB 4AP9A 1CS0B 3EWIA 3NP9A 3R2JA 2JHGA 1QSGA 1OXUA 3DC7A 4FHDA 4Q1FA 4CQJA 3AEUB 5A3QA 1YULA 3T9EA 1LK0A 4B3MB 2FFJA 2JVIA 1HE4A 4KQKA 4UUMA 3NUQA 4KFRA 3DFZA 3LYAA 3GPDG 3A27A 2L42A 4GP9A 5BORA 2JAQA 1KZ1A 1BA2A 3BHIA 4CV0A 1A82A 4EVRA 1KF0A 1BCRB 3CRMA 2Q9UA 3V1KA 4XDYA 1VJ1A 2RGNA 3LW7A 2V96A 3OLCX 2VTKA 3C74A 3DZ8A 5HTOA 2X3FA 1JQ5A 4OM7A 1EFKA 3H4VA 2EFJA 1SBTA 5JAOA 2EZ8A 4F7WA 1QFSA 3W3ZB 4ARAA 2SICE 1T5IA 4GYKA 3K0CA 4A0FA 3TQQA 1QU3A 2DMRA 3UJ6A 2DXIA 2ZUEA 4MULA 4WNAB 1G21B 1TAUA 4B8ZA 5BN5A 1DC6A 3CB2A 3HBFA 3OQ6A 7ABPA 1JHZA 4M55A 4O4HA 4YAFA 3VRHA 1GDDA 1DC8A 3KSUA 3FOAA 3HRHA 1JDUA 4S04A 4LRSB 2C4UA 5K6AC 5K9ZA 3NHBA 1CWUA 1UKYA 1HMYA 2G9RA 5FJIA 1PV2A 1UXKA 3RHFA 2O52A 4ENVA 2Z4RA 4HGZA 4MB6A 4Y6PA 1K6EA 4LJ7A 1Z08A 4RWEA 5E1MA 1BRTA 3EFBA 2VWGA 4C0SA 4PS0A 3GEBA 1Y6FA 3QY0A 1BA3A 1XZEA 2PSJA 3A6KA 1QVWA 3LSYA 2C3OA 3VR5A 1TJNA 2PQMA 3RVDA 3URMA 1QG4A 3DNPA 4TN5A 1XZNA 3ZR4B 2W93A 4LRYA 1XZLA 3G9QA 3LT1A 3LUKA 4YMHA 2GM9A 3TLGA 4D9HA 3EXHA 3P9CA 2X9LA 5JDIA 1TOAA 2G7ZA 2GHQA 3NKLA 2JFWA 1CP3A 3U4QB 3ZKWA 2X6TA 4BB0A 2ZTSA 2OLEA 1AGNA 1QH1A 4U6QA 1ZYUA 1PDWA 3T7RA 2ZCVA 4FS3A 4JVSB 4RL4A 4GI5A 5ENDA 2CLLB 5FBQB 3I62A 4PBTA 1EDDA 2C2XA 4OHMA 5BVGB 2ZAIA 4R81A 1WXXA 3IJPA 1PTKA 3K0EA 2PNFA 1WKVA 2EQBA 3AHEA 5GONA 3M5WA 3E9ZA 3WTCA 1VA4A 2XRZA 2QN8A 3PQ8A 3O9VA 4KV9A 4YRAA 4DGSA 3I28A 4CIAA 3MT0A 3KFLA 3OZWA 621PA 1W4LA 2XCIA 1QWSA 3B20A 2DWOA 1QIFA 2A2ZA 2F59A 3CNBA 3CZCA 4HG2A 3NT4A 1H5UA 3EVBA 4RU1A 5ILGA 4YYEA 5C18A 2XXBA 3AM3A 3N8GA 4MA4A 1HF3A 2Q6KA 3N0TA 3TNJA 4KMMA 3ZHXA 1T5HX 3GCDA 5FL7D 1ADYA 1PZHA 1QRTA 3WNQA 1PP4A 3CT4A 4B2YA 1BJRE 4C3VA 1XD8A 2O3RA 1Z12A 2VYCA 1X9HA 2O7VA 1LTHR 1LBEA 2IV3A 2FMHA 3M81A 3SU8A 3Q3EA 4ZQBA 1UT8A 2IEAA 4OV6B 3TSAA 2BKUA 1QHIA 4XEUA 4DY6A 5FH9A 5TLSA 1XFDA 4DV1B 3F5DA 4WPGA 1AV6A 3A14A 3DB1A 4KI0A 5LP6F 4HDNB 3NBQA 1YC2A 3UA4A 3ZWBA 1EUCB 5CPBA 2NXEA 1DX6A 4V1CA 1T43A 3DV0A 4M7WA 2L19A 1VCIA 2XE7A 3JRXA 2R6ZA 4PO3X 1I0IA 4Q9HA 1I33A 4R68A 4ZODA 3PKJA 4A73A 2FE1A 5L7YA 4RH3A 1VP9A 3NIGB 3AEKA 3JW8A 3MXOA 1Q19A 2WPDD 5ETJA 3V1TC 1O7JA 1G2IA 2JIZD 3EVTA 4KFUA 1UDRA 2A78A 2D62A 2ZJ0A 2ADOA 1GL7A 2VA9A 1IWBB 4HJXA 1J33A 5EAIA 3VPFA 2HRCA 3C4VA 2R62A 3RVRA 5BY2A 3NEAA 1A8SA 1P9OA 5I7VA 2OGWA 4WBNA 2OFOA 2HPVA 3L41A 5KQMA 3D02A 2JD2A 3Q7EA 2I62A 3WL3A 2G0AA 2QLTA 4H4DA 3RWOA 2YZMA 1FNCA 4Z4EA 2C8VA 1QV6A 4Q5IA 3U48A 3HB5X 4FNOA 5INTA 5K6RA 3CUKA 1JW9B 2VF5X 3IOCA 4M1ZA 3SC3A 3AZOA 2PK3A 4KG7A 4WXPA 3OJXA 4C89A 4IOMA 2F9LA 2A4MA 2DAPA 3AB7A 3OPYI 1M6NA 4MVJH 3D7KA 1C4WA 1B6TA 1M67A 2A67A 2QDXA 5HG0A 5TF0A 1TECE 3FFAA 1AK1A 4MUAA 1Y8RA 2AT1A 2HSEA 3QVLA 2X0NA 4DJTA 5BXQC 3QPWA 4LE1A 1YE3A 4LY3A 1J2YA 1KI7A 3NHLA 3HTXA 4IRUB 1LQ2A 3HBMA 1V1MA 4EB3A 2Q4OA 1YDMA 2AXPA 1BMDA 4QOJA 4A2WA 4AS3A 4KQ6A 1BE8A 1MG5A 1UWVA 3QENA 4UPVA 5HIKA 2FRXA 1FP6A 3A10A 1G4HA 2X0KA 3COYA 3KR0A 1N5JA 3QW4B 3FPLA 1H8HA 3D3QA 4RSGA 3NT5A 4LXIA 4UEKA 1KKMA 4JU9A 2H06A 2VHZA 3X1XA 4YMWA 3VSDA 1TM2A 4TMTA 1M6VA 1WMBA 3BG5A 4NICA 3WGKA 4POAA 1Y9EA 3SC2A 4Y2YA 5T41A 3U16A 1FFAA 2JA2A 1IQUA 1WP9A 1R0XA 2WMOB 3QIAA 1CF4A 4I3GA 3RIXA 5AOAA 1O0BA 1TB4A 3OSZA 2QVCA 1TKRA 4OP2A 3ZI7A 3WYAA 1ZSYA 4R2LA 1EX9A 2OQ2A 3T5GA 1E32A 3QLTA 3RTEA 1Q0SA 2Q6OA 4Z7QB 3FUCA 1ZJ6A 1J06A 3EG5A 3ID6C 4FGKA 4LCEA 4HEA1 3T1YB 1RT9A 1ZUHA 1WW3A 2C29D 2OZLB 2XZTA 3DMHA 3HCBA 1JDPA 2DUNA 4Q9DA 3ZVNA 1Y3CE 5CU7A 3VTZA 4X61A 4WLOA 2YRFA 3ITEA 3Q15C 4OAOA 4U7TB 3ZY4A 3OLVA 2C78A 1IQRA 3U49A 3GLRA 1T5LA 4DGQA 1U2TA 3VKHA 4D3ZA 3HJHA 5A2QA 5LDHA 1WDMA 3A1DA 4ASUD 3DNMA 4DR4B 1WB9A 1FYVA 1NBIA 4UKDA 3SHOA 2CNOA 5CM2Z 3WV5A 3DP9A 2NNLD 3PYXA 4MV9A 3TLZA 1ADJA 3I6IA 1IHDA 3LFTA 3IQIX 3ML1A 4MS3A 3H8JA 4HAWA 4N5IX 3ADKA 1X9GA 3EDYA 1CULC 3GQVA 3LW8A 5AI5A 1THMA 3GT7A 2UVPB 4RHEA 1XDWA 5BSTA 4YRIA 2HFJA 1X1SA 3D7MA 2CLEB 4GOND 2MR5A 3OTGA 1AIPA 3ZDQA 4BO3A 5LMCA 4IKPA 1QNFA 2C9BA 1D2GA 1BH2A 1USUA 4GWKA 3RVMA 4YJ3F 5KVCA 2P6MA 3ZDFA 5JTTA 2XCLA 2GX6A 2IS1A 2ES4A 5DBFA 1ODKA 5EXPA 1I3KA 2R7MA 1N7JA 2AQIA 3PCXA 3G1TA 4OUKX 3HB4X 3PQ6A 2XNCA 3WRVA 3WLRA 4XGRA 4YDQA 3J80A 5KKNB 2A88A 3U7FB 1WD5A 1DUSA 2BDEA 1DV2A 3QOWA 3P4XA 1JZSA 2QS9A 4X65B 3PEFA 5HRUA 2H54A 1YTLA 1B7GO 2EF1A 4MMZB 1NFFA 4NBLA 1HURA 3TG2A 4IXDA 2DKFA 1GPNA 4L5JA 2BCEA 2EQ5A 3NM4A 1NM5C 4E5PA 2JLXA 1G7SA 1V8FA 1XMVA 2Q4EA 3LP6A 5C8YB 3E22A 5DHSA 3PJFA 1K63A 1XNGA 2FYTA 3LWDA 4ZI7B 3SLKA 2W6MA 3MZ0A 1OXXK 2A3RA 2ET6A 3IEIA 1T6BY 1Z38A 3ELYA 4GPBA 3MLBA 1P33A 4AQ7A 1E94E 1AM4D 2GILA 3CEAA 4B9AA 2GN2A 5LBIA 1JFLA 3U7IA 5TGTA 1SB9A 4AJNA 1ODCA 1ETUA 1QO7A 2DR3A 4A91A 1YD7A 2C8KA 2Z56A 1ZD4A 4YRMA 2P6RA 1D4FA 4A0RA 4LFAB 1YHYA 2AYYA 2IK8A 5IUJC 2HA0A 1IN5A 4CMCA 2YW2A 1OWOA 1ZH6A 5DO9A 3SJUA 5E1OA 3D7NA 4PQRA 3AT1A 5ISMA 3A1NA 1KC1A 4FNAA 4CM5A 4KMSA 4EB6A 5FORA 3SQDA 5IXYA 4OU4A 1LPOA 5ALNA 2L17A 4GLJA 1XRRA 5C5EA 1UJ6A 2OFWA 3NM5A 1QIEA 4HGRA 2B4AA 4LC9A 1NPYA 4IDDA 5IVIA 1Q6YA 1ZR4A 4XFJA 4GLOA 1THZA 3TDMA 1YL7A 2OBMA 3OI7A 5KQPA 4NJMB 3WK6A 1ZRNA 5TB5A 1FXWF 2XI4A 4WLUA 2GCOA 5C34B 4MP6A 4AZVA 9GPBA 1Y5LA 3QVVA 1N3LA 4O2AF 4TV8B 4F2WA 3EEBA 1O4WA 3GLSA 2C2KA 4I36A 1NJFA 2HF2A 1BNCA 1F5SA 3LBHA 1X94A 1LXCA 2WJIA 1FU8A 2RK3A 3TD9A 1ZEJA 1Z2PX 1T4DA 4LJLA 4P5EA 5JZMA 3M4NA 1SCJA 4CMBA 3HU5A 2PX5A 4K8OA 2E4YA 5KOJA 1EK0A 5KB3A 2ZTMA 4PHGA 1YRWA 2R6CA 3BILA 3FUUA 2OWEA 5JAZA 3H5OA 3KP1A 5CP8A 4ZO7A 1JECA 3WRYA 2WG2A 4EYGA 3OZ7A 4JUCA 3A1SA 2VHYA 1OROA 4OQXA 1W93A 3M4XA 3M6FA 4PLHA 1JG2A 3MAGA 4OM8A 1VI2A 3S2EA 4HQLA 3R40A 3SJAA 2P5SA 1EMDA 3LHDA 4CMIB 2AJLI 3GCWA 5IDXA 1XTVA 1HZJA 3K05A 2SCUB 1JR3D 2J08A 3PFBA 3N8IA 4MS4B 2B9EA 2FUCA 1CVRA 1WKBA 3NBAA 4NK5A 3H11A 1RI5A 3F96A 4A8JC 5AW7A 2BF4A 4INPA 4WK2B 2AEFA 4OB8A 4PHHA 2RHCA 3AETA 2GUWA 5I9SA 3WICA 1E2FA 2OK8A 1ZO8A 1FLVA 1N92A 4MP3A 1OA0A 3DXYA 2GPNA 4P33A 4YACA 1QV9A 1PL0A 3F6YA 1GCAA 2QLNA 3PTLA 4KQXA 5BSKA 1LI5A 1BX3A 2G71A 1T0UA 3L77A 3VU9A 1XTJA 2IW1A 4BFTA 3MJCA 5HRCA 4Z4GA 3H4TA 1JLSA 1U9JA 2I3ZA 1PV1A 2X77A 5E8JA 5HF6A 3KZMA 1P7ZA 4NG5A 4ZVTA 1LJUA 2A5GA 4LDJA 4DWJA 2QY6A 1DFGA 1EGHA 3ACBA 4R16A 1UMDA 3QX7A 3UXMA 4AYXA 2WJ4A 1SBHA 3R41A 1Y89A 5JYDA 4PO1A 2OVBA 4WXYB 5GV7A 2FPKA 4NBNA 2ZWIA 1XO1A 4HOYA 5FI1B 3RM3A 1IZ7A 1LDNA 1JXMA 3VYVA 5KQLA 4C3UA 1RPTA 1C7RA 1J8FA 5CAEB 2EF0A 1RSZA 1KRWA 2GASA 3D4OA 1XU7A 1BWSA 3AMVA 1GZ6A 2ZT8A 5B3LA 2GXSA 2KHZA 3AVOA 4GKKB 5K0ZA 2GD0A 4HB0A 4YREA 4RTJA 1J00A 4R1TA 3EZXA 3HNPA 4MKIA 4NYMQ 3QFCA 3Q12A 2WJ6A 2PRYA 1V4NA 3QELB 2ONYA 3G9UA 4QT0A 5D8DA 3UFXB 3LL4A 4CM1A 1QGED 3LA6A 2NO9A 4XQ9A 5F35A 3ED1A 1NX6A 3NNNA 4FWTA 3LCMA 4H7EA 4RKFA 1NBMA 1Y3HA 4YIKA 4JI0B 1GGJA 1R5BA 4CI0B 3ENWA 4XQGA 2WJGA 3AF3A 3HZZA 4NNJA 4AP5A 2B82A 3KE8A 2WLSA 1IDOA 2QI9C 5IN5A 3V46A 1CUDA 3SF8A 3AP2A 1N2GA 3RARA 1NVVQ 3V1YA 1ELOA 2PBFA 1JZTA 2ZYGA 2GS9A 5HKAA 2FZLA 2R8EA 4ZALA 1I3CA 3JPYA 4CQMA 3ZU5A 3BBPA 3UHOA 4NE9A 2MSCB 1OT5A 2FW6A 2XW6A 2ZR9A 4BNTA 4CM3A 4BECA 3NYIA 1I2DA 5DMHA 3VJRA 3OF5A 2JEYA 1MOZA 2EJBA 4IJ6A 5KYYA 1Y9DA 2VP4A 1N6NA 2FN7A 2BUCA 5AW6A 3VNRA 3G2IA 4BO4A 4MLCA 4F6RA 5ED4A 3E4CA 1Y4AE 5IKMA 1GDTA 2J30A 4N7RA 1CUBA 1EDZA 1IUPA 3BM5A 3PR1A 1OHHD 3UAOA 1DQNA 2IIQA 3CT6A 3LKZA 1OPRA 2DPLA 2QU8A 4FJ2A 5BSEA 3O3MB 4NULA 4A2QA 1KYYA 1PSDA 2YWRA 3INRA 1MQ8B 3UMFA 4H77A 4GGOA 3N58A 2PRJA 1NR5A 4M9CA 5C1IA 4L50A 1KXJA 3D43A 3GP5A 2C98A 3BGOS 4O8ZA 3KFVA 2ERYA 4UAVA 2XOKA 1U2ZA 5KI6A 1WXDA 1SBQA 1YT5A 4FMCB 4RXUA 4EA8A 3BF8A 1X7XB 4H0CA 3VYSB 4DDKA 3RO7A 1GSHA 3OT1B 4A16A 4DMKA 1ZIDA 1WZCA 4O4IF 3BXFA 3R20A 2IF2A 2Q3DA 1JIJA 1O3YA 2XQVA 2RB4A 2Z95A 3FDJA 3IIKA 4M1WA 4PYKA 2WWXA 4RTOA 1E89A 1SVMA 2QX8A 1T1RA 2YJ3A 1FPMA 5IAEA 4Z2YA 1ZN7A 2NPIA 4MRVA 2AC2A 5DYGA 2UKDA 1QK3A 1T9GS 3MFQA 4WHMA 3R8FA 2PKYX 4Q4LA 4PM4A 1GQFA 3LK7A 4YJFA 3X2FA 3OQHA 5MDHA 1PJBA 1G8PA 1GUBA 2C9MA 5A2GA 1RXIA 2PA0A 3K8OE 3MILA 5FAKA 5GZ3A 4U0JA 3A1WA 3OFVA 3LV8A 2O4UX 2RKWA 1ML3A 3W4IA 2D8AA 521PA 3JZAA 5KTNA 2VNSA 3TQTA 4XIIA 3FGOA 4ARVA 4S1WA 4YJ2B 2XVMA 4LF5B 3NOOA 2RH5A 5G1OA 2X3YA 4PCVA 1XL0A 4ZWNA 1CPYA 2D06A 4JYBA 1TZBA 1WUYA 3F67A 4K2AA 5E7MA 3SOZA 1Z4OA 3THWB 1N2ZA 1JLLA 7AT1A 2R9VA 2G5CA 2HA5A 2EARA 3ANMA 4IFBA 3U4HA 3AL0C 1FMTA 2RH4A 1NBME 4X66B 1GG9A 2Y1CA 3CF4A 2PDAA 3FKQA 3K9NA 3OJ0A 2CFCA 4BP9A 2Q5FA 1Z8FA 4DABA 2V7EA 4I5FA 3NS7A 5EJFA 1HPLA 1L3CA 2LUOA 4HB2A 4P7GA 3V7YA 4MUKA 4EB8A 2HXGA 3NIWA 5BV8A 1KDVA 5LUAA 2CNWD 4TN1A 3A6DA 4NMMA 1STOA 2JIQA 2O3SA 4BLRA 4NCAA 1PJTA 2ZSHA 3EXG2 1SRRA 3IA7A 2O0MA 3NRBA 4MYCA 1T2EA 4IHJF 1T1SA 2ZLBA 3NJ8A 4P83A 4EY8A 4EHKA 4W5TA 2I4LA 4I4TF 1II9A 2C77A 3ESQA 4MQUA 2SKDA 4QJ4A 4WY5A 4XDGA 2HRZA 1OI4A 4IILA 2FDCA 4JLMA 1RQLA 1A9RA 1DIHA 1WR8A 4FUQA 3A8TA 1GSIA 3KC2A 2PTGA 4JENA 4KO3S 5K2MA 3FHOA 1D03A 1XA0A 2O5RA 1LSJA 3FHJA 3ECSA 5H3CA 4MUFA 4X5OA 1B8VA 5ERYA 2NX2A 5I7UA 2DT8A 3AR2A 5JIBA 1IY1A 4PLTA 2ZS8A 3UHAA 5K2OA 2O59A 5LZ8A 1E1KA 4RV9A 1Q5PA 2NU6B 1BOFA 1VPVA 3FMPB 4JB0A 1N6IA 3PA6A 3OF3A 1T15A 2XQJA 4UE3S 4WASA 4UVGA 4CTKA 2VNHA 4F5YA 2D1TA 1LDYA 2JH9A 3STYA 1EU1A 3MW8A 3IERA 3M82A 4MUXA 4NCJA 2WEKA 2GEFA 5B1SA 4OLJA 1D4OA 2YIJA 1EGVB 1NOIA 5J2UB 1MNAA 4AUNA 4R5MA 1EFPA 1YCHA 2J67A 5IBQA 2HWKA 2JJ2A 3RB8A 4CMJA 3OPNA 5BYJA 1P29A 5A5FA 3HLYA 5B1YA 4ZVVA 3HJUA 3QX8A 5K51A 2GF9A 4IGIA 4WA7A 1RAAA 3VI4B 3FOZA 1GPDG 5BW4A 3WMFA 4J0GA 1IHUA 4R1NA 4RFSA 1E3QA 1DUIA 2VDLB 3AV0B 3BMOA 4Q4HB 1ZJJA 2VPPA 4FOPA 2ZRHA 3LLSA 1NKSA 4AJ4A 2O2ZA 3IHWA 1EA7A 4AZ0A 3A2LA 3K0KA 4JI2B 2WB4A 4NCIA 4G1UC 3AL2A 3O1JC 2ONCA 4GXNA 2ECOA 3P94A 1NULA 3EQ7A 2EERA 3N2NA 5A9SA 5F5LA 4ZT7A 5BV7A 4IMRA 3VJKA 2OO7A 5TQ0B 1ISRA 2MSWA 1M1NB 3I5MA 4BQEA 4F6LA 5AVOA 1KMNA 4MMXB 3VR5D 3REQA 1DDOA 1DXQA 5DYYA 2G0NA 8GPBA 1D1TA 2DPGA 4N8EA 4WCFC 3RRMA 1U7ZA 3RU2A 1E6CA 3T7IA 4RCZA 2IHBA 1XI2A 5EY5B 1D7OA 3UO8B 2V59A 3DBOB 3QOFA 1DEHA 5JYCA 4RF4A 3JD3A 1XV5A 4RVOA 1G42A 5JEEA 3HLTA 1WLSA 2QX6A 1BHQ1 3QKSB 3S2FA 2WUVA 3QOYA 2II6A 1EDEA 1SOAA 1Z2NX 5DNYB 1R4ZA 3O4FA 1XA4A 1IRXA 1XJQA 1LPAB 2B7CA 3K6SB 2DLCX 4NV1A 2QP3A 5EZYA 1G19A 1JYEA 3WO1A 3RGGA 4FHEA 4AXXA 2FPGA 2P69A 4DQKA 2H7CA 1FB5A 1VIAA 2VCEA 2EKBA 1RHRA 1T24A 1Y3BE 2CZGA 2VIIA 3BJMA 3W4KA 4W5QA 3DDUA 1VYUA 1FSPA 3NWOA 4B84A 6Q21A 1U28C 4WD3A 1W34A 4ENSA 1VJRA 5KSWB 3KQTA 1IXRC 3K31A 3JSAA 1QHSA 3MLAA 3T52A 4IJ5A 3ULKA 5M7EA 4XM2A 3OKAA 3DEJA 1O9BA 3H05A 3EZGA 3TL6A 5BSHA 2YY7A 5FEMA 4OJKA 4R1PA 4HKTA 4RE5A 4WJKB 4CNBA 1ISPA 1GNRA 1YWGO 4U2CA 3O8OA 2N42A 3M5PA 4DCSA 1MB9A 1LBHA 2RFLA 3UPTA 3M49A 3RUIA 4JI8B 2FUEA 5IJ9A 2R1VA 2DBQA 3BF7A 3G0CA 3MMSA 4EW6A 4IIFA 3DPUA 1GQYA 1XD9A 5CB4F 1ODLA 4N0MA 5F78A 2ZBUA 3Q8MA 2J45A 4C2UA 1SB8A 3G85A 4RM2A 4I19A 2V65A 1LY1A 4BMSA 3AHFA 1F6DA 5BRJA 3UAZA 4ZZ1A 1U7DA 1ZVVA 4YONB 2WIBA 3TINA 3PI6A 2P1DA 1RXUA 3E61A 1KVQA 1YOBA 3B9QA 5TJHA 3UV3A 3WLTA 1M0EA 3AR3A 4MCIA 1TT7A 5DHTA 1S2LA 4UDXX 2DH5A 3QRWA 3SNHA 1N5IA 1FA9A 1TF5A 1KEVA 4OP1A 1RXCA 1DTSA 2BF7A 3OTQA 1SUWA 4BFCA 4JNCA 3GLIA 2XPCA 2DFPA 2YQZA 4XH9B 3TSCA 1KYIA 2WD8A 5H81A 1QHEA 1A71A 1C0LA 13PKA 1Y82A 2O4CA 2QVXX 3ANNA 3C24A 3M6XA 2QUHA 4IDQA 1B1AA 1RPAA 4R6WA 3C7CB 4E11A 4O0MA 3A1TA 1V48A 1SVNA 1UDBA 2HSDA 3BGDA 3OQJA 4MWCA 4AMGA 1XQ1A 5C46F 1RVV1 1WV0A 1IVNA 2K2WA 3M9LA 4UMFA 4B40A 2QK4A 3GLHB 4O3FA 2VDQB 2QP4A 4OH1A 4Q4DA 3NBFA 2R6DA 2YWFA 3LBFA 3AOGA 3C41J 2QG9A 4QA9A 2QRVB 2QTGA 1G4AE 1LPBB 3HJAA 4KL8S 3HS3A 2HBYA 1USIA 3P0IA 1QYWA 3HV2A 1V2GA 3BXPA 4FONA 4G1CA 4MKZA 1N5LA 2V6BA 4Z9YA 5IKPA 1EFAA 5BN1A 4ICIA 2M6KA 4GOMD 4Z7JA 2G88A 1XVLA 3K0BA 3RI3A 3WWDA 4BQIA 3DE4X 1WV1A 3V7FA 2DSNA 3VVLA 1TLTA 2PGXA 2OYSA 3S8MA 2BKAA 4F6CA 3MWGA 2ZI7A 2R79A 5E6UB 3P7MA 3WLFA 3WGLA 3P9PA 4OQDA 4R1MA 4BQSA 4EA9A 1P0MA 3HCPA 3L49A 4KX3A 1SUAA 4I9UA 3ZHTA 1RHQA 2IUFA 2R6R1 3LYHA 1B6RA 1X80A 5SZKB 3DZKA 5IARA 3W1VA 5BPFA 3MJDA 3HUTA 1CB0A 1H8HD 3P0JA 1UXOA 1XEFA 2Y0EA 1F4PA 1U11A 2Z2XA 2LIPA 2WI8A 1ZM2A 2ARKA 1AMUA 5EUBA 4IVQA 3IV6A 1B1CA 3BVPA 3I3OA 4KUHA 2BPOA 3HFJA 3V5NA 1BQ3A 4BJ6A 2I1QA 2H1RA 3DMGA 1C0PA 1ZVKA 1JHAA 4M8NE 2IYVA 5AXAA 4P3XA 1YA8A 5A4DA 3N59A 2TRSB 2N1BA 4WOJA 4BFVA 4XUCA 1QAQA 5L3ZA 3DZFA 1E7MA 4MH0R 2R6HA 4MW6A 4BVJA 4LTDA 1PEYA 1TIBA 3OFKA 3OPXA 1GT6A 4CKYA 4IZIA 4EUFA 2O50A 1SKAA 4E03A 2DPYA 3MA0A 5BV1A 1OFTA 4ZCIA 1VJ0A 4YCLA 3EIEA 3QPUA 3QUBA 1TUBB 2YNMD 5SYMA 3SHFA 4LTNA 1P4GA 4EUSA 3OE7A 2VKQA 3JATB 4J76A 2BRUA 1UJ4A 1ZM7A 4I50A 5KOIA 3PHCA 3KUDA 4DLWA 1FX0B 2QMYA 3SBXA 1ISHA 1YU9A 3TIVA 1L7NA 3V2UA 4L16A 4G86A 1UWKA 2CBZA 1J1IA 1QFJA 1EAYA 3CUUA 2DKOA 2P35A 3NTXA 4A9AA 4C0XA 2XDYA 4BZXA 1Q83A 5JNRA 5J43A 4EPTA 3MF4A 1NC1A 3ZHSA 2HDNB 3FWYA 3QE4A 3OICA 3N0WA 3AVVA 2E37A 3SHQA 2WABA 2FW0A 3RK4A 1EWVA 2I7VA 4JITA 1PGNA 1U8YA 3GJ7A 1OTXA 3BL6A 4OI1A 2WIKA 3A37A 4YXWA 4MQFA 1CZRA 4FYKA 1D8AA 3VU3A 4B7CA 3EIOA 4U2GA 4N0PA 5TDHA 3TOSA 4M89A 1DIAA 3IH5A 5T6BA 2ZJ2A 1G7CA 1LWNA 2Q8QA 3N3AC 5THQA 3DBVO 3T7KA 4MA5A 1HX7A 1Y1SA 4DLSA 1THGA 4B5LA 1O57A 4ED9A 5I3CA 2R96A 4BX8A 1LS6A 1I10A 3Q11A 4X8OA 1XKXA 3C1OA 4WZ6A 1R18A 3WDKA 4AURA 3QKRB 4D3YA 5JXIA 1AS2A 3CM0A 5KYNA 1OZAA 2Q7XA 2WDZA 4M86A 5AMXA 16PKA 4UEJA 1HFEL 3BQNB 3E9DA 2YXEA 1UK6A 3KUUA 3JAWA 1K9SA 1MV5A 4RSRA 3ICEA 2IV7A 3A1FA