4AJEA

Rat ldha in complex with 2-(4-bromophenoxy)propanedioic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
330
structure length
327
Chain Sequence
ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 113
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajeA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajeA02
5DOVA 3UH1A 1KC1A 4R3NA 3UUWA 1I32A 1PZEA 4KTTE 3DXFA 4XB1A 4JN6B 3WXBA 4HWKA 3GK3A 3W8FA 4K9DA 2IXAA 1DHTA 2P4HX 4UVEA 3U4IA 5DCWA 4Z3DA 4Y98A 1AUPA 4NHEA 2UV8A 4YAEA 3LVFO 3K2EA 4BQPA 1T2AA 4CQMA 3WSVA 4K6FA 4CMCA 1D3AA 3WTBA 1ZXLA 4XYBA 3PJEA 3NGLA 3R0IA 4BNTA 4BNKA 1ONNA 3BMOB 3E5RA 1PL6A 3GDFA 3INRA 3GNSA 4OYRA 2Q1WA 4BGEA 5IZ4A 5KNLA 5LDGA 2RAFA 4A73A 2Q49A 4XIJA 1U3UA 2Z5LA 3BHIA 3LU1A 3QV1A 2DAPA 3ANLA 3NAQA 2Z1MA 3KVOA 3LQFA 1HE5A 4BO7A 5A9RA 3A14A 4LRSB 2ZCVA 3HDHA 1P1HA 4JBGA 2GN6A 3WIDA 4BB5A 3GVIA 3I83A 1A4IA 1F06A 2BHLA 1N9GB 1Y8RB 4RPLA 2VWGA 3VDRA 1BW9B 4E2XA 5DN9A 3KSDO 1YRLA 4RVFA 4CQLA 3WDSA 2B5WA 4DQUA 2PD4A 4EBFA 5AXDA 1Y5MA 3C3XA 1U8XX 1QXSA 1ZZEA 2O48X 1HSZA 1DJQA 3ENNA 3R1IA 4FBGA 5EQDA 3RROA 1X7GA 2Q50A 4NBWA 4ZRMA 2ZTLA 4YWJA 5BSFA 3U9LA 2CDBA 3FTNA 1RWBA 4NBUA 1YVEI 1F0YA 4F3YA 3H6KA 5EJ2A 2JD2A 4J1NA 2TMDA 2DU8A 4WOJA 5JDCC 1E92A 4EI2A 3IJPA 3GNTA 4YJGA 5KKCA 4R1SA 8LDHA 2J5KA 4WLUA 5H82A 2I6TA 2O3QA 1HDCA 5A06A 4HFJA 3LDHA 4YPOA 2IDZA 2OHXA 4AVYA 4DREA 3WGZA 2AQIA 2VZ8A 1XG5A 1SNYA 4FOOA 4BGIA 3L4SO 3WQSB 1YE3A 1OI7A 3WFJA 2QIOA 4IJKA 2G82A 1XEAA 2OXIA 9LDTA 4PIVA 3W4JA 2W90A 4RCVA 2A35A 1ISFA 3PK0A 5A1TA 2BMAA 3GHHA 4AFNA 5EERA 4L75A 1EVIA 5COQA 2JFFA 1ORRA 2A9FA 2X23A 3JYOA 4R3WA 3TNLA 2NTJA 1GADO 3DC2A 3IUSA 4RVUA 1ZSVA 1BDMA 3ZWXA 2VT2A 4L73A 4Q3DA 2OGUA 1ZBQA 4K26A 3ADPA 3EY4A 5KJEA 4BHTA 4X54A 1VPDA 5CEJA 4BO6A 1BXKA 4MVJD 4PVDA 1IE3A 2J6IA 5JCXA 1A9ZA 4FR5A 2VWQA 2Y68A 4IDCA 3C1OA 4E5YA 1NAIA 3NDJA 5K9ZA 4CM5A 2YV1A 4PG5A 4YEDA 2BKAA 3JD1A 4KTVE 2I99A 4B8ZA 1EMDA 4CR6A 1L7EA 1PL7A 3JQDA 4AJ2A 1D1TA 1K6XA 1WZEA 3FI9A 1PWXA 1H93A 3RUCA 3ZNQA 4A5OA 5A3JA 3TFOA 4M49A 3RCBA 1DLIA 1A7AA 2B36A 2W2LA 1JAYA 3FR8A 3GVHA 1B8VA 3EZYA 2DM6A 3SEFA 5GZ1A 3OIGA 4BO9A 1WXDA 3NUGA 4NBTA 3DAGA 2POQX 6LDHA 3LYLA 1W4ZA 3JQFA 5JE8A 4EUEA 4O5OA 4MPDA 3I1JA 4CLDA 3GZNB 3S2FA 4ONEA 1EUDA 1LI4A 3M2PA 1H6DA 4ZRNA 4QEDA 5G0UA 5KVVA 5CDTA 5K0ZA 4R68A 4CMIB 2H5LA 4CM8A 1R0LA 3KZVA 3AOEA 4CL3A 1EZ4A 2CD9A 2NADA 1GTMA 4YT2A 3ST7A 1LBEA 2EHDA 3WLFA 4CMJA 4JP2A 2HMWA 1J49A 4Y8VA 3A1NA 2AEJA 3NJ8A 1NP3A 3WGIA 4IMPA 1E6EA 2FR1A 2GASA 2FPGA 4ILKA 1KVUA 2QRJA 2YY7A 3PQDA 4NJMB 4E13A 4U6QA 3CPSA 3K92A 3DZHA 4HX5A 5HRUA 1XCBA 2O2SA 4NBVA 5CEFA 5A9SB 5TLSA 2JHGA 3UVEA 2HSDA 3D3EA 2PKRA 4W4TA 4Z0PA 3RJ9A 4WLEA 2O3RA 2XXBA 1C14A 3VC7A 4BB6A 4J9UE 5L40A 2PKQP 1X0XA 1OMOA 5DZSA 4XR9A 4IZHA 1JAXA 5U4QA 1H6BA 3WB9A 3I4FA 3QE3A 2XXJA 4FPXA 5L7YA 1GCUA 4AJEA 5IDQA 1NQ5A 1YB5A 4PVCA 1DPGA 4PGFA 2VOJA 4LVUA 4BNHA 2Q1SA 5F21A 5B37A 2V6MA 3R3SA 4ESOA 3WYEA 3TZ6A 2P4QA 4CMAA 1MX3A 1GUYA 1C0IA 3O9ZA 4I1IA 3SLGA 3TN7A 4QTZA 3AM4A 2AG8A 4ZHSA 4MVJP 1NM5A 4YRBA 1PJ4A 4J7XA 3P5SA 5A3VA 4WGGA 2FY8A 4N54A 5DBGA 4YA6A 4CQMB 3LK7A 1RM3A 1GEGA 1Q2XA 3B70A 1PWZA 2EKLA 4J4BA 2BFPA 1U3TA 3PDUA 4CV1A 4RJTA 4ZJUA 4BO1A 2B83A 1NFFA 3PQFA 2DBZA 2DC1A 5CPBA 3C24A 1GZ6A 3D5QA 4A27A 2WD7A 2AQKA 1IHYA 3NGXA 1E1NA 1JLLA 3ONEA 4ZU3A 4MKZA 2J3JA 4ZA2A 5TGDA 4J1SA 4IGEA 4NFYA 1E1LA 4XYGA 3WQQA 1TA4A 2OOSA 4S1VA 2WD8A 5G0SA 2NSDA 1GD1O 1HZZA 1ZIDA 4FFRA 5T5QA 5J23A 4DLBA 4WK6A 1NX6A 3SXPA 2X8LA 2OP0A 1LRLA 2TMGA 3F5SA 5TF4A 5TJ9A 1RM5A 4ALJA 1PZGA 3IDSA 5IXYA 1ADFA 1ARZA 3VZSA 1NYTA 1ZSYA 2ZTVA 4CQLB 4R1UA 1QLHA 2OP1A 4MINA 3P7MA 3FD8A 1HSOA 1A72A 2I5PO 3JQAD 3GMSA 4PLGA 3H4VA 1KVTA 1YOVB 2VHWA 4GX1A 1X13A 4IBOA 4J49A 1UH5A 3LZ6A 4J3FA 4URFA 3JQFC 3ZV4A 4MIOA 4FC6A 1OZAA 2YQ5A 2QG4A 2LDBA 3HQ4O 4OXNA 1UR5A 2UDPA 2LDXA 1LDBA 1PTJA 2AXQA 3IMFA 2B4RO 3E9NA 1M2WA 2PH3A 4GX0A 2O3JA 3TOXA 4D43A 3T7EA 3AOEC 1XKQA 4YJGB 5CPFA 1PGOA 1YB4A 2O4CA 2Q2QA 3QWFA 5KVCA 2P9GA 3H9UA 2DFDA 4YACA 4R5HA 2PFGA 5JO9A 1R12A 1HE4A 3NX4A 4XDZA 4XX0A 5JBIA 1HDXA 1VL0A 5JS6A 4ALKA 3GUCA 1IPEA 4DYDA 3OSUA 4HNHA 5KOIA 5T57A 2CF6A 3PJDA 5U1PA 4CV2A 2X1HA 1ENPA 2ZATA 3CIFA 2AQ8A 2W98A 1SZJG 4PLVA 2EGHA 1ZK0A 3PYMA 2NACA 1T24A 1BG6A 1DRWA 4BMNA 3JQ9A 4MVJG 1H9BA 3O03A 1IULA 4IIVA 4BKRA 1F12A 4DLAA 5K6AA 2OUIA 1V8BA 3S8MA 4TKLA 4WJZA 2B4TO 3KLPX 3QWBA 1RJWA 5BQFA 4RZHA 4N7RA 1DC4A 1K6IA 1ENOA 4W99A 2EW2A 2E37A 3JYLA 1BGVA 4DPMA 1U9JA 5A03A 3V2UA 5BNIA 1TT7A 2VRBA 3AU8A 3OETA 4PZCA 1G0OA 3D1LA 1PJTA 3UICA 4DGSA 3I23A 2NV6A 1PS8A 3PHGA 4CJXA 4XB2A 2HJRA 2CVQA 3IP1A 4PLYA 4TMFA 1UP6A 4TWRA 4UVDA 2VHVA 1IB6A 1KEUA 3EC7A 2PLAA 4QSMA 3QWIA 2Y93A 4WNCA 3ZWAA 1JU9A 4PG7A 3QP9A 1NBOA 4RF5A 2WM3A 3AFNA 3HSKA 3AY6A 2GO1A 5TJHA 4XKJA 4BL5A 2IEDA 3TPCA 1VSVA 1B3RA 1E3SA 5IDYA 3FWZA 2G17A 2E4AA 2VHZA 1VL6A 3AW9A 1F8FA 3WGQA 3ZNNA 3P2OA 5TRTA 3QVSA 3D7LA 4MIYA 3ZW8A 4YAKA 4WKGA 1RKXA 2DFVA 1QYXA 3DZBA 3JV7A 1OBFO 2FRDA 2H9IA 3L9XA 1M67A 3U4DA 1A7KA 2X22A 1E5LA 3F5QA 4OKNA 3L0DA 5HA5A 4YAGA 5JO0A 4BNXA 4CM8B 3GFBA 1SPXA 4S3MA 1Y6JA 2C59A 2VHYA 1PJCA 3VZPA 3EMKA 2VNAA 4PCVA 1WPQA 1PJLA 5U9CA 5B12A 5IZCA 1YONA 1ZJZA 4QECA 4RGBA 3WNQA 2V7PA 4BV8A 4BNZA 3BTUA 4GSKA 2WJPA 2CVOA 1NQOA 1T2CA 4I08A 2YFQA 4TVOA 2QRKA 4CM1A 4J2OA 2HMUA 4QFDA 1CRWG 4CLOA 4DWVA 5JYEA 3NT4A 3L4BA 5L95A 2CZCA 4XQEA 1Z73A 1R0KA 4L76A 4BGVA 2NUAA 4GAEA 4II2A 4OXYA 3WNVA 2G5CA 1OC2A 3WLEA 1EQ2A 1P1IA 4PRKA 4XGNA 1I33A 2DBQA 4IDAA 2X0IA 1HYEA 2BI7A 4HADA 1R6DA 1CETA 3VH3A 1LSOA 1GUFA 2C7VA 4TRJA 4BNGA 3L6EA 1D1SA 4GVLA 4YT5A 1HXHA 1EVYA 4CMKA 2VWHA 4FJ0A 1V3VA 3ZZNA 2ILTA 3FPLA 1R4NB 1ADGA 3LT0A 4NG5A 2X0NA 2C7GA 4QUKA 1B26A 3DZGA 2B35A 3F46A 3MEQA 4BQRA 5K6AC 2I9PA 4BVAA 3ZWCA 4IMRA 2Q1TA 2DUUA 3SVTA 4MVJH 1DFHA 1LNQA 1UAYA 3ONDA 5KTKA 1T2FA 1BDBA 2HDHA 3FR7A 3UCFA 1H2BA 4PG6A 5DP1A 5ADHA 3G0OA 2P91A 2DTDA 3G49A 1U4SA 2NVUA 1BSVA 5ENVA 3TSCA 5A02A 4NDNE 1F8GA 1P31A 1XLTA 2WD7B 4P38A 5L45A 4IQ0A 1PX0A 2C2XA 4DQXA 3GC6A 1NPYA 1YQDA 1Z74A 2A92A 4C7JA 1KERA 4O0LA 2YUTA 4IQGA 4BNIA 1SAYA 4KZPA 2SCUA 1X7DA 4BO0A 5C37A 3F9IA 3U5TA 3D4PA 1H2HA 3M1LA 3SX2A 4RDHA 3NEPX 4NI5A 4D42A 4LCEA 4IXTA 2A94A 3AUSA 1X15A 1E1MA 3JSAA 1LTHR 3S55A 5B4UA 3EUWA 4U6SA 1E7YA 2WMDA 3PHHA 4I5GA 3WS7A 3HFSA 4GGOA 1I2CA 3GPIA 1E6WA 5MDHA 1QRRA 3JQ6A 2X6TA 1QR6A 4L4XA 2GR9A 1AHHA 4BKQA 3UFXA 2HUNA 4EGFA 4WLFA 1HRDA 1A4UA 4UVIA 5ITVA 5IJZA 3DB2A 3PWKA 4CUJA 2C82A 3MTGA 3RIHA 4B4VA 4F6CA 1EUZA 1JWAB 3ZN2A 4EYEA 1AXEA 4II3A 2WYUA 1NNUA 1W8DA 1ADCA 3ROMA 1LJ8A 4JJFA 3ZU3A 1DB3A 4OXKA 5HS6A 4EW6A 3I6IA 5AVOA 1EUCA 4CM7A 2BH9A 4DYVA 4DA9A 2WYWA 5T6BA 3CTMA 1QLJA 3ZU4A 3GVPA 3FPCA 4R1TA 1GY8A 4IM7A 1U3WA 4OQYA 4QO7A 4ZQGA 1TEHA 4XQGA 4CM9D 2VOEA 3QRWA 4O63O 4KDFA 3PHJA 2EKQA 3FRJA 1DIBA 5LCXA 3VDQA 2PA3A 4RQTA 1G6KA 1NR7A 2Y1DA 4RPGA 3SJUA 4CV0A 3GEMA 3ASUA 3RU9A 4FD3A 3QQPA 1B8UA 1Y81A 5BNTA 3FF4A 3IKTA 3VAZA 1EE9A 1KVRA 1PS0A 3E6AA 3BMQA 5G0WA 2ZKLA 1E1KA 3I9KA 1XQ6A 1YXMA 3DONA 4BGUA 2DBVO 3AUUA 4IS2A 1KVQA 2IEBA 3K6JA 1E7QA 1Q0HA 4DIFA 4PN3A 4YVFA 1TI7A 2Q2VA 2YJZA 3VTZA 5CAEA 4HFMA 3PFFA 3RFXA 1VJTA 1HDOA 1IYZA 1LQTA 2PZLA 4YRDA 3EHEA 3SBOA 1IPFA 3RUEA 2AEMA 3B1KA 3QW2A 3S2IA 4B4OA 3WWYA 4BO3A 3BTOA 4Z6KA 1P1KA 1HE2A 2OBNA 4GMGA 3G17A 2NTNA 2QX7A 3DHEA 1HDRA 4MVJI 5I7VA 3PJFA 3VPXA 1ISHA 1ZW1A 3DAPA 4RPJA 4XJTA 4DMLA 5CDGA 5JSFA 5G0TA 4RL6A 4FSHA 1AHIA 3V1TC 3UW3A 2PGDA 4YJHA 3ZU5A 4WNIA 2HAEA 4DTIA 3WICA 3ZWYA 4TROA 3WWZA 4BIIA 4TRNA 2PZKA 3RC9A 2ZB8A 1X1TA 4MP6A 3NDIA 3W4KA 2FN7A 4RQUA 3X2FA 2RH8A 5T8KC 3AI3A 2O3SA 3MJSA 5I9MA 3OICA 1WDKA 3NRCA 2FPPA 5TQVA 3JQBA 3D64A 3EAGA 1QORA 3CEAA 3HDJA 3GRPA 4Y6SA 4KQWA 1QG6A 1ZK1A 3IAHA 5F1PA 4K28A 4H7PA 1P3DA 5I8WA 5CDUA 2VZ0A 5LC1A 5LDHA 4XR4A 4UAGA 4NR0A 4BO5A 1GZ3A 1Y8QA 4LCJA 1E3JA 4D3SA 4BV9A 3OIFA 3E9MA 3ZCXA 1A9YA 4A0SA 1MXHA 5FI5A 4RF2A 3GN2A 1N92A 2JAPA 4ND1A 1QSGA 5KVQA 3WJ7A 1SOWA 2BF7A 5L3ZA 3BHJA 2YDXA 2HJSA 2O7SA 5KVSA 3KO8A 3VPHA 3VPSA 4MIEA 4CL8A 1IY8A 1I0ZA 4ZICA 4OHUA 1GUZA 4IS3A 1KEWA 2YHUA 4AJOA 3CH6A 3MJ4A 4ZN6A 1C1XA 2D59A 4CLEA 7MDHA 4JP3A 3RKUA 2IRWA 3OHSX 4TVBA 1PJSA 3HZZA 2X5KO 3RFVA 4JX8A 5F5LA 4LN1A 2FPIA 1O8CA 1HE3A 3QWAA 4CMEC 3OJLA 3Q0EA 2ZK7A 1E3WA 1RM4A 5FI3A 3V1YA 3ZWNA 2D5AA 1E7WA 1DAPA 2E49A 4R9RA 2UUOA 3MJCA 3VOSA 1J4AA 2P5YA 1JVSA 3RKRA 1MG0A 2ZTUA 1N7HA 1BMDA 3RU7A 4A7PA 1UXKA 4GWKA 3C7DB 3ROPA 5ILOA 1I01A 2NVUB 2FMUA 3GHYA 3D0OA 1KBZA 3PLRA 3OQBA 2GD1O 2ZTMA 3TOZA 2FR8A 3JQ7A 5G2OA 4P22A 3JQ8A 4ALLA 4DL9A 1NASA 4PG4A 4BNYA 4GBJA 1ZVMA 5A4DA 4CM3A 5JDIA 1ULSA 1XHLA 2DPHA 2P68A 2XF8A 4A2CA 4NPCA 4J1QA 3MOIA 4IZIA 5DP2A 3NV9A 2Z1NA 1V3UA 1GCOA 4UEJA 4ZVVA 3PFWO 5CP8A 3GA0A 3WGHA 1P44A 1GQYA 3STHA 4IDDA 2VQ3A 4ZD6A 3D3WA 4WUVA 2W8ZA 1C0LA 2BGKA 2XOXA 4FJ1A 1P9LA 1ONPA 2DVMA 3HWRA 2UVDA 2HKIA 2WSBA 1GEEA 3EK2A 1DXYA 1LQUA 1VJ0A 3KLMX 2XAAA 3KSZO 4WCDA 4CM9A 3EVTA 5L4LA 1YO6A 4PLZA 4ZGWA 1ZMTA 3JD2A 3H9GA 1NVGA 4G81A 4YCAA 4QT0A 4D41A 2BFOA 2PH5A 2NU8A 3JQBC 2Q46A 3NTOA 2NM0A 3OEWA 1O6ZA 1XWFA 3MJTA 2WTBA 4FFPA 4W82A 1HWYA 3H7AA 2CFCA 4GLOA 2R00A 2NU9A 3OF2A 4EZBA 3C1AA 4XGKA 3TJRA 1PL8A 1DAOA 5GZ3A 2B0JA 3OECA 1KEPA 1S7CA 2EG9A 4L9RA 1T26A 2PR2A 3DL2A 3GG9A 1CF2O 4FJ2A 4LK3A 1MFPA 1YBVA 2VYND 3GN1A 3B1FA 3W8EA 1IZ9A 2YDYA 2C5AA 3BZUA 2VNSA 4OGWA 3OFSA 4Q3AA 3RASA 5BSGA 1ISMA 1NWCA 4MDHA 1DHRA 4AJNA 1NWHA 2O2YA 5IN4A 2BLLA 2AE2A 4QXMA 1VKNA 3GEGA 4MJLA 3VH2A 3PTZA 5I7SA 3ZNOA 5I9NA 2GNAA 2QYSA 2X9VA 3G79A 3UAGA 1K3TA 1GV1A 1A5ZA 4HP8A 1GL3A 4O59O 1B0AA 1LLUA 3WG9A 4E2WA 2CMDA 5GY7A 3F4LA 3F6YA 1ENYA 1YS4A 5A5FA 3ZHYA 2V65A 3OJ0A 1UDAA 4XRGA 1GV0A 3I3OA 4R51A 2PY6A 1S6YA 1O9BA 4FGSA 5F3RA 2J3IA 2ZB3A 3MWDB 1LLQA 3WX0A 1HYGA 1LSSA 2A4KA 1DIGA 3RC7A 2X58A 1JDJA 4IDGA 1WNTA 3FNEA 4HY3A 5DCYA 3V1UA 2GLXA 4L4RA 3VVBA 3BA1A 3Q6IA 1GQ2A 4YJHB 4WLOA 4JLWA 3PZBA 1C3VA 4E0BA 1LDYA 5ILGA 2ET6A 4A10A 1DRVA 1JKIA 3DDNA 1BRMA 3MOGA 4FFMA 4NU6A 4CUKA 1IOLA 1UXIA 4AJKA 5JY6A 1TVEA 3OA2A 3RUFA 5JFOA 3H9JA 3TZCA 3A28A 3PDJA 4Z0HO 4PLPA 4UEKA 4PLTA 1T4DA 3OEYA 5JCJD 1Y5RA 4FFLA 5EQFA 4TRRA 3G3EA 3E5MA 4MKXA 4DBZA 4GQAA 5AYVA 5JMWA 4UVHA 1SOVA 9LDBA 3ZH2A 3BYZA 4L0QA 3WTCA 4CM6A 3PHLA 3SLKA 3PEFA 1Y8QB 2GGSA 3BMNA 4NK5A 3BAZA 3RC1A 3RD5A 1BWSA 1DC5A 3IP3A 4IJUA 5KCZA 1ENZA 1U3VA 2C54A 2FSVA 1WAMA 3FSRA 4NH4A 4P4NA 4E5PA 1H9AA 3RSHA 1D7OA 5IG2A 1XQ1A 4Q3NA 2VTEA 2VWPA 3OJFA 4I5DA 3TL3A 3DBHA 3WGTA 4I5FA 3BTSA 4KUGA 1LLDA 3E03A 4EITA 1C1XB 1UDCA 4DIBA 4KWHA 2GERA 5JW6A 1PJ2A 1NQAO 5IAAA 4XJSA 2Y1CA 3BHMA 2PGJA 1EK6A 1R16A 1UUFA 2B37A 3GNQA 2EJVA 3MJVA 1LDEA 3FBGA 1E3WB 2EXXA 1YBMA 1UP7A 1K0UA 2J3HA 1MC4A 3V2GA 1ZSNA 3LF1A 1A71A 2F1KA 4H16A 2WWRA 2R6JA 1FDUA 1Z75A 4C4OA 4BNVA 3OBBA 1P77A 3O38A 1OOEA 3F3SA 1MA0A 1PR9A 2Y0EA 1EBFA 4XDYA 3AOGA 2X0RA 4I5EA 4AICA 4D7AA 4CODB 2FZWA 2J3KA 3H5RA 1NQTA 2VN8A 2ZJ1A 4FOSA 1E3LA 1W0CA 1LA2A 3JQ7B 4FFOA 3JQ8B 4OM8A 3DZKA 4O1MA 3DAFA 2VRCD 3PXXA 3RFTA 2ZJ0A 3AM5A 3MWEB 4PG8A 3QJ5A 2Y0CA 3PIDA 3WYCA 1EDOA 2C0CA 4YTEA 5JAMA 2BELA 5GZ6A 4MVJA 1LEHA 3OIDA 1E5QA 4RORA 4K1LA 2D8AA 1NFRA 1U28A 4LGVA 4YT4A 5JC1A 4BNUA 3ADOA 2GYYA 2CNBA 2GN8A 3CE6A 1KOLA 3GY0A 4Z9XA 4JJGA 3WGGA 3D3WB 3DFZA 1IL0A 1ML3A 2D1YA 2JD0A 3K8ZA 3K96A 4OO3A 3RVDA 3ZHBA 3O26A 1HTBA 1DC6A 4D3FA 2EERA 1HYHA 1MV8A 4NIMA 1F14A 1M6WA 3I4CA 4JNKA 1JKJA 4N5NA 3B1JA 1FMCA 4B4WA 3D4NA 4B7XA 1D4FA 2EKPA 3JQCA 1PEDA 1LRKA 2JFHA 1U1IA 2O50A 3CINA 3GVCA 5C7OO 3ROQA 1WWKA 4MP8A 4E2YA 2CVZA 1UXJA 3H5NA 2J5RA 3UGKA 4EUFA 2G0TA 1SEPA 1V9LA 4ND2A 4U5QA 1MP0A 4DPKA 4XRRA 2Y1EA 4YT8A 5F1OA 2DPGA 5TC4A 3C7AA 4E5KA 4CLRA 3CUKA 2Y1OA 2H1SA 2IXBA 3RBXA 3DBRA 4GX5A 3QVWA 4W6ZA 3O8QA 5FWNA 2VHXA 3RUIA 4JIGA 2E6UX 3AK4A 3I5MA 4GPD1 4E5MA 3U0BA 3UHAA 2GZ3A 3B20A 4D45A 1SC6A 4YRAA 1L1FA 4YAJA 1OC4A 4OOFA 2EEZA 1GAEO 2OORA 3H65A 4W7HA 1HDGO 2EF1A 1UJMA 3GRKA 3MZ0A 4HXYA 2J5QA 3OQ6A 1GPDG 1AN9A 2OMEA 3DOOA 3ROKA 2HK7A 3NTRA 4KWIA 3L6OO 5A05A 2DBRA 2WEKA 3M2TA 4XYMA 4ND3A 2ZYGA 3KSUA 1WMBA 4E33A 2DQ4A 2W2KA 3BIOA 1SBYA 1VM6A 1HDZA 2NQ8A 3HHPA 4Q3CA 3ZWBA 2NTVA 2OFPA 2DUWA 1YJ8A 2Y1FA 1KY5A 3DHNA 3PQEA 1B3BA 4I9HA 5T67A 5CG2A 3ZWVA 3QLJA 4WEQA 1HLPA 3EW7A 4JQCA 5JCJA 4HV4A 5HTOA 1FDVA 1V6AA 1ONOA 1U5AA 2RHCA 1FXSA 2YV2A 4NQZA 1DRUA 3IKVA 3KB6A 4H15A 1V3TA 4EEZA 2I3AA 5C7LO 3I52A 1CQIA 3ULKA 1SCUA 3ETEA 1MUUA 4AJIA 3DFUA 3PGXA 4RF3A 1EVJA 5F5NA 2HQ1A 3CMCO 3U4CA 2AEFA 1U2GA 2QW8A 3VPFA 3JQ9C 1QYWA 3IJRA 4HKTA 3RUDA 3GGOA 1Y7TA 5FF9A 2BFMA 4PRLA 1KIFA 1Q1NA 2BGLA 2GZ2A 4EJ0A 3ABIA 4BMSA 4YQYA 1BXGA 2NU6A 4PZEA 3PWZA 4D79A 5DT9A 1O0SA 3AI1A 3G1TA 4WLVA 1Y8RA 2O7QA 1SO8A 3T4XA 4JBHA 1C0KA 4F45A 4XZ3A 3BMNB 2PTGA 3IS3A 1WMAA 1UAGA 3E82A 3JQAA 4A26A 4WCFA 2BI8A 1N1EA 1MG5A 2WDZA 1T2EA 2CDCA 5CHEA 1ID1A 2RIRA 3PHIA 2F00A 3ITKA 4DBVO 3NKLA 4GI2A 1Z6ZA 3C8MA 2C29D 3FWNA 1B16A 1JKFA 3DBHB 3KOUA 1B2LA 5AXBA 5C7IO 3OMLA 4FN4A 3GGGA 1IUKA 3UN1A 2V6GA 2JHFA 3VZQA 1FK8A 4IY1A 3GQVA 3GGPA 5DNAA 2CUKA 2X5OA 5TSDA 3JYNA 2BGMA 3ZW9A 3GPDG 3DBVO 1BVRA 3JD0A 2Y66A 5C3MA 4MVJE 1MFZA 3ZV5A 1K2WA 4U0KA 4XIYA 4OSPA 2IYOA 3H2ZA 1FJHA 4YJFA 2D2IA 2O4UX 2HMTA 4RDIA 2GF2A 3LT2A 1U4OA 3Q11A 4PLWA 1J5PA 3D4OA 1HL3A 1XIVA 1EFKA 3TFQA 1PJQA 1FF9A 4RVHA 1I10A 4IQ8A 1EK5A 1ZNQO 5IZCC 5JNLA 1ZCJA 1KYQA 1QMGA 2P5UA 3AUTA 2O23A 3ICCA 1NFQA 4LVCA 3ZGYA 5TS3A 2HRBA 1GZ4A 4TQGA 1QKIA 3PZRA 5KKAA 2G1UA 3N74A 2VUUA 4B7UA 1V35A 3L4BC 1ULUA 1UXGA 4IJWA 4GWGA 2R2GA 3SC4A 4MO2A 3F1KA 4I8XA 5F1KA 1CDOA 3SC6A 5AQ1A 1ADBA 3NYWA 1JA9A 5FEUA 5L7WA 4G65A 4L74A 4RF4A 4ND4A 1XA0A 2YQ4A 1NPTO 3PWSA 2RBEA 5THKA 3NT5A 1VRWA 1M66A 1O94A 1LDGA 1ZEMA 1DIHA 2FWMX 4JCOA 1GU7A 5L51A 4BNFA 3F4BA 4GSLA 3AY3A 5DOZA 3GOHA 4DLLA 1W73A 1BHSA 2NU7A 1LSJA 3M1AA 3LC1O 1VC2A 1BXZA 3PLNA 4XA8A 1LUAA 4AJ4A 4E2ZA 1N7GA 3WBFA 3KHUA 3ANMA 5C5IA 1ZK2A 4EJMA 1DSSG 3RQSA 4TZKA 4E32A 4MKRA 5EL0A 1GYQA 1ZFNA 1PGNA 1UXHA 4CM4A 3IUPA 1YQGA 4CLRB 8ADHA 5JDCA 1LDMA 1WZIA 1Y9EA 1GQQA 3HN2A 5JLAA 1JN0A 1HT0A 3DOCA 3LLVA 4M86A 3GVXA 4GKVA 5JYDA 3DBRB 4U8GA 3HUDA 3EDMA 3O8QB 4WCFC 4ALIA 1JWBB 3V2HA 5IF3A 4Y6RA 3WGOA 4NJMA 3PPIA 3RWBA 1PQUA 3W1VA 1XU9A 2E48A 3W6ZA 1T2DA 1B7GO 3WYBA 4R5MA 3ZNPA 3PIIA 5A9SA 2V6BA 5IN5A 4IINA 4GMFA 2B4QA 3DBLA 2Y0DA 4Z3KA 1Z45A 1PZFA 1TLTA 2D0IA 1Q7GA 5JAQA 5IDXA 1BTOA 2C20A 1NXQA 4Q9NA 2C07A 3RJ5A 1PGJA 4J7UA 4RVSA 5H81A 5KJ6A 4UUMA 1DFGA 3ZDFA 4R54A 3X2EA 4RPHA 2W2KB 3KYDA 4GKBA 4PFJA 4UUPA 4DUPA 5KJCA 1E0DA 1DLJA 3KEOA 2P9EA 4CLOB 4JGBA 3GLQA 3I9NA 3FNHA 3MCVA 4AJ1A 2DT5A 1E7SA 5JC8A 4DXHA 4KUEA 5BSEA 2I65A 3ZWWA 3ENKA 2QRLA 3DZFA 3UXYA 1DFIA 5HS4A 3PYXA 4N5LA 1Z7EA 3INTA 4XGIA 1VLLA 3NDRA 4QO8A 4BKOA 1I24A 1T25A 5JMPA 3OA0A 2OL4A 2ZYDA 4RVGA 4IXWA 1CQJA 4NBRA 3VPGA 2IZ0A 1E7RA 4MP3A 4O6VA 4N18A 3F1LA 3ZHXA 5JPIA 2YHIA 4TZTA 2UYYA 4BO8A 2FP4A 2JCYA 3KM0A 3OQ1A 4XQCA 1WVGA 1ZXBA 4F46A 4UREA 4KDEA 1LLCA 5COAA 1P1JA 4ALNA 1PR3A 1BXGB 3KYBA 1TT5A 1YJQA 3KV3O 2EP7A 4ITUA 2ZYAA 1A27A 4JJIA 4P4LA 1I2BA 3R3JA 2D3TA 4JK3A 5DBIA 4GL4A 4A03A 1YL7A 1ISJA 2C2YA 3AFMA 4EUHA 1YL6A 3UCEA 3JQGA 4LRTB 1RPNA 4B7CA 1PSDA 1XYGA 2FSSA 2O3TA 4XYEA 1MC5A 1B8PA 2G76A 3JQAB 4WCFB 3RBZA 4PLCA 4BNWA 1CERA 1YOVA 2HRZA 3RAJA 2EGGA 3WMXA 1MLDA 2GDZA 2Z95A 3VKVA 3QSGA 5JY1A 2J8ZA 2JKVA 4ID9A 4JBIA 3VZRA 3CMMA 2P2SA 5BSHA 1UZMA 5ER6A 3VVCA 3ZHZA 4CV3A 1J6UA 4DC1A 1VE9A 3A06A 1EE2A 1XGKA 3TF5A 3QIVA 2IZ1A 4IDFA 5CFZA 4NMHA 2D5CA 3I9JA 3U49A 2EWMA 4NFHA 1VSUA 2PK3A 4MVJF 1YDWA 2E82A 4WASA 3INGA 3GMDA 4DQVA 3H2SA 3H8VA 4G2NA 4WLNA 2JL1A 5EPOA 4DMMA 2AG5A 2I67A 3DMTA 1YDEA 2RHRA 2ZB7A 1EFLA 2VCYA 4W7IA 4XYLA 3LC2O 4J0FA 4BKUA 4YJFB 2NNLD 3U3XA 4FB5A 4Q3BA 3ZU2A 4TRMA 1B14A 5L7TA 2QZ9A 3OJOA 5TT0A 2D4AA 5L9AA 1H5QA 4FFNA 4J0EA 3GAFA 2QYTA 1YQXA 3TZQA 3S2EA 1G0NA 3JYPA 4TSKA 3W8DA 3HDYA 4GX2A 4FS3A 1LXCA 1X7HA 2DKNA 2PV7A 3EGOA 1HLDA 1X0VA 4OMUA 5L4NA 4OKIA 1LU9A 1EEHA 1TB4A 4UULA 3JYQA 4Q39A 3SJ7A 2QQ5A 2YV3A 1M76A 2CDAA 4RZIA 3AY7A 3I9LA 3H9EO 1BVUA 2PZMA 4J6FA 4FC7A 1DIRA 1P0CA 3BXXA 3FNFA 5TX7A 3TRIA 4XEHA 1SB8A 1VJ1A 2X0JA 1I3MA 1P74A 3I9MA 2RH4A 1NTOA 3DZJA 2GCGA 4HFRA 1HZJA 3BMQB 3K2BA 4FW8A 3IL2A 1C1DA 3CSDA 5CDYA 1KETA 2VYVD 2YZ7A 3K73O 3QVXA 4IGFA 2JAHA 2YW9A 4EEXA 1HF3A 4HFNA 4M89A 3BMCA 4M54A 2ZCUA 3ZV3A 1XU7A 4R41A 1DEHA 4R69A 1I30A 4CR7A 4BKPA 1HDYA 3ICPA 1N2SA 1I36A 2GZ1A 4DRYA 4CLHA 4MVJM 1Z82A 1JQBA 4CM4B 1YWGO 2PZJA 4N5MA 3AWDA 4F6LA 4J43A 3GFGA 4J4TA 1E6UA 2DTEA 3LT4A 4ND5A 2OO5A 2PNFA 3H5AA 2Q45A 4CMBA 1F17A 1FDTA 3S2GA 1GR0A 1JVBA 2IE0A 2NQTA 5G4LA 1N8KA 1CYDA 1ZMOA 3WQRA 2HLPA 4AG3A 3P2YA 1Q0LA 2JCVA 3TZKA 1CIVA 4J4HA 2CF5A 1XDWA 4YB8A 3RUHA 1KVSA 5JDIC 3B6ZA 3U62A 3DQPA 2NWQA 4OQZA 5CG1A 3C1TA 4GGPA 3DBLB 4RVDA 4J9VA 4OIMA 1LSUA 4Z9YA 3E18A 5IFLA 3H3FA 4C7KA 5ER9A 4J91A 3WMWA 4AJPA 3H9QA 2DTXA 3U09A 1KS9A 1H6CA 3KYDB 4B3HA 3E8XA 1UP4A 5DDIP 4B3IA 5BNFA 4D46A 4YR9A 2EP5A 3TZHA 3DMTC 1MXFA 2FR0A 2YFHA 3QA9A 1P0FA 1R4NA 5AOVA 1X14A 3DZIA 2NVBA 2IZZA 4E3ZA 1LDNA 1M75A 3K31A 1R66A 3PYLA 4LISA 4BUCA 1NPDA 3Q9NA 4CPDA 2I3GA 1YH3A 4DVJA 1E3EA 2HO5A 3WIEA 3MTJA 1HKUA 1P1FA 1KC3A 5COBA 3O4RA 4CUZA 3ANNA 3ON5A 4IJVA 3DOJA 1ZH8A 2BFAA 2Q1UA 1GYRA 1P33A 2JD1A 1DBVO 1VI2A 2R00C 3KRTA 2Q4BA 4JROA 1FDWA 5G4KA 2HK9A 5L53A 3JTMA 3IOYA 1SEVA 1ZEJA 2JFGA 3Q9UA 2VUSA 2PGLA 2AA3A 4WPGA 1WP4A 2Y1GA 3UKOA 3K30A 2VT3A 3NTQA 5BT9A 2YHIB 3HJAA 4ZQBA 2QZZA 4E5NA 3UF0A 2Y67A 2PD3A 3ONFA 3ASVA 4J2HA 4QX6A 3AJRA 4I9UA 5TIIA 2P9CA 3ETGA 3ZWPA 2BD0A 1YGYA 1HEUA 4L8VA 4AL4A 1TT5B 1GDHA 3RUAA 1AGNA 4NJOA 2OZPA 2Y05A 1MGOA 5DCUA 5ES3A 4B4UA 5THQA 3GT0A 1ZK4A 3DR3A 2GN4A 4IIUA 4BOYA 2I66A 1PS9A 1Q0QA 2AQHA 3JQGB 5DBFA 3AM3A 3FTPA 3WR5A 1ZUD1 4NZ9A 1RYEA 2NVWA 3E1KA 4P4GA 4RLHA 2CSUA 3AI2A 1L7DA 1DDOA 4PZDA 2B5VA 5EESA 1SB9A 2GUGA 3QY9A 4W9NA 5GMOA 3KYCA 1NR1A 4E21A 3FCOA 4NU5A 5A04A 4Z0TA 1N1GA 2PWZA 2I76A 1O89A 1K5HA 1U7HA 4FGWA 3GUYA 1EBUA 3OH8A 1UZNA 5G0VA 5EMHA 3Q1LA 4LMRA 4Y67A 5I7EA 4PLFA 2HU2A 1EQUA 1U7TA 3JCZA 1Y1PA 3PI7A 1PU2A 4IDBA 1ISIA 4WE3A 1B15A 2WYVA 1WW8A 2V6FA 2NLOA 3PP8A 3I6QA 3ZWMA 2HK8A 1LX6A 1QYVA 1GFSA 4GLLA 2EJWA 4KUHA 4OL9A 3JD3A 4INAA 2GSDA 3FN4A 3TWOA 2YYYA 2AMFA 2VYNA 2JCXA 5HM8A 2GRAA 3C7CB 4WOKA 2WE7A 3GEDA 1ZK3A 3PJGA 3FBTA 1Y9AA 2Y99A 5EINA 5A9TA 1H94A 4MOWA 4AJHA 1CJCA 6ADHA 3VH1A 3VHRA 4NNJA 1K89A 3ZWOA 1ZJYA 3EYWA 5ICMA 2VYVA 5IDWA 4RLSA 5CDSA 5JXWA 1M6HA 5HBRA 5H83A 1PIWA 1XR3A 4BO4A 1R37A 2EV9A 2FHSA 1R4MA 1YL5A 3GR6A 3NT2A 2B69A 4QQRA 2FZEA 1YBAA 1CWUA 2C5EA 1G1AA 2FOIA 3L9WA 4R4JA 4DC0A 4GVXA 2UAGA 1PQPA 4ZQEA 3NJ4A 1NAHA 4Q3EA 4LMPA 3Q2IA 1E7MA 3P19A 3GDOA 3T7CA 1P1RA 4OSOA 1C1DB 4QFCA 5I9LA 4WEOA 1XSEA 2O3UA 4XQ9A 3KBOA 3E9QA 3DHYA 3MJEA 3BMCB 3HG7A 1OAAA 1RM0A 3HDQA 4M55A 5L4SA 2H6EA 3ZV6A 4J7CA 4J1TA 4LW8A 4H3VA 1I5RA 4FQ8A 5TNXA 1I8TA 2GPTA 5BR7A 2OBYA 4CLXA 1I3NA 2AW5A 4WECA 1PGQA 1J0XO 4I9NA 4GH5A 4OJNA 1VL8A 3AU9A 2ZQZA 2ZB4A 2IYPA 1ZKMA 4U0JA 4HNGA 4Y6PA 5JAIA 4BNNA 4Z9FA 4EJ6A 1XELA 3W4IA 3HE3A 3VKUA 1LC3A 3RBVA 3OJEA 2UUPA 4BS9A 4BMVA 2X86A 1JW9B 1R15A 4DPLA 4W9NC 1IZ0A 3BMOA 3E48A 4KOAA 4ROSA 3EZLA 4RV9A 4IPTA 3IC5A 1NVTA 2ZIZA 4M87A 1H0KA 1CEQA 3PGJA 1E3IA 3EVNA 3CKYA 5CEEA 1PZHA 3D5TA 3DMYA 5T64A 1JTVA 1UDBA 3L6DA 4UVGA 1QYCA 4FCCA 7ADHA 4CR8A 3QVTA 3COSA 3DTTA 4EDFA 4CQMD 1KY4A 3U4HA 1N9GA 1WDLA 2DLDA 2IODA 3S1LA 4B8WA 1D8AA 1BW9A 3PRJA 3QVOA 1I3LA 1WLYA 3AUAA 5KWEA 2X7HA 3ORFA 2XPCA 2W4QA 3KTDA 4G5HA 3GH3A 4YXFA 1Q7CA 1ISGA 2X9NA 5EIOA 4D0RA 5B4VA 3K5PA 3ETDA 3T4EA 1GYPA 1K6JA 2WE8A 4B3JA 3L07A 4M8SA 4YDRA 4R16A 4XD2A 3UCXA 1IHXA 3WBBA 4E30A 4J90A 4AJLA 1E77A 4FDAA 4HBGA 4BNLA 5KIAA 3KETA 5B1YA 1YKFA 5G4KB 1AXGA 1DOHA 4E4YA 3LLSA 1SMKA 5ENDA 3F47A 3LSYA 1DO8A 4U7WA 1KEVA 3DEYX 4ZQHA 1WDMA 1Q7BA 3C85A 3HNPA 2ZQYA 3ITDA 1X1EA 3I9OA 3W6UA 3DTYA 4FIZA 1NVMB 4LSMA 3G1UA 2VRCA 2VZ9A 1EDZA 3A9WA 3HB5X 4YAIA 5KJ1A 4BO2A 5A5EA 4YJDA 4D44A 4E31A 3HN7A 5T8KA 1H6AA 1UZLA 3CZMA 5MGBA 1NHWA 1DIAA 1PGPA 1P45A 2AE1A 3V8BA 3HFGA 2HMSA 3LC7O 4KQXA 1O5IA 4D0SA 5TT1A 2VTDA 4IUYA 3WSWA 4UUOA 4OH1A 2PKQO 3TQHA 1LC0A 5EN4A 4YYZA 1O95A 3HB4X 3KYCB 2QHXA 2Q99A 4UEOA 3N7UA 4OAQA 1QV6A 4BNJA 4OOEA 3GZ4A 1R0SA 4B79A 3VH4A 3QHAA 1PQWA 3CXRA 3RC2A 1EVZA 4UUNA 1DC3A 4L4SA 4R9SA 5DF1A 4TKMA 3WJAA 4E6PA 1DJNA 2RCYA 2HCTA 3GDGA 3OM9A 3QWHA 3IQDB 1OFGA 2VUTA 4KP7A 2H63A 1FDSA 3JQEA 3DWFA 5ICSA 1I3KA 1NHGA 4CMHA 2PD6A 3L77A 3OP4A 1T4BA 4K6CA 5I7FA 1RYDA 3LF2A 3N58A 4AJJA 4YQZA 3K9QO 4CMGA 3PVZA 5FYDA 4CMEA 2JJYA 4JXKA 3WFIA 3CZRA 5IXSA 2X9GA 4ZQFA 1TXGA 5ITWA 3Q2KA 2HMVA 1C0PA 4M1QA 4XWYA 4KMSA 1QYDA 1GPJA 3GZNA 3KXDA 3ZI0A 1YB1A 4XCVA 4BNMA 2EIHA 3WGYA 1LRJA 1U8FO 4RO0A 4CMIA 1T1RA 5AXCA 3WOHA 5B4TA 5FFFA 1Z7BA 3IIEA 4NFSA 3V5NA 1VKOA 4D3DA 3FNGA 3UOGA 4LSWA 3A4VA 1HETA 1MB4A 2W2LD 2Q2WA 2X5JO 3DO5A 2X4GA 3GAZA 5HWSA 3H3JA 2GN9A 1R4MB 4R1NA 4HUJA 1PJBA 3LT1A 1QV7A 1U5CA 1I2ZA 4PLHA 3RI3A 3GG2A 3BTVA 3KUXA 1V0JA 4YBZA 4RPKA 2Q3EA 1T1SA 1AE1A 3HADA 3JD4A 5AXAA 3VTFA 2EW8A 1ZO8A 3R6DA 4DIOA 5JAZA 5KJFA 3FHLA 4P8RA 3Q3CA 1PJ3A 4J16A 4IDEA 3TL2A 2Q4EA 3M6IA 3TDKA 4NK4A 3KEQA 1U2DA 2BRUA 1QP8A 2AHRA 4ALMA 1N5DA 4R01A 5DULA 2CY0A 3GF4A 4E12A 1W6UA 4Y9DA 5I8ZA
chains in the Genus database with same CATH superfamily
1M34A 1WV1A 3CRMA 3Q12A 2M6KA 1ONBA 3N3AC 5ERYA 5AM1A 2EYQA 3A3KA 3DMPA 4DCCA 4EG1A 3EXFB 3GJXC 4OG2A 1P4SA 3DW1X 4V0QA 5ALNA 3T5BA 2INGX 5J4VA 1KAOA 2RBKA 5KS2A 4K9DA 6AT1A 4UVEA 3U4IA 5JXGA 4B1FA 3QVGB 4Z3DA 2ZSFA 3K16A 1PNVA 1Z8DA 3MAGA 4Y98A 3FFBA 4NARA 4AIRA 3PQ4A 3K2EA 5BYBA 5J2TB 5L8VA 4CQMA 3WSVA 1W25A 4K6FA 3TIXB 4QOSA 1SXJC 1ZXLA 4Q16A 3THYA 2W71A 4BNTA 1CQIB 2P2ZA 3HXKA 3LPAA 4R8MA 2J0VA 1AGRA 2XMBA 3E5RA 4PYJA 2BSXA 1K4KA 1DOAA 4HTAA 1F5SA 1H2RS 1P8AA 1Y7PA 3C5HA 3E2PA 4BGEA 5LDGA 2O2CA 5D87A 2ZI9A 2WJHA 3G88A 4A73A 1ZJ6A 1Z8HA 3ECSA 4F84A 3OZEA 1XZEA 3ORYA 3W1WA 5LJIA 2VQFB 5LA6F 4DV2B 1IMJA 1AKTA 1UEXC 3QBVA 4JB8A 1W5FA 2GD2A 2Z1MA 3FX2A 3KVOA 1ES9A 3NAQA 3IV6A 3A14A 1H8HD 2ZCVA 3N8DA 4LRSB 1P1HA 1P72A 3WIDA 1D04A 2C92A 4PR3A 4PZAA 2Q1YA 1V7PC 4BB5A 5ALRA 3D8RA 3GVIA 4FONA 1N9GB 2YFYA 1M2VB 5KTOA 3RYTC 4ZDIA 1UPXA 1DXOA 1R9NA 5EA2A 1QTQA 3F7TA 4CQLA 2I87A 3BWVA 3RPEA 1SN7A 4ECEA 3MTQA 2JZOA 3KUUA 5CGZA 1HSZA 3HNRA 3K6RA 4MW0A 3ENNA 5EQDA 1FYFA 1U0JA 2C9OA 4PO1A 1T6YA 1U8AA 2ZTLA 4CKCB 3AB3A 4Y2VA 4ZOLF 4YWJA 1PG5A 5CDFA 5DVZA 3ROEA 4M98A 3X43A 3LI2A 3D0QA 3RREA 4BFXA 3FHTA 1RWBA 2ZI4A 4YGYA 5A4IS 4R1LA 3WC4A 1YVEI 1F0YA 2EIXA 2PQ0A 5LYJF 1T2VA 2AEEA 4B43A 2R1VB 1R5JA 3GO4A 1GGEA 2JD2A 3ELDA 2V3CC 5K1ZA 1IJFA 4X64B 3VGPA 4I81A 5CB6A 5KKCA 4X7PA 2OK7A 3TCKA 8LDHA 3IMCA 4OM7A 3DTNA 3CUEF 3O8CA 5H82A 2GD6A 3U1TA 2O3QA 5B30A 1HDCA 5M2QA 2JGFA 5A06A 1N6NA 1NF3A 1RWQA 3A6GA 3OQVA 3OEHD 2IDZA 4BQFA 5CM9C 3RVRA 2UVPB 3LRXA 4KQMA 1KTIA 3KQTA 3DL7A 2IE8A 3OTQA 3MWEA 3N28A 1SNYA 3EXIA 4FOOA 3PFIA 4ENTA 3PRKE 4R7TA 3EOAI 5I4KA 1YE3A 5L6LB 2QIOA 1M9NA 2GN2A 4IJKA 2OXIA 5TPWA 5LSAA 2V7GA 4ZK2A 2GS9A 3W4JA 2A35A 3BD9A 3HRKA 4W6QA 3HCDA 3F67A 3L79A 4H17A 4J16C 5EERA 4AFNA 4A92A 3QVMA 521PA 1GQFA 4UJ3A 4MW1A 2JFFA 4PHGA 3A2NA 5EP2A 4WBSA 3RFFA 2A9FA 2X23A 1XDSA 3JYOA 2EL9A 2XOEA 5C0OE 3SZRA 1UBMS 3CF6R 4PGGA 1GADO 1H4QA 1W0KD 3DC2A 4AW9A 4ZI7F 4TYYA 2FDXA 1ZS9A 1ZSVA 5LPNA 2VT2A 5ERXA 4OX9B 4HJRA 2NO1A 3BRWA 4H9GA 4B32A 1L2TA 2CCKA 3EY4A 3K9GA 1Z16A 3Q8WA 1A8IA 3GUUA 4YPFA 1SIUA 1AUXA 5IEJA 2VYCA 2V7QD 1PWYE 3E7XA 4AB1A 2W2PA 5JCXA 3MT7A 3H1BA 3WWEA 4FR5A 3TLKA 2LNDA 2HPVA 1JI0A 3KJEA 1NMYA 1NAIA 5K9ZA 4P58A 2YV1A 4D3ZA 4YEDA 4YLEA 3JD1A 5BVHB 4CR6A 4V0KA 1L7EA 3AFHA 3NP7A 2CXQA 3W3ZB 3JQDA 1T5OA 1K6XA 2XCOA 3DHVA 1H93A 1XAHA 4QYMA 4HB0A 4CIBA 4X95A 3QPCA 3U4MA 3BBLA 1PV4A 2ZB2A 2XCIA 4M1ZA 2ZAYA 2ZSDA 1KK0A 2ONKA 4YASA 5JSQA 3KOWA 1ISRA 2QE6A 2QLFA 4BO9A 4LQDA 3IE2A 1N5MA 3AQ4A 3DAGA 4WJLA 3F9RA 1Q14A 3LYLA 2CB9A 4ARVA 5K8JB 1BZYA 2HDWA 5HZHA 3TGLA 3QKRB 3GZNB 3IAFA 2OZVA 4ONEA 4QD3A 6ABPA 4JC8A 1LI4A 3BE6A 1DL5A 2ZG6A 2CFRA 4C4PA 5CDTA 1A8PA 2ZJ6A 4OHYA 2MSLA 2HU5A 1R0LA 4DJAA 3KZVA 1JG6A 4CL3A 2NADA 2ST1A 4NMLA 4YT2A 4LOAA 3ST7A 1L5SA 3U60B 3T7RA 4R83A 3LW7A 1N6PA 2AEJA 3FZYA 1NP3A 3AUXA 4MAAA 4IMPA 1WB4A 5B2ZA 4AKTA 4EHKA 3IVXA 1IWOA 2NW6A 2GASA 4ILKA 1KOGA 3HKEA 2VLBA 3KWLA 2IKQA 3PPXA 3K8YA 3R23A 2O2IA 4S2UA 5FPHA 3CPSA 1Z88A 2OCAA 4HX5A 2NYRA 4JAVC 3QXHA 4MITA 4ENWA 2Y3IA 2ROQA 3OPYA 4NBVA 5CEFA 2VPPA 3JY6A 3O4JA 3EG5A 2JHGA 4GLFA 2QMHA 5FDFA 4OYLA 2FLWA 2PKRA 4OHOA 3RJ9A 3KWJA 3B5JA 3AEQB 2ZROA 3EGWA 2O3RA 1IXKA 4FYPA 1OY1A 2XXBA 4JJ6A 2HIAA 5LU8A 1IWBB 4J9UE 3BSYA 1XTSA 4DLPA 1V4NA 3FNQA 5BN1A 1Z08A 4XVUA 3HACA 4IZHA 2PBZA 4M8KA 1DARA 2J7PA 4PWZA 2RI1A 1N0IA 4Q7MB 4BP9A 5B6IA 1N25A 4C01A 3QE3A 1NR5A 2VVTA 1NQ5A 4OP2A 4PVCA 1NUQA 2R8ZA 4LVUA 1Z6GA 4INJA 4MUBA 1M34B 1VYUA 4E22A 5JZVA 1CUIA 2Q2NA 2QTMA 1XRNA 3BXOA 1QONA 2R8XA 4U2KA 1HNWB 4ESOA 3WYEA 3E8SA 2GAIA 2P4QA 4TSFA 1GUYA 3QH4A 3SLGA 3TN7A 4HS4A 4BCBA 1IK4A 1SRQA 1Z56C 2IYQA 5LB2A 4ZHSA 5AIBA 5IKMA 2Z2KA 3CZCA 5J4YA 5CR9A 4KR9A 4YRBA 1PJ4A 1H8HA 2Z3ZA 2PAFA 1PSWA 4KXMA 2BGGA 1HY3A 3U4QA 4ED9A 5AJHA 3VNVA 1RRKA 3CV3A 4D4JA 4CQMB 3BWEA 3I01A 1GEGA 2XB4A 3FSJX 1QBKC 2EKLA 1UZAA 1SVUA 1Z4LA 4NBKA 4QE3A 5GGYA 5J4LA 3THYB 3LHIA 3PT9A 2BL4A 3NHSA 2FFRA 4MGEA 2PPVA 2KI5A 3E23A 2H0RA 4IH9A 4BO1A 3E27A 3L49A 1YIAA 3B2QA 4QYXA 4TS9A 2DC1A 5GONF 3W7AA 2EJBA 4GW3A 1E66A 2AUTA 4BWFB 1RLTA 2QOEA 3U3JA 4F3NA 3IURA 3VH4A 4UM5A 1P18A 2OCLA 4DMGA 1E1NA 1J1IA 1OWLA 1SHKA 2J3JA 4ZA2A 4IGEA 4Y2YA 1KSJA 1T2UA 1TA4A 2OOSA 1VB5A 4BX8A 4X3CA 2REOA 3K1ZA 1N5RA 5T5QA 1GD1O 1HZZA 2E5LB 5J23A 2LBPA 1K8QA 4DLBA 1TJ4A 2K87A 2TMGA 4EX6A 4QRIA 4OLAA 4AXXA 2VAMA 3IDSA 4LC9A 2X8BA 4PGMA 3TD9A 3VZSA 4BLTA 1ZSYA 4CQLB 1E2LA 5DTJA 2OP1A 4ZVLA 3G89A 3L1VA 2QQFA 5IXJA 3ZHOA 3EZFA 4G0ZA 4M53A 1XJ0A 3PQ6A 4LBVA 3H4VA 1KVTA 3BVPA 1A2BA 2XCTB 4GX1A 3OEHA 3HBMA 4G5QA 4IBOA 3Q15C 3KQMA 3DDZX 4URYR 1HQKA 2JLRA 2H5JA 2BEJA 1JKXA 1UH5A 3ZV4A 5BUZA 4DMFA 2ZVJA 2P41A 2JIBA 1OZAA 4FC6A 1J5EB 4OXNA 2LDBA 1K8ZB 2VPQA 1W30A 1T34A 1Y1QA 1UR5A 5IBRA 2LDXA 4GNRA 1U7ZA 4GXRA 1R6AA 1QHSA 4ZJPA 3L84A 2OQRA 1QCCA 2WJYA 4H4EA 4D9BA 1NQWA 4OKSA 4D43A 1FYWA 2WZQA 2F1OA 2PS3A 1IN4A 1JALA 5FL7D 5H02A 5CPFA 1JA0A 5DYNA 1PGOA 1EINA 1YB4A 2O4CA 3E81A 4Q02A 4ZQIA 3RAGA 4JQYA 4EKDA 4GICA 1QVZA 1JNXX 1BS2A 2GILA 2OHVA 1KZGB 4UM9D 2PFGA 1R12A 1HE4A 3MQ2A 1FUIA 1X1SA 2Z2JA 1HDXA 3NX4A 4XDZA 2DHEA 5CVEA 4YS6A 4ZAWA 5JS6A 1IPEA 3ZKAA 3OSUA 4Q9DA 1MJGM 1ZC3A 4CV2A 2X1HA 1MAAA 1VG8A 3CIFA 3EXIB 1DXHA 4LC0A 2WIAA 5DHAA 3ZI4A 3IEMA 3PYMA 1T24A 4BMNA 5TPWB 1V41E 2UXBB 1XJWA 2WM2A 2GEDA 4BC0A 1PJRA 2XMGA 2VJAA 5KYUA 3GLFE 3D02A 4IIVA 3TQCA 3BC1A 1ANKA 3BS4A 3KEGA 3LWZA 2XMQA 1U7DA 2VLIA 4BYGA 4BN5A 1AZSC 1GL6A 1JHPA 2BCGY 1HE1C 1R6UA 1GGVA 4YAOA 2GJ8A 3LRPA 4RZHA 2OLKA 3NIFB 2AC4A 5AR1A 4PNHA 1K6IA 5CJ2A 1ENOA 3SHWA 4MVCA 1QRSA 1E9SA 1WABA 1CHDA 4EL5A 2EW2A 3ICQB 5IVPA 5HJ7A 4AU1A 2NIPA 4ZOCA 4ZT3A 5GOZA 1NE2A 3ZUPA 4ENUA 2X13A 4M7PA 3RJZA 1UKZA 1ZESA 3T54A 3NP9A 1XRRA 2VRBA 4H35A 2M1ZA 3IVCA 1U94A 2Z9CA 1SVNA 1PJTA 1US8A 3UICA 4D4KA 5H9WA 1NM5C 1EGHA 3CRZA 1PUJA 5DTMA 3KE8A 4TXJA 1XVIA 1UJ2A 2OC4A 4OI1A 4F91B 4O2AF 5E6UA 1Y3BE 2NZXA 4UVDA 2AFHE 2ZJZA 3DQZA 1G19A 3EC7A 5BSTA 3BULA 3IBFA 2E3JA 4MYHA 4EWLA 4RMHA 3SSMA 4Q12A 2VYQA 1JU9A 3QP9A 2XMSA 3WLLA 1NXOA 2WTNA 4J0IA 4ETMA 3FTFA 1YTLA 2PU5A 3O1JC 5TJHA 1VMKA 4OCZA 4EDHA 1NVXQ 4BL5A 3IMGA 4EG3A 3VR2D 2AYZA 1AD2A 1E18A 1VSVA 4DUGD 1F2VA 2PUWA 1E3SA 3NALA 1RWWA 4KQ1A 2XYQA 1VL6A 2BMEA 1Q22A 3IT3A 2HTEA 1F8XA 5HR5A 1Y6QA 1YHYA 4YAKA 2HBYA 5CXSA 1E2EA 3OI7A 1NP6A 5F9MA 5CIWA 3WLRA 3FYCA 4I50B 5KHAA 1NI4A 4OKNA 5JO0A 5D3MA 5DM0A 3A10A 1YS9A 3L7BA 4COOA 4KE7A 3ZY4A 2YOGA 5D6OA 1DCMA 5ICGA 5C5CA 1Y6JA 5JASA 1XJCA 2VHYA 3ZV7A 2RKOA 4PCVA 3MLEA 3ZLVA 1NVUQ 1ZRMA 3FPBA 5IZCA 1YONA 3D6TB 2V7PA 1U8YA 4BV8A 3R75A 4BNZA 4GSKA 3C4VA 3R5KA 1J1UA 1AO3A 2VJCA 3R6LA 2Q5HA 5CNKA 1CEXA 1YDFA 1OBHA 4HB3A 1XX6A 4J2OA 4R2JA 4QFDA 5TMBA 4CM1A 5K0SA 3W06A 4A82A 5JYEA 5L95A 1W2GA 1E64A 3OPYB 4XQEA 3R0XA 4L76A 1Z06A 4AO7A 1LBTA 2NUAA 4HNVA 4II2A 1R8QA 1EDEA 3HBNA 2WJVA 4HRVA 3QU9A 1B41A 5LQKA 3ZR4B 3AUYA 3HV2A 5C32A 1EQ2A 5E7MA 3S2ZA 4JYZA 5KSOA 4XGNA 2UZ0A 2HRQA 3L7DA 2XUZA 5IVHA 2PGNA 4D9JA 1QHHA 4BUZA 1COWD 3GQBA 1NQVA 3T1OA 4ESEA 2Q5IA 1E9EA 4X92A 4B82A 4Z7NB 2HUPA 1NVDA 2Q5OA 2C7VA 4NCHA 1Z37A 1ZNYA 3L6EA 1D1SA 4GVLA 5HNKA 3HCPA 2PT6A 5LQMA 2VWHA 1X9IA 1XZLA 3K20A 4FJ0A 3ZZNA 1L7OA 1OU0A 5TPZA 1F7VA 2BEKA 1SBHA 2OAGA 2R8EA 3D2LA 3FPLA 1GA4A 2VG8A 3NEAA 4GF5A 4NG5A 2X0NA 3T6KA 2ZRNA 3WGJA 2Q9UA 3LPMA 4QUKA 1AMNA 5EIBC 3DZGA 5B3LA 3F46A 3WWCA 2FETA 5SYMA 4MW5A 5EOVA 5K6AC 4GYKA 3KC2A 4UMEA 3ZWCA 4BVAA 4DIUA 3ER8A 3IEIA 3AQIA 1XZKA 3FTCA 2I7DA 5EJ5A 2A78A 4JJ8A 1KJNA 2DUUA 3FPHA 2WV9A 3GZTB 4O4HF 3UJBA 2QN8A 1LNQA 1KO4A 1IONA 2ZU6A 3ILXA 7YASA 4AROA 3C70A 2J0UA 3OE4A 4RS3A 4AJ9A 4AZ3A 2MMCA 3SSNA 2Q3DA 3T15A 4Q6WA 2QT9A 4MUAA 2NVUA 3HCRA 3IEPA 3JAWA 3L7KA 4RK1A 5ENVA 1KZ9A 4JB0A 1F8GA 3H16A 4P38A 3TB4A 2XMCA 2V7EA 5K20A 4S1WA 1KZ6A 1ZIYA 4I4NA 2OG2A 5TARA 4FYVA 4C7JA 1H0SA 3UTCA 3OF5A 3KYJB 4BNIA 4CRWB 1SAYA 3PNPA 3BEOA 1X7DA 1C4WA 3GFQA 1M2OA 3MT0A 4QVIA 3NBUA 1V8PA 3M1LA 3SX2A 1V8FA 3AHFA 1OYOA 3DT8A 4NI5A 1WB6A 1O9HA 4L78A 3H6GA 2DG2A 4IXTA 4XW2A 5FV4A 3RS5A 2BGWA 1X15A 1JZTA 1GVHA 5K5EA 3JSAA 2G5PA 3EUWA 4WBNA 3MIIA 2WMDA 1XO1A 3PHHA 2IC5A 1YOBA 3HFSA 1OGIA 2J9FA 1K8RA 3A0UA 1E6WA 2WSYB 1PNOA 4WXHA 1RLMA 5MDHA 1KFBB 4P92A 3AJAA 1I4DD 4TMVA 5DB4A 4QDJA 4A6XA 4L4XA 2F9MA 4Z51A 2OENG 4ARSA 4GWLA 1GPNA 4QAJA 4M0DA 4L50A 4PYMA 1BA2A 4UVIA 1G1MA 2WYHA 5JZ9A 1NV8A 1LS1A 4HK4A 3EBOA 2GN0A 3PWKA 4HEA6 1PZMA 1RWVA 5KYGA 1L5VA 2JIDA 3CRNA 4ZTBA 3V80A 4RULA 2WF6A 3AESB 4LQLA 1H2XA 4EHLA 4IIHA 4BMZA 5HBGA 2R7NA 3N2LA 1J23A 3H5OA 1DB3A 2GPSA 4M0PA 1G9XA 4EW6A 1TCVA 2HRRA 4MUXA 1RQGA 1JAHA 3EIQA 4GR5A 5DYYA 4LZAA 1EUCA 4JR1A 5AVOA 5B1IA 1C81A 1B23P 2BH9A 5GPBA 3UJHA 4FMCF 4ADSG 2WYWA 4ZEXA 3QMVA 2BCEA 2W6ID 3GVPA 3A7EA 3FPCA 3QXXA 4MA0A 1GY8A 4WZBA 1QE3A 2ZUSA 4IM7A 1U3WA 4ZT2A 1T3LA 2HEIA 3LXMA 3R5JA 4QO7A 1JG2A 4F5YA 5KQGA 1JHXA 4MWGA 3U39A 2WHEA 1GKYA 4MAFA 4YREA 1K98A 4QEKA 2EKQA 2X42A 3F5FA 5KYUB 3I1FA 5JXHA 3T0GA 3O83A 3PDCA 1CUHA 4GPZA 4PINA 1JDBC 4RQTA 5LCXA 1UJCA 2VAVA 4B84A 1G6KA 2EX0A 4RPGA 5T41A 2WUWE 3OE5A 4EHNA 5BNWA 3R09A 1AQJA 1XYVA 3O75A 3MILA 5BNTA 1F6WA 5F9HA 3FF4A 1RNLA 3RHZA 1WW3A 1JAZA 2CNLA 2NXCA 3KZCA 3QSYA 4ARIA 3NXSA 1N5OX 4JOBA 3ORQA 3IEXA 5SV2A 4V1CI 2H57A 1N2BA 2V97A 3KQLA 4LQ4A 4G1VA 3ABRB 3OZFA 4A0GA 1RPAA 2BMFA 2W48A 1KVQA 1JXOA 2IEBA 2R5FA 3KT0A 3QEMA 1VCNA 1Q0HA 4I7EA 2WLSA 4MQBA 4NCNA 3WJ2A 4DIFA 5CBPA 3DMRA 4YVFA 3RHSA 5AK0A 4DUGA 2R62A 5K3EA 4UZFA 4KI7A 3ZE0B 3ACCA 5CAEA 4HFMA 3QKIA 1V9CA 1ZD2P 3F6CA 1US8B 3KLBA 4E3WA 3HA3A 1CUAA 3PD1A 3R9KA 5LFAA 3SKYA 2M1XA 3CNHA 3L04A 4B3SB 5ARBA 5AVRA 5E6UB 4ZGBA 1VIYA 2ZSIA 3B1KA 4OHFA 4QASA 1KRXA 2HB6A 5C35A 3FB4A 8ATCA 4B4OA 4PZLA 2XDWA 4R31A 1FTWA 1ZMXA 4Z6KA 1CJTC 1BIFA 2B82A 2YXLA 3BGOS 4UMFA 5JSHA 1BAPA 3DHEA 4AUMA 1HDRA 3P0FA 5E7JA 3A11A 1VHLA 1XZMA 2GFQA 3EEBA 3ESQA 5I7VA 3HEMA 3VPXA 1FTGA 2HRCA 3DAPA 3IUNA 3QUSA 4H1UA 1OFIA 1JHQA 2BHRA 4RPJA 4WQMA 4BVHA 3F3MA 4HGYA 1WDWB 3OU6A 4X63A 3VNAA 5AD1A 3WJ1A 1GG8A 4ZXPA 4ZHQA 3THXA 3ZU5A 1IN5A 1OZGA 4AF8A 3QEKA 3ZWYA 2HM7A 4ZYVA 5IJ0A 1N0HA 4W1SA 1ZI6A 2PZKA 1C7EA 4QTXA 3RC9A 1UBGA 1ZWKA 2WNIA 2OYRA 1GPBA 1NI4B 2RH8A 1UBTS 5D3MB 2O3SA 5A6VA 1BQEA 2VC2B 5AESA 1TLFA 2FPPA 5TQVA 4IQ4A 1V5EA 3IQZA 5HW0A 3W5AA 3EDOA 3I0MA 2CB0A 1QORA 2ZOSA 3ECAA 3M89A 3M34A 3TTSA 3UWDA 1AQIA 4D25A 3MTDA 3A32A 1COWA 4AP6A 3CRRA 3V4LA 3IAHA 4BN4A 4C3UA 5LJLA 3PT5A 3MVEA 4GSYA 4NKRA 2Y0BA 4IAOA 5HIKA 2XVAA 2YBEA 3K9NA 2OG1A 3P26A 4GBMA 4PAWA 1RQXA 1G7TA 2G4VA 4HWTA 5LC1A 1JYFA 4YLGA 4BE4A 4I1RA 1YC2A 4PPNA 1ZD9A 1FY2A 4QRHA 4NR0A 4YMIA 4BO5A 1MAUA 5EIEA 1E3JA 1M5RA 3NUZA 3SQMA 2L0XA 2FF5A 5CYOA 1MXHA 1UT8A 3N2GB 4PNPA 2NUAB 2ZREA 1KA9H 1P19A 1L4KA 3ZS8A 4D1YA 5KVQA 4ZOQI 3NASA 2VH5R 1RCTE 1SOWA 2X1MA 4AKGA 1L4HA 1LI5A 3DVQX 1EFHA 3BHJA 1L1EA 4KKVA 3ZEIA 1QHHB 1L8OA 3CKLA 4GDMA 1NNI1 2AD5A 3GQBB 5BYJA 5ULLA 3L8EA 2IOFA 3VPSA 1UADA 2CZGA 1IY8A 1I0ZA 3W0LB 5IUNC 3NOVA 4OMDA 5K4HA 4URXR 3ABQB 4AJOA 1E0JA 3CWZA 2ZP1A 3SE7A 4YP9A 1L8AA 1MU0A 2WM8A 3E3NA 1YE8A 2WM9B 4HSEA 3TGPA 3RKUA 3LX5A 3AHIA 4LXHA 3STUA 3QLUC 2JFVA 3CVVA 1LB1B 3QW4B 3U37A 1MH9A 1P80A 2C04A 4PR0A 3T9CA 1SCAA 2JIRA 2GHTA 4KQIA 1RM4A 3NEJA 4EL0A 1XK6A 1SIBE 1YZUA 2OGTA 5FI3A 3V1YA 3Q7TA 4OXIA 4KFTA 4C3VA 1EFUA 2D54A 1L4LA 5FADA 4DCPA 1LVGA 5CX1A 2WAXA 4V2IA 3QLEA 5EFOA 3FY4A 1J25A 1Z8NA 3EC1A 4LYDA 5DM2A 1G21E 1JQ5A 1TKBA 2AOUA 2J0UB 1VJRA 3C45A 3IXLA 3KP1A 1UXKA 3OT1A 4HYEA 3MBOA 3W6PA 4AZ3B 5E0KB 1H23A 5IC4A 2E6KA 2NVUB 4ARCA 4RH1A 3Q40A 1N3BA 4HGOA 3HCNA 1RMTA 1RJEA 3WK6A 5K6RA 3OQBA 3VAAA 1KDZA 4PPGA 2H9AA 4NP6A 4IHQA 2FR8A 4Q7EA 1DQNA 1LV7A 4IJ5A 2JFNA 3FNIA 1PD1A 4TL7A 4DL9A 1NASA 5I7UA 1FP7A 2MDTA 3NPAA 1FFGA 1ZVMA 1M2OB 2XF8A 2IU4A 2QSUA 2C8KA 4J1QA 1IJEA 2X15A 3HSSA 4GUAA 5L3SA 2Z1NA 3N7TA 5C31A 2FEOA 1GCOA 4UEJA 4DLXA 4WBNB 3DYBA 1I3CA 2XI4A 4ZVVA 2WIKA 2Y4NA 1CU1A 4MW9A 2J9FB 2O6LA 3STHA 3GJRA 4FQ7A 4IDDA 2UYHA 1V8DA 1U2DC 4NZNA 2MSNA 3K9CA 1KDPA 3LQQA 4YJKA 4TS3A 2GXAA 5SZKB 1OU4A 1QG2A 2G8LA 2Z4TA 3HWRA 3ZW7A 2XRMA 2NSLA 3RT9A 5IJ9A 2HKIA 3V8MA 5ISMA 1VGQA 1NBIA 2ACEA 1GEEA 4CF5A 4AUKA 3AXSA 3EK2A 1V3QE 2D2FA 3KSZO 1MJHA 1P0PA 4MJ3A 4WCDA 1GTZA 3EVTA 1S8NA 3NHKA 1AC5A 5FIUA 1J56A 1SG6A 1E2DA 4Q3LA 2J0QA 1Z22A 2RGYA 2NU8A 3JQBC 2BSAA 4OXRA 5JYBA 2QNRA 1FFHA 1K8YB 1BFKA 2MWMA 2IHKA 2ZI3A 5H5JA 4YNBA 2YVAA 3H7AA 3K09C 1EUCB 5ALMA 5BUQA 4RKWA 5B7PA 1E4OA 4FYIA 4WV3A 1J22A 4MUGA 4Z4EA 4ZVQA 1Z68A 3H2GA 1PL8A 1UC8A 4QPZA 4US1R 1CULC 1WCYA 1J7KA 1KEPA 1S7CA 2JA2A 4WZBB 2GXUA 2OLJA 3VPCA 2PR2A 2VXBA 1AV6A 4EMBA 4KW7A 1XMSA 1CF2O 4FJ2A 1VHTA 2BP7A 1BE1A 1YA6A 3AGPA 1U6JA 3OG9A 1R1DA 1JHMA 1FQKA 1UFKA 5HILA 3CVYA 3TAUA 3VR1A 5EE0A 2VNSA 4LF8B 2FW1A 3M7IA 5AVJA 4YRMA 1EJ2A 3CE9A 3H0EA 1GKKA 3M5WA 3OCXA 3RGGA 1JILA 2J30A 2RHTA 3W5JA 2O2YA 4ZVKA 4BN0A 4DMKA 2DT8A 3O4HA 5DSTA 4ZMSA 4QQNA 1DRKA 1K06A 3VR3D 3BL5A 4OK3A 4QXMA 3BSSA 3G2OA 3VH2A 2BY4A 4YMTA 4B6OA 3PTZA 4EEKA 3QEMB 3HPQA 1MB3A 2X9VA 3UAGA 4A4DA 3L40A 5CBPB 1GV1A 2RGXA 2Y1KA 3KJIA 4O59O 3I45A 5CAEB 1B0AA 4BZQA 4D9CA 5A7FA 1DG3A 1TD1A 2CMDA 3LPLA 1W94A 4TMTA 3F6YA 4AMVA 1ENYA 1P60A 2PEYA 3IDQA 4X3PA 1YS4A 5FUBA 2I91A 2JGEA 2R6HA 3MGKA 4CKEA 5HVNA 1UDAA 2FI1A 4XRGA 1GV0A 5AW8A 4FGSA 4TTVA 4EG6A 2J3IA 4YRZA 2IIQA 3DE4X 1G60A 1XDBA 4DF3A 3DD5A 4F2HA 2PUGA 3NCHA 3MWDB 4GM4A 5EXXA 1V48A 3HCCA 1LLQA 1T0JB 4G8DA 3WX0A 3SYRA 4Z7JA 1XMQB 2A4KA 3WL7A 4MTLA 1J70A 3TLZA 3VKWA 1JDJA 4IDGA 5HYVA 4OQEA 1WLSA 3HHEA 4L2IA 3V1UA 3R6GA 3NRBA 1ECJA 1EI9A 4L4RA 3TX2A 2WTEA 3BA1A 3THXB 2PAAA 4ZHQB 5C4GB 4WX2B 4ZPJA 5IJ0B 1YB7A 3PZBA 4P4TA 1K27A 1UZUA 5ILGA 3FLEA 2ZWMA 3DDNA 4A10A 1EYZA 2IU6A 2RKWA 4DQ0A 5ESRA 1WULS 2A0KA 1D0SA 3HPRA 3MOGA 3O4IA 4FFMA 5K0EA 5CXXA 3QOWA 4Z99A 4AJKA 2I34A 4P0QB 5JFOA 4DSOA 2FPPB 3A28A 3OCJA 4Z0HO 4N8SA 4QYIA 1QFJA 4PLTA 4EZIA 2I1WA 3ONVA 4RGVA 1Y5RA 3L1JA 1CUWA 4DTCA 4BLVA 2XYVA 2XQJA 4YRGA 5EJ8A 4CQJA 4TT8A 3OC6A 1XU4A 5D51S 2PM8A 5AYVA 4BQOA 1ORHA 3DCJA 5B2EA 4L0QA 4NFLA 4RTNA 3PHLA 4JLNA 1JYEA 1NP7A 2DSNA 3PEFA 4KPUA 1SOAA 2IX3A 2RHLA 5FLXA 3OF3A 3BMNA 3VYWA 5IAEA 3GPBA 2VP4A 4ZQCB 3DDOA 2XCRB 1T8SA 3IP3A 4KFRA 1EE1A 3ASYA 5EXSA 1E8NA 5KCZA 2QJOA 4O33A 3AYXB 2QLTA 2X7XA 2OCYC 3L1KA 4DS3A 1L5WA 2C54A 3SPXA 4EA8A 1SVMA 1S9HA 3K15A 4JL6A 1D7OA 1CY6A 4IJMA 2NSJA 2P90A 2Z57A 5K3CA 1XPUA 4FZRA 2REBA 3OJFA 2VNIA 4CG2A 2C7BA 5IAJA 4JOCA 1RHMA 3EG9B 4I5FA 1TZMA 1ETHA 4P5DA 1X87A 4EITA 2X1VA 5DGDA 1D1QA 1UDCA 2ODBA 2FFQA 2GERA 2C4WA 2Z6VA 2XJ4A 3LDAA 5CLQA 3J80A 5IAAA 1TD9A 2H2DA 2A9PA 1ODIA 2H5EA 3BGVA 3BHMA 3E9RA 4FN5A 1WCV1 3GNQA 3NUQA 4G1BA 5CB0A 2EARA 2EJUA 4UJ5A 3CUSA 3HYNA 1LDEA 1D6NA 1ZMRA 3IP6A 1T3SA 3JZDA 4YX9A 2ZPUA 1YBMA 1UP7A 3AEXA 3LDGA 2J3HA 4BP3A 4L6IA 3V2GA 3LF1A 1A71A 3LP5A 1KHTA 5EC8A 1NONA 4CKBB 2P79A 4K1XA 5CX1B 2GPNA 3S29A 4C7XA 1T6NA 3HVRA 1VIDA 3DMDA 1D4OA 4AF7A 5BSKA 3GLIA 1FVXA 2AOUB 4X7RA 3FAZA 2E5FA 2WIBA 5I47A 3OT1B 1RRMA 3OIWA 1OOEA 5JHGB 3F3SA 5KZMB 2Z1DA 3KOXA 4H1TA 3FHJA 3FF1A 3S28A 4EMUA 5J43A 4CODB 2O1EA 1SGWA 2J3KA 1E2IA 2QMEA 3DDHA 1VE6A 3MLBA 4IGIA 2ZJ1A 4ETWA 1KBQA 4Y2TA 3NW9A 1AY0A 1LA2A 2XVYA 4PAMA 2CLFB 1A7JA 1CJUC 4O1MA 3HB7A 3IIJA 3PXXA 4HQOA 3JWIA 2BGTA 3AM5A 2HF7A 3ERCA 3MJDA 1E6KA 2Y0CA 3B6JA 3PIDA 3WYCA 1KQGA 4MWDA 2A14A 5AI8A 1W1IA 3ZPXA 2V3VA 4B75A 5L3SB 1LEHA 3F3KA 3AI7A 5ICEA 2CSXA 4BB0A 4K1LA 2N1MA 5F78A 4OHPA 4JLSA 4CT5A 4LGVA 2I4RA 5JC1A 1YDMA 1N6IA 3GY0A 3RV3A 2C5LA 2WIFA 1HG1A 2WF8A 3EWSA 3EJWA 3U5ZB 2PCLA 2VDUE 2JAWA 2Z30A 3CN9A 1ML3A 3MS2A 4JOSA 4M8NE 1Y33E 3K96A 3MQFA 1D2RA 2ZJ4A 5BOVA 1I0LA 1TTTA 3O26A 4K88A 4HVTA 1ZJWA 3OTWA 5IJ9B 1ESCA 2CL7X 2OM2A 3UMSA 4D3FA 5K3FA 3KB1A 1DCKA 4M2LA 1M6WA 3I4CA 1MRNA 1R0RE 4JJ7A 4B4WA 1D4FA 1U98A 1CC1S 3BD7A 5GGXA 1LRKA 3PC8A 1XVLA 2O50A 4X90A 4PIMA 1PEKE 1WWKA 2GWRA 3B82A 4L8GA 1XQVA 2C9BA 3ELWA 4MP8A 2CVZA 5AOBA 3RVOA 4BIMA 1UXJA 1TC2A 4JBWA 4NSNA 1E32A 2XOKA 1JIQA 5EHQA 1G7SA 1SEPA 3RJMA 4EUFA 4ND2A 4UMVA 1U1GA 4LF5B 4XRRA 1QTRA 2XUGA 1QIMA 2P0AA 2RJOA 1NBWB 1VBFA 3IAAA 4HO1X 3N0VA 5AMXA 1V71A 3RF7A 3VR3A 4UNSA 2I8LA 2KWIA 2ID9A 1BHO1 1CR4A 1QUFA 3PQ5A 2IELA 4N0PA 4ODIA 4LKRA 3EPKA 1A4XA 1NXVA 4DCOA 4LF6B 3DBRA 3QVWA 4FGZA 3OCVA 2OR3A 3CHYA 2BP7B 4ROTA 5ALTA 1GSOA 3ILSA 2GEKA 2Z8YA 1ISPA 2E6UX 1KFEB 1JFFB 1RWXA 2N1BA 4MVXA 4QJ4A 5EUBA 2FUNB 3HMQA 1SQ0A 3A6EA 2GZ3A 3GRVA 1KO1A 1DS6A 2A5DA 4MLZA 1GTL1 2SICE 3NBQA 3OTIA 3C5EA 2XYHA 4EUKA 5BV0A 2VAWA 1QIEA 1TQ4A 1HDGO 4FU0A 4HXYA 3T5DA 2FMXA 2ZE6A 2J5QA 1QIDA 3AJ9A 3DOOA 2OMEA 3ROKA 1AJEA 3BIWA 1B8NA 2HK7A 1E2KA 3NTRA 1FMFA 1EVEA 5A05A 2R8BA 1NN1A 4OBWA 3ND9A 2DBRA 4P35A 3FDZA 4XYMA 4C1NA 4ND3A 2J09A 3FPKA 2ZYGA 3GJQA 3KSUA 2H4XA 1B0UA 4Q7LA 4ML3A 4E33A 1TU0A 4JT2A 2JAOA 2PV0A 3QX8A 2W2KA 5HZGA 3NHBA 3F96A 4IO1A 4M36A 2FG7C 2G1KA 2Q6VA 4MGIR 3X0DA 4CKEB 5G1NA 4BAGA 2NTVA 3W34A 3ET5A 2PRIA 1V47A 3NHRA 2H4JA 4GXTA 1E96A 2PZGA 2ORIA 4JVLA 3ZD8A 5FHQA 1U2PA 4I9HA 4AS2A 3M6WA 2DQYA 3QLJA 2DECA 3EW7A 4BATA 5LBTA 2PLNA 3OVMA 5HTOA 3RTGA 1FDVA 1NRJB 1U5AA 3C14C 3G8BA 4ZO9A 2B1RA 4TLCA 2YV2A 4L2IB 3T35A 4UOEA 4ZEMA 5CFMA 2IP1A 4JENA 4YP5A 1WBBA 2ZULA 1EG2A 2I3AA 4OQXA 2FEPA 5E2AA 5C7LO 3I52A 4EHHA 1MPTA 2YX1A 3CX8A 3ULKA 2G70A 3I9V6 4AJIA 4D9HA 3BM5A 4NPAA 2HYIC 2QM3A 3HB9A 1VSQA 1BS9A 2O59A 3W5VA 1NOJA 3QELA 4WA8A 1II9A 3BGSA 2AT1A 4ZO4A 3NBYC 3CCFA 3IE1A 2R11A 3TVYA 1BROA 1QYWA 1ZM4A 2ZJ7A 3RUDA 3GGOA 4PRLA 3DDUA 5IHXA 2GZ2A 2Y9PB 1WUHS 1MHTA 4U3JA 4QPPA 3V6MA 1GU0A 2FSHA 4Y2PA 1L5NA 5FUQA 5CCXA 1F6BA 2I55A 4TYQA 5K8TA 1BXGA 1ORWA 2ODEA 2ZUFA 3PWZA 4D79A 1KEKA 1CPYA 1O0SA 1LTQA 3BOSA 2FQXA 3LL7A 1JQLB 2D1SA 4WLVA 3GPLA 4DDHA 1EQAA 1SO8A 3T4XA 4EYOA 4KPFC 1A1SA 4O4JA 1H2AS 1Y7HA 1C0KA 1PN3A 3L8MA 4KPUB 4F45A 3O0DA 3VAYA 3BMNB 4IIJA 5FBQB 2GCPA 3PXDA 5E38A 1HR0B 4UEQA 2DZDA 2COEA 3HL4A 3IS3A 3KKZA 4Z8XA 1RRCA 1THTA 1TQHA 3E82A 1SCBA 2ZIFA 1NVVR 2WDZA 3GLUA 4ZT7A 3MS4A 1Q1AA 1OE0A 5CHEA 1GRNA 2WPNA 4A2PA 5FH9A 3KAJA 4N40A 3CPEA 2YWBA 1EWVA 5KYTA 4DBVO 3TJZA 2EW1A 2J59A 3OX3A 4G5OA 4EPRA 2GVNA 4I4CA 4BFCA 3C8MA 1WZUA 2PGOA 3FWNA 1PFWA 2WUFA 1JBKA 1G3RA 4BVGA 2E4XA 5I51A 1NMQA 5JFGA 4JV5B 4X1IA 1IJBA 1Y1SA 2IHYA 4QTTB 4OHRA 1SOMA 2VSNA 8OHMA 4IY1A 3EMBA 2X5NA 4HYQA 3RVLA 5DNAA 3QNUA 5TSDA 2IZ6A 5CLHA 1CEYA 4PHHA 2IGBA 1JHAA 3HI4A 4DCJA 3JARA 3CH5A 3JD0A 2QK4A 5FPSA 4IG9A 2ZCJA 2A9QA 1SQ5A 5JJIA 2LKCA 3T3GA 1SURA 4MRMA 3BXZA 3ZV5A 1DKUA 5BQ3A 3MWLA 5B55A 2IYOA 1DAKA 1E5TA 1FJHA 1SVLA 4H7IA 1NMEA 5SY6A 3TEMA 5CM2Z 4F2GA 4RDIA 3VDXA 1KYVA 2PHZA 3GLIB 4B5LA 4F96A 2R47A 1NZJA 1RYHA 3NQ41 1KRWA 4ND6A 4EF4A 1C9MA 2XUIA 2ZSHA 3D4OA 4LNUA 1HL3A 1IUOA 4F85A 4DR1B 4GOND 2Q7OE 1FF9A 3L41A 1JEQA 1L9XA 4EKEA 1VFNA 3DNPA 3KQNA 1QQTA 2Q41A 2AFIE 4GE0A 3DEZA 3ZDYB 4AN0A 3BIFA 4Q9LA 4LVCA 3ZGYA 5TS3A 2QR2A 3AR3A 4TQGA 1KQPA 1FDOA 4GMKA 2FJ0A 2RGGA 5KKAA 1CR0A 4QOJA 1U1EA 3OTGA 2WWWA 3VYSB 3OUTA 4JC4A 1VYHA 3SS7X 1U7WA 3OFND 4IJWA 1L5FA 4K9KA 3BL8A 3KQQA 3M83A 4D0GA 1W5SA 1CDOA 3ET4A 4KMRA 4RXUA 3SC6A 4CCWA 5AQ1A 3I58A 1WSAA 1QHEA 4D56A 3BGIA 4G65A 1G20A 1ZW6A 2BR3A 2E87A 3RVMA 1JUDA 4B33A 2RBEA 2A88A 3GD5A 3NT5A 4Z86A 4I3HA 1O94A 3DE0X 4EP1A 4F1WA 1LDGA 1ZEMA 1DIHA 1EP2B 2PSSA 1ZNWA 3ENZA 3HUEA 3OPNA 4N76A</