4AJHA

Rat ldha in complex with n-(2-methyl-1,3-benzothiazol-6-yl)-3-ureido- propanamide and 2-(4-bromophenoxy)propanedioic acid
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
330
structure length
327
Chain Sequence
ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 118
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajhA02
4BNWA 3GQVA 4I5GA 2RHCA 3NT4A 3I3OA 3RBXA 1TI7A 1HTBA 5JO9A 2GYYA 3PJEA 3ZNNA 2HMUA 3IJRA 3ON5A 1TLTA 4D46A 2B37A 2BFMA 2Y0DA 1E3WA 4EJ0A 3GVXA 1EEHA 3GEMA 4WE3A 4E32A 5CEFA 5FYDA 1ZO8A 4KP7A 3G1TA 3RBZA 3DWFA 1SOVA 4DPKA 2QZZA 3GGPA 4RDIA 2GSDA 5J23A 2X58A 1MXHA 4W6ZA 3TDKA 3W4KA 4BNZA 2VYVA 5HTOA 4NJMB 1ML3A 1XQ1A 4G2NA 2PTGA 5HA5A 2JCYA 3PI7A 4XD2A 1JKIA 1H6AA 2B69A 4J4BA 1KVSA 2BFOA 4YB8A 2Z1NA 5KJ1A 1WZIA 3H3JA 4E5MA 4A2CA 1MUUA 1T25A 1E5LA 3K2EA 4FFRA 3DL2A 3QWAA 4JP2A 3ORFA 2PKRA 3UAGA 3RC2A 4YR9A 3ZI0A 4AJPA 5TSDA 4ALMA 1V3VA 4CL3A 3JD2A 1RPNA 2CY0A 5BSFA 3M1LA 2JJYA 2IZ0A 1B26A 4K9DA 2YDXA 5ADHA 2WMDA 1PJQA 1Y81A 3L4SO 4W7IA 4D0RA 3IJPA 1TXGA 4TZTA 3VPHA 2OP0A 1GPJA 3QWIA 5A4DA 1PR9A 3B6ZA 1SBYA 3G17A 4URFA 1BW9B 1XCBA 4GGOA 1Y5RA 5G0TA 1DHRA 2Q49A 1WW8A 2EG9A 1NPYA 3NV9A 4IM7A 3GMSA 3V5NA 4WKGA 2HSDA 1UXGA 3G1UA 3DBRB 3ZZNA 4B4UA 4CV3A 4TRNA 4EDFA 2GDZA 3BMCB 3JQ7B 4O0LA 2UYYA 4ZQHA 3VOSA 1GUYA 4X54A 1KEWA 4N5NA 1MGOA 3VH2A 1A5ZA 2IDZA 4CM8B 5ITWA 1I10A 8ADHA 5T64A 1ZH8A 5IFLA 4ZJUA 4DQUA 2C54A 4CMKA 4ONEA 1Z75A 2WYWA 4GSLA 2YDYA 5F21A 2JFFA 5A9SB 1H93A 4B7UA 5K6AA 3KYCB 2J5QA 4PZDA 4DLLA 4CM6A 4IJWA 1LSOA 1PZHA 1SCUA 5KVCA 3COSA 5TJHA 3JV7A 4BVAA 5BR7A 4DIFA 2CMDA 1Z7EA 1B14A 3DZIA 4IJVA 4DREA 5JAIA 4LK3A 1C0KA 2VNSA 4XGIA 1NQTA 5DN9A 2C2YA 1NAHA 3WTCA 2HAEA 2Y1GA 4E5PA 4BUCA 4CV1A 3E9QA 3P19A 2J5KA 4HNGA 1HYHA 3NDJA 3VKVA 5CDTA 1DIAA 1NBOA 1OI7A 4HBGA 4OL9A 5HRUA 1N2SA 2G0TA 3QY9A 4MP3A 1HE2A 2FZWA 3VTZA 4RF2A 4EZBA 1ZK3A 1EZ4A 1I3MA 1PGOA 4DBVO 1IYZA 5DCUA 5JDIC 2X7HA 3WDSA 3WYCA 1MXFA 1W4ZA 3EGOA 4XJTA 1U8XX 2VHZA 2X5JO 2VYNA 4GKBA 3PDJA 4NNJA 2J5RA 1B3BA 5A9RA 2PZMA 4H7PA 2IE0A 4CJXA 3ROPA 3HDJA 3WIDA 3DXFA 3M6IA 1PGQA 3LU1A 1YKFA 1WWKA 4JBGA 2GR9A 3RAJA 4J3FA 3WSVA 1SEPA 5JW6A 3SJUA 4KWHA 1QR6A 3F4BA 2HJRA 1D3AA 2RCYA 4CUZA 5IF3A 4ZRNA 4W99A 1R4MA 1X7HA 1T26A 3G3EA 2ZKLA 4H16A 4R54A 5TQVA 4EYEA 4MINA 4ND2A 4XQ9A 3RCBA 5I9LA 2VT2A 1U3TA 2VHXA 2Y66A 4MDHA 3TZKA 2IXBA 5H81A 3JQ8B 3GFGA 2WE8A 5KKAA 4AJ4A 5C3MA 3AFMA 3RROA 1J6UA 2QYSA 4A10A 4J2HA 1R4NA 5I9MA 4I08A 1HE5A 3D4PA 1LQUA 4KUEA 5AVOA 1NASA 5AXAA 5GZ3A 3E1KA 4YCAA 4XIYA 1U7HA 4DA9A 1O89A 2YQ5A 4PLHA 3GPDG 1GPDG 1GQQA 3NGXA 5KJFA 4GWGA 3FBGA 4HADA 4GQAA 4RO0A 4G65A 1CJCA 4Q3NA 4YAEA 1T2AA 8LDHA 1X13A 5F1PA 3W4JA 4QFDA 1AXEA 1BXZA 1NP3A 3DAGA 5DZSA 5FF9A 4BL5A 1DFGA 2I76A 1MLDA 1HT0A 2RAFA 1ONOA 3VDRA 3D3EA 2G1UA 1P1FA 2WJPA 2P9CA 3ULKA 4A26A 5TNXA 2I3AA 2QX7A 5CDUA 1EK5A 1V0JA 1CQIA 3VPFA 1PJ3A 1Y5MA 4D3SA 2AQKA 4B7XA 2VYVD 3C1AA 3U5TA 2PA3A 3FWZA 2VZ9A 1YH3A 3WWYA 1UR5A 3TSCA 4NJOA 5G0VA 1QYXA 5KJCA 2OFPA 4D44A 2HO5A 4J7UA 4ZGWA 2X9VA 1QKIA 3GVIA 4RVGA 1D4FA 3S1LA 3K73O 3KBOA 2XXJA 5KVQA 4YJDA 3SEFA 3F1LA 4E6PA 2JFGA 1TEHA 5BNTA 1ZK2A 4OSOA 1N1EA 2NTVA 3FNEA 1E3WB 4BKRA 4LW8A 3Q9UA 3TF5A 1JDJA 5TT0A 4NK5A 4ZA2A 2C7GA 3TN7A 5ER9A 2YW9A 3GAFA 5EPOA 4XDYA 3K96A 1QORA 3L6EA 4WLOA 3DC2A 5JDCC 1ORRA 1PSDA 1IULA 3ZHBA 3JQ9A 3DONA 1E3SA 1JAXA 3UCXA 2Y68A 3FPCA 3WXBA 1GZ3A 1PS9A 3A28A 1KETA 4TSKA 3V1TC 3VTFA 1T4BA 2V6BA 3HG7A 4DMLA 3ZWXA 4YXFA 5CG2A 1B0AA 4QTZA 5BQFA 5JYDA 3WNQA 2P4HX 2YHIA 1M2WA 3T7CA 4E5NA 3C3XA 3OFSA 4CM9D 3TQHA 3FNHA 2RH8A 4IDAA 3WFIA 2A4KA 4NBTA 5IAAA 2BFAA 4RJTA 5K0ZA 4RDHA 4DLBA 3L0DA 1HSOA 2GN4A 4D3DA 3AK4A 3TRIA 4Z0PA 4D42A 5A04A 4FB5A 3VPSA 1P31A 3KHUA 4CLDA 4J9UE 1XWFA 4NPCA 1VPDA 4FC6A 4DL9A 1R15A 1Y1PA 1R66A 3JD0A 4GKVA 1HLPA 3K6JA 3WQRA 4AJEA 2DM6A 2CF5A 3ETGA 5JE8A 2B4TO 2FRDA 2TMDA 5A5FA 4MVJI 1DSSG 3TL3A 4PLWA 3RASA 4N5MA 1HETA 4XGKA 2WTBA 4FGWA 4WCFB 2CUKA 4ESOA 2G17A 1KY4A 2RH4A 3HDQA 1EFLA 2GN9A 3QW2A 3HDYA 4OSPA 4P4LA 4BNMA 4IBOA 2V7PA 3F6YA 1BMDA 2Q99A 3AY6A 4NBVA 5I7VA 1RJWA 3QP9A 3GY0A 1BVRA 1OFGA 4BO3A 1CRWG 2W98A 3GT0A 3U3XA 5L3ZA 4BNXA 3PLNA 4MP8A 1UP7A 2Y1CA 2FR1A 4L4SA 1P9LA 3PDUA 4E2XA 5CDYA 2J8ZA 3CKYA 2POQX 3GRPA 1YBMA 4RZHA 2CVOA 4GX2A 2ZTMA 2B36A 2GD1O 2DBZA 4Y98A 1ZSVA 2ZB8A 3DOCA 3K8ZA 1B3RA 1Q7CA 3OIDA 4DGSA 3JQAA 3RUAA 1DB3A 1ZJYA 1I01A 2AHRA 2XXBA 3LF2A 1YJ8A 1Q0LA 4MVJG 3WGGA 1PL8A 1N7HA 1T24A 3DBHA 5JYEA 1T1SA 4R1TA 3I6IA 3MOGA 1ZVMA 3HADA 4O6VA 4BGIA 1WNTA 2GGSA 1O5IA 2RBEA 2GCGA 1ZNQO 3GVHA 3IMFA 4J90A 3UCEA 5C5IA 1ZXLA 4IQGA 5FEUA 3AI3A 2GF2A 2E4AA 3DTYA 5JCJA 4RPGA 1IE3A 2GZ3A 3GDOA 3PQEA 4RPHA 5B4TA 4R5MA 5I7SA 1NNUA 1V3UA 4M8SA 5A9TA 3CTMA 3F4LA 3DAFA 2AXQA 3ETDA 4RVDA 4E2YA 1A4IA 2DBQA 5JNLA 3TZ6A 4A27A 1DO8A 4TVBA 3ZWAA 3ENNA 3VAZA 2I67A 4XRRA 3C8MA 1Z73A 2EW2A 2GO1A 3EYWA 1R4MB 4GAEA 3ZU3A 1AUPA 1CF2O 2V6MA 1XLTA 2ZTUA 3FI9A 1ISGA 1UXHA 5ILGA 4WOJA 1IY8A 3D4NA 3MOIA 4XB2A 3PYLA 5B4UA 4RLSA 2J6IA 2PD3A 3KEQA 5HS6A 1E0DA 4YAKA 1KC1A 2PZKA 4OQZA 3JYOA 2OOSA 3E8XA 5GZ6A 2I3GA 4BKUA 4O63O 1CETA 2Q1UA 1B8UA 2JCXA 2FY8A 3PQFA 4OKIA 5DF1A 3C1TA 1YQGA 3HN7A 2PKQO 3AY3A 1PL7A 1YJQA 4NU5A 3ZDFA 4JBIA 4ZD6A 3KLMX 1Z7BA 2VOJA 2Z95A 2X86A 5THQA 5IDYA 4YAJA 2Y1EA 4KDEA 1QYWA 2VUUA 4DYVA 2EP7A 4Y6PA 3U4DA 4YACA 4CLOB 3V8BA 4CQMA 1X7GA 1YQXA 3E6AA 1FF9A 2JD0A 1DFHA 1U3WA 3MTJA 3NGLA 4J43A 4YVFA 3QWBA 1DC4A 3DOOA 3OBBA 1ISHA 4GI2A 3ZWYA 4N18A 3FF4A 5G0WA 3FN4A 4NFYA 3ZH2A 1E7RA 5I7FA 1AN9A 3BHJA 1E5QA 1E1MA 3VKUA 2DTDA 3DBVO 3CZMA 4BMSA 3ZWBA 3Q0EA 1IPEA 2H63A 3B1KA 1Y7TA 2F00A 3FR8A 2EF1A 3OM9A 4LN1A 1BVUA 1P1JA 2GNAA 3NAQA 3PHGA 2J3IA 4U0JA 4BV8A 3NYWA 1HDGO 4KWIA 5CDGA 5IDWA 3IL2A 4XZ3A 2AE1A 1U28A 4RGBA 1FDTA 3HFSA 2ET6A 2P2SA 4D45A 1NQ5A 3ZV5A 4I5EA 3QE3A 1KVQA 4GGPA 5CEJA 2O50A 4TROA 4ZU3A 1BXGA 3L77A 1P1KA 3OJ0A 5TGDA 1EK6A 3IUSA 4J7CA 1K89A 2YV3A 1AHIA 3V2HA 3I9KA 3V1UA 3K2BA 1E1KA 4W4TA 3F1KA 1Z74A 3JD3A 1L1FA 3H9UA 1KEPA 5JO0A 1X1EA 1H5QA 5KVSA 4FCCA 4NR0A 1YWGO 2CZCA 4YTEA 3I4CA 4AJJA 4E13A 3HZZA 4LSWA 1U4SA 1K6IA 4CLHA 1YL7A 3WGIA 2GZ2A 1E3EA 4N5LA 1ZEJA 2D8AA 4AL4A 3IKVA 2NU9A 2AQ8A 2W2LA 4KOAA 3E18A 2YHIB 3WYBA 3I5MA 3R3JA 2VN8A 4GSKA 4ND3A 2HKIA 4ILKA 1LBEA 4ID9A 2ZQZA 2R00A 3FNGA 3PIIA 1F8FA 3ANMA 1N5DA 3GZNA 4FBGA 1FXSA 2I99A 4J49A 5T5QA 2FP4A 5MDHA 3Q6IA 2NWQA 4DRYA 4R9SA 2W90A 3OA0A 1QV7A 2PFGA 4NFSA 4J6FA 2JHGA 3NT5A 3JSAA 2OZPA 3L07A 4WLNA 3CINA 3ZWMA 1PZGA 3AOEA 4ZQEA 4U7WA 4WCDA 5JBIA 1YS4A 4E2ZA 3C1OA 1NQOA 2WDZA 4MVJF 1A4UA 4FN4A 4GVLA 4BNVA 4E5YA 5IZ4A 3DOJA 4DPLA 5JAZA 5JFOA 2X0NA 2B35A 2H5LA 1NWCA 1E3IA 4DIBA 3AI1A 1EDOA 3JQAD 3A4VA 4OXKA 4TRRA 1BSVA 1FK8A 5TLSA 2EEZA 3D4OA 1HDYA 4ND5A 4EUEA 4BV9A 1PQUA 5FWNA 2NTJA 3GG9A 3I9LA 4Q3DA 3INGA 2C7VA 2WSBA 4BKPA 1ID1A 4BOYA 4IZHA 4XB1A 5EQFA 5T8KC 3WOHA 1RKXA 4YT5A 3C7AA 1QV6A 2OO5A 4C7KA 2CD9A 1LTHR 4L73A 5JCJD 2UUOA 1SEVA 1ARZA 1M6WA 3JQBA 4QXMA 4BNFA 5C7LO 4U0KA 3UN1A 1HRDA 3JD1A 4AJIA 1AHHA 3DDNA 3JQAB 1R0LA 2PD6A 1DJQA 1LLQA 1WLYA 2FR0A 2HK8A 4ND1A 2NSDA 1EVZA 2JD1A 4A7PA 3X2FA 4UVDA 3DBHB 2CVQA 4ALIA 2R6JA 4NI5A 4ALNA 1XSEA 3H2SA 3W6UA 2HRBA 3PGJA 5G4KA 4GVXA 3QVTA 5F3RA 3RJ9A 1I8TA 2AW5A 1WP4A 3F5SA 1NWHA 3MTGA 1WAMA 3KUXA 3OJOA 4TWRA 4UREA 2NVUB 1X0XA 3SX2A 1Y9EA 1YOVB 5G0UA 1UAGA 3ZV3A 2LDBA 4UVIA 1SNYA 3FSRA 3WMXA 3WWZA 4OJNA 4BO5A 4L0QA 1ENZA 1HYEA 3V2UA 2E49A 1VM6A 3M2PA 4KQWA 2D0IA 3NRCA 4Z3DA 1XU9A 5L7TA 2W4QA 4XR9A 4NDNE 4PG6A 4XX0A 4DPMA 3V2GA 5CEEA 4BQPA 1DXYA 2A35A 2O3RA 4OOEA 4OMUA 3WNVA 3WGOA 4IXTA 1BXKA 3WS7A 2C59A 3TZCA 3GAZA 1EE2A 3K92A 3OIFA 1MC5A 4ITUA 3DZJA 3O8QA 1XYGA 2E37A 4PLYA 3FR7A 3PJFA 5TX7A 4D41A 2B83A 1DIGA 3GEDA 4TRMA 2JHFA 3LT0A 5ICSA 1ZK0A 4XQEA 4E5KA 3PYMA 5CFZA 2NLOA 1XU7A 1DPGA 1DJNA 1LDEA 3ADPA 3W8EA 3ZWPA 2YYYA 4XYEA 1NAIA 2GN8A 1Y9AA 4YEDA 3DQPA 4E2WA 5KTKA 1O94A 1QRRA 1EFKA 1Z82A 4W7HA 3GDGA 2HUNA 3GA0A 3T4EA 3FBTA 1CQJA 2YHUA 4R68A 4U8GA 5COQA 4WLUA 1I3KA 3INRA 4BNKA 3DZFA 1X1TA 2HK9A 3FTPA 2O3JA 4GL4A 4MKRA 3ROQA 4MVJM 5L45A 3AM5A 3PYXA 3DFZA 3E48A 2VZ8A 1HKUA 2IYPA 3LDHA 2F1KA 2P68A 3IP3A 4N54A 4W9NA 1ISIA 2VNAA 5T6BA 3X2EA 4AJ2A 3JYLA 1UDCA 2G76A 3WJAA 2P9EA 4CUJA 3ICCA 3WGQA 3GVCA 4R1NA 1P1HA 4DVJA 2OBNA 4HP8A 3AI2A 4YQYA 3GEGA 4IIVA 1VE9A 4LVCA 5DDIP 1R6DA 2ZYAA 4B8WA 5LC1A 3D5TA 3QLJA 2WD7B 2Y93A 1SMKA 4J4HA 1BRMA 3GFBA 2V6FA 2OMEA 5JXWA 3GF4A 4FC7A 4HNHA 5JMPA 5JLAA 2PNFA 4WCFC 3Q2KA 4DXHA 4J4TA 3UKOA 3WX0A 3R3SA 3KB6A 4KZPA 1I36A 7MDHA 5F1OA 2FMUA 3HFGA 1LNQA 1RM4A 5IXSA 1GV0A 3QSGA 4UEOA 1PZFA 5U9CA 3CMMA 1PIWA 4J0EA 3ST7A 5K6AC 1JWAB 3AUSA 1F12A 4RQUA 4CMGA 1IHYA 3CIFA 1BG6A 1VI2A 2JL1A 3NEPX 4J7XA 4O59O 4RF4A 4Y9DA 5AXDA 3SC6A 3BAZA 3ZWOA 1P3DA 2X1HA 3BTUA 2O3UA 4MKZA 4TMFA 1OMOA 4XA8A 5EESA 4XYBA 1MC4A 3C24A 3I23A 4R1UA 1VSUA 4BNTA 3GZNB 3SBOA 3LLSA 1PS0A 4QT0A 5F5LA 2E48A 1HF3A 2Z1MA 1UZLA 4RVSA 3ZWNA 2VT3A 4C4OA 4ZQBA 4EJMA 1LI4A 2O23A 4TKMA 4YA6A 3PWZA 3U49A 1DEHA 2DPGA 4F45A 4EBFA 4QQRA 4OYRA 2VRCA 3H9JA 4LRTB 4WECA 4D7AA 4YT8A 1NFRA 3RUEA 4II2A 1QLHA 1UP4A 4DUPA 3AWDA 5JPIA 1PS8A 4R9RA 2NV6A 1W0CA 3I9MA 3HJAA 2CSUA 3E82A 4YQZA 1RM5A 2C20A 2YJZA 3NTQA 2C2XA 4P4NA 3ONDA 3PWKA 5IZCC 1ISFA 2DLDA 2AEJA 2ZCVA 3GK3A 4XDZA 2NACA 1YO6A 1I33A 3QVWA 2Y67A 4R51A 1NYTA 1BTOA 2VQ3A 3TZHA 1U5AA 4MP6A 2IZZA 3U4IA 2WYUA 4GPD1 3AUTA 4KDFA 1LXCA 1YVEI 3G0OA 1W73A 2VCYA 1JKJA 4LVUA 2O7SA 4MVJH 1U5CA 1P0FA 2O3SA 4HFNA 3OJEA 3TOZA 3NKLA 4P38A 1LDYA 3IS3A 2AEFA 1LDGA 1M75A 3AOGA 3Q1LA 5HM8A 1GR0A 5BSGA 4RQTA 2Q2QA 4K26A 1A72A 4RPJA 4TQGA 4BGUA 3PFFA 3DZGA 1P45A 5G4KB 2FR8A 4IQ0A 3PHJA 2VZ0A 1P0CA 1U2DA 4Q3BA 1LSSA 1B15A 1QSGA 3VC7A 2JD2A 1WDMA 3D64A 1D7OA 4GX1A 1M66A 1OC2A 2J3JA 3PZBA 2EV9A 1TT5A 3MJCA 3UUWA 4FJ1A 2VUSA 1ULSA 1JVBA 4UEJA 4MVJA 5FFFA 2Y0CA 4FDAA 5CHEA 2X9GA 1HDRA 4B8ZA 1GY8A 1XEAA 1YQDA 2ZTLA 1JKFA 4G5HA 4L76A 4S1VA 3KXDA 3DMTC 1B8VA 2PKQP 3RUIA 3H4VA 1VC2A 4MO2A 2BMAA 1EBFA 2GERA 1VKNA 1E7QA 1JU9A 3ZWWA 5EQDA 3RUHA 4NIMA 2WD8A 3E03A 3WBBA 3MJEA 5EIOA 1PJCA 5CDSA 4J1QA 2BD0A 1PJ4A 3ZN2A 4R4JA 3TNLA 5JDCA 3JQGA 4HFMA 3LZ6A 3WGTA 3AUUA 2UVDA 3EMKA 4HFRA 5A06A 4FGSA 2NVBA 3QVOA 3KV3O 1KC3A 4CV2A 1PGNA 3U4CA 4FOSA 5F5NA 1Q0QA 2GN6A 3L6DA 3NX4A 1LC0A 2NVWA 3CEAA 3I52A 3SXPA 1YB5A 2B0JA 5KKCA 1H6DA 3O8QB 1C3VA 1VL6A 1XHLA 1HZJA 1PJ2A 3GR6A 4XR4A 4JX8A 3ZW8A 4BO9A 3DZHA 5L7WA 4PZCA 3B70A 4Z9YA 1AE1A 3KSUA 1EMDA 4OH1A 4CMIA 4QX6A 4YRDA 4TZKA 5A3VA 4MJLA 3RSHA 4JLWA 4YAIA 3OIGA 1JTVA 3D3WA 3DBLA 3H5NA 2Y05A 2YV2A 3PFWO 3OQ1A 4BO2A 4IGFA 3JQ9C 1DAPA 4RVUA 4INAA 1Z45A 2Y1DA 2NU8A 1A7KA 5AXCA 5IN4A 1EVIA 2FWMX 4B4WA 1ZBQA 2FHSA 3PTZA 3ZW9A 2V65A 2PK3A 3H3FA 4Q9NA 4AJOA 1MG5A 2PH3A 4PCVA 2BGLA 3DHYA 3HQ4O 1ZCJA 3KYDA 4K28A 1S7CA 3RWBA 4BKQA 1H9AA 4PLGA 4J16A 1I3NA 2X4GA 4XYLA 1UP6A 3WB9A 3MCVA 2JCVA 2AE2A 3WGYA 2EKQA 2Q3EA 5EN4A 2Q1SA 3ANLA 1UDAA 4FR5A 3I83A 1YL6A 4U5QA 1C1XA 3KRTA 2DUUA 2Q4EA 2DKNA 4I9NA 2BELA 4II3A 1BDBA 2O3TA 4RORA 3S55A 1MA0A 9LDBA 1KVUA 3KZVA 2ZYDA 2G82A 4PLTA 3ZGYA 2VYND 2YFQA 4YRBA 2ZB7A 9LDTA 4TKLA 3NTRA 4L9RA 4A0SA 5GMOA 1X15A 2Y99A 4PLCA 5THKA 2P5YA 3A06A 5DBGA 3H2ZA 4UEKA 3SVTA 4JJIA 4B79A 4BMNA 3ZU4A 4BS9A 1JWBB 1J49A 4CMAA 3QRWA 1J4AA 2HLPA 4WNCA 2DVMA 1NPDA 3MWEB 3W8FA 3LC7O 4YJHA 3RI3A 3F47A 2DU8A 1ZZEA 2PY6A 2BGKA 3VPGA 2VRCD 3ITDA 1K6JA 3WICA 1O95A 1P1RA 2O3QA 1DIBA 2FSSA 1I3LA 3JYNA 5TF4A 1OBFO 4B4OA 4HV4A 4E3ZA 2NM0A 1E3LA 5TC4A 1CDOA 2C0CA 3ABIA 1N9GA 2ZIZA 1DLIA 1B16A 3FD8A 3KEOA 5IDXA 1VJ0A 1GYPA 2EKPA 4XKJA 3DHNA 2B5WA 1D1TA 1GFSA 2I6TA 1I5RA 4BKOA 3G79A 3F5QA 3BZUA 4Q39A 3EUWA 2HMTA 3B1FA 3KSZO 4J0FA 1DHTA 4E0BA 3ROKA 3GRKA 1ADGA 3H7AA 3BMQA 1P74A 3HE3A 4I5DA 4WEQA 4A5OA 2D5AA 5DNAA 4IJUA 2EKLA 3JD4A 4Z9FA 3WR5A 1VSVA 3GZ4A 5FI5A 4R01A 4JCOA 5TJ9A 3LSYA 1G1AA 2VWHA 4J1TA 2X0IA 5B4VA 1QXSA 3I9NA 3LLVA 4CR7A 4CLXA 2YV1A 3L6OO 4CODB 1WDKA 3GGOA 2DBRA 1R4NB 4TRJA 4JP3A 3JQFA 2Y1OA 3U62A 1GD1O 4EGFA 4DTIA 1M67A 1RYEA 2YFHA 4JJFA 3CE6A 4XYGA 4R69A 4L4XA 2FN7A 3A14A 3NT2A 4EI2A 2XAAA 3PVZA 4XQGA 2QIOA 4L4RA 5COBA 4YWJA 4UAGA 1SB8A 4BB5A 3SJ7A 4K1LA 2OUIA 4YPOA 4WGGA 2NNLD 4NQZA 3F3SA 5L4NA 1EVJA 5CPFA 2OHXA 3EC7A 4ZQFA 1KVTA 3SLGA 1YDEA 4XQCA 3LT4A 3N58A 4BNIA 5DOVA 4FOOA 3PQDA 4AG3A 4E12A 4L8VA 3EW7A 4IMPA 5L40A 4AJNA 4IS3A 4WJZA 2ZATA 3NDRA 4MIYA 1Q0HA 2C07A 2ZTVA 2GRAA 4YJGA 2Z5LA 3UF0A 4JGBA 1PWZA 2GLXA 1HWYA 3OA2A 1H2BA 5AXBA 5JY1A 1TT5B 1V9LA 2H1SA 1XIVA 4YT2A 2VUTA 3P2YA 1RWBA 3QWHA 3WQQA 4XRGA 3TPCA 4KTVE 2LDXA 3Q3CA 4H3VA 1NFFA 1BW9A 4L74A 1UXIA 1GEEA 1KOLA 5AOVA 1A27A 4E33A 2IEDA 1LC3A 2OBYA 4CR8A 2HMVA 3IDSA 1NXQA 3QJ5A 3TOXA 3AW9A 1YBVA 3JQ7A 1Z6ZA 1VRWA 1YXMA 3O03A 4MIOA 1LRJA 2HK7A 4NBRA 4CM8A 3NTOA 1QYVA 3PZRA 1NFQA 2CF6A 1SPXA 3RU9A 3LT1A 1E6UA 4GLOA 4CL8A 1UAYA 3B20A 2DAPA 1R12A 1U2GA 2AG5A 2Y1FA 4GLLA 1HDOA 3VH3A 2Q4BA 3UCFA 2RIRA 3EY4A 4JBHA 2OGUA 1HYGA 3IQDB 1F8GA 1H6BA 3ZV6A 3OH8A 4GMFA 4JIGA 2WEKA 1G0NA 2AA3A 1N8KA 3RU7A 2C29D 2Y0EA 2QQ5A 4FFPA 4DQXA 5T67A 2XPCA 2ZYGA 1E7YA 2QRKA 3VH1A 4Z6KA 1H0KA 1E6EA 1B7GO 4OGWA 3TL2A 3A1NA 1I2ZA 1YRLA 4CPDA 4CMIB 4JK3A 4NBWA 3DHEA 1FJHA 1KYQA 4KTTE 4MIEA 1EBUA 4R3WA 1EDZA 5DOZA 1XA0A 1OAAA 3AY7A 3CMCO 1GYRA 1G0OA 4M55A 1LJ8A 2EWMA 3OEYA 5IG2A 4UUNA 1SB9A 2X6TA 2PGLA 4GMGA 3V1YA 4IY1A 2HMWA 1N7GA 2HJSA 2NTNA 3OF2A 3WIEA 1ZMTA 1ZXBA 1BHSA 1K5HA 3ZWVA 1XGKA 4M1QA 2PV7A 2W8ZA 4WPGA 3RKUA 1ENOA 5LCXA 3ANNA 2WM3A 3RQSA 3UXYA 4CLRA 3AM4A 2BI8A 4QEDA 3CZRA 4FD3A 3D5QA 3MEQA 2VHYA 3ZU2A 5L9AA 2R00C 2HRZA 3KYDB 4LISA 1L7EA 2VRBA 3LQFA 1T1RA 3EAGA 2ZQYA 3O4RA 3FRJA 3M2TA 4Y6RA 1KY5A 2X8LA 5T57A 3M1AA 1HEUA 3IP1A 4IINA 5T8KA 5KWEA 3O38A 1GEGA 3KETA 2YUTA 2FPIA 1FMCA 4DWVA 1JW9B 2IRWA 4GH5A 4HX5A 3OETA 4O1MA 1C1XB 2NU6A 3RUCA 3ETEA 2EGGA 4ALJA 5ILOA 4HWKA 4FFLA 3ENKA 4WLEA 5BSEA 2UDPA 1ULUA 3JQEA 5A03A 3O26A 1KVRA 1PZEA 1W8DA 3L9XA 4LGVA 3ADOA 3JQ6A 3RFXA 4CMEC 1GUFA 2FSVA 2JFHA 4YJHB 5TIIA 3L4BC 2EERA 1LSUA 2EW8A 4WASA 1GQ2A 5JMWA 1Q1NA 5I7EA 4EUHA 4EITA 3EZYA 2A92A 4JJGA 2Q46A 5L51A 1GCUA 3GGGA 3GUYA 5A02A 4XYMA 5JC8A 5LDGA 2YZ7A 2EIHA 3GN1A 1NPTO 4LCJA 3S2IA 4BB6A 1VJ1A 3W4IA 1XQ6A 1GAEO 1IL0A 4B7CA 5L4LA 4B3HA 2HMSA 2X5KO 4BNNA 3RUFA 3TFQA 2EHDA 1U9JA 1CEQA 1NTOA 1CWUA 3R0IA 3WLFA 1DIHA 3HNPA 4CMCA 3BYZA 3KTDA 3OQ6A 4UVHA 4N7RA 1R0SA 3RD5A 1LEHA 1EVYA 1FDWA 1FDSA 3BMQB 3K9QO 3BMNA 4DC0A 3F9IA 4R3NA 4IGEA 4L75A 1ADCA 3JTMA 4ZQGA 4OKNA 1E6WA 4CQMD 1LDMA 1ONNA 1HE4A 2P91A 3ONFA 4IXWA 2VTDA 4PIVA 4Z9XA 1TT7A 4IDDA 3RUDA 4CUKA 1U4OA 1EQUA 2C5AA 5I8WA 4CM5A 3PWSA 4FQ8A 5DCWA 5DP1A 5ITVA 4S3MA 4HUJA 1T2FA 4M54A 3WTBA 1S6YA 1PL6A 1HE3A 2GUGA 1NX6A 3UW3A 3IUPA 1GUZA 4G81A 3GNSA 4YYZA 4Y8VA 4NFHA 3BTVA 2PZLA 4Q3EA 1C0LA 4BO1A 2DC1A 5JS6A 1W6UA 3UFXA 4BO6A 2XF8A 3QVXA 2VWGA 1KEUA 4I5FA 5DT9A 1E77A 4IIUA 4IDCA 4ALLA 4CQMB 2X23A 2CNBA 3H5AA 3PJGA 3GLQA 3H9QA 4CMBA 5H82A 3H65A 4QECA 1SAYA 4IJKA 3S2GA 3UOGA 2OORA 4PFJA 3AU8A 1LSJA 1LUAA 4R5HA 3IIEA 3ZNPA 4EEXA 1E1NA 4YJGB 2Q1TA 3VPXA 1GV1A 5TRTA 3HDHA 3CPSA 3OECA 6LDHA 1SZJG 3R6DA 4J1SA 5F1KA 1UJMA 4B3JA 2QW8A 2FPGA 1M6HA 1XR3A 1GQYA 3OP4A 4YAGA 5BNIA 3EZLA 4GWKA 2GASA 2EXXA 4IDBA 4EW6A 2NADA 1IHXA 1PWXA 2IXAA 2JKVA 2PH5A 2QHXA 1JQBA 3DEYX 3EVNA 1MFZA 4UUPA 7ADHA 5JC1A 4B3IA 3QIVA 1YBAA 4D3FA 3FCOA 4JQCA 1LLCA 4O5OA 2W2LD 4WCFA 5KCZA 4R41A 3MJ4A 4I1IA 2CDAA 3UVEA 1WMBA 1BXGB 1V35A 4H15A 5JAQA 4CM9A 5A1TA 3QV1A 3VZRA 4W9NC 1EUDA 3EDMA 1ADBA 1HLDA 1U7TA 4DLAA 1UZMA 1WVGA 1Y8RA 3FTNA 1A9YA 4NU6A 4FSHA 1UUFA 3UH1A 3GMDA 3FPLA 1PJSA 1I0ZA 3NJ8A 3NDIA 4RL6A 4HKTA 4NMHA 2FOIA 4BO7A 2QG4A 2G5CA 2Q45A 2DUWA 1IOLA 2BRUA 1E7WA 3TFOA 3PPIA 2Q2VA 1ZSNA 4M49A 4M87A 3GVPA 4NG5A 4QFCA 4RF3A 2O48X 1E7SA 1T2EA 1U1IA 1YDWA 3K30A 3VH4A 1ZUD1 3U0BA 4YDRA 5L95A 5KNLA 5A05A 1U3UA 1ENYA 4KMSA 3HUDA 4NBUA 5BSHA 1Y8QA 3NUGA 4PG8A 1BGVA 4OM8A 2W2KA 1DFIA 3U4HA 4ALKA 3E5MA 1ONPA 1F17A 3GH3A 3BIOA 4WNIA 1YL5A 4IMRA 4PG4A 3AFNA 5U1PA 5GY7A 4J9VA 1P33A 3G49A 2QYTA 4BGEA 1KBZA 2OXIA 4Q3CA 5FI3A 4DMMA 1AXGA 3IC5A 3BMOA 5I9NA 3RFTA 3PEFA 1VL0A 2NQTA 3JQDA 5GZ1A 2QZ9A 3PHLA 1PQPA 3OJFA 4R1SA 4B4VA 3ZU5A 1I2CA 4K6CA 3GC6A 1N1GA 3DB2A 2IZ1A 4QSMA 4CLRB 3OEWA 5EINA 1UH5A 4BIIA 4ROSA 2C5EA 3GUCA 1O9BA 1HL3A 3TWOA 5IZCA 4NHEA 4EEZA 3N7UA 5EJ2A 1OZAA 1I30A 3VZPA 1NVTA 5EERA 1LLDA 2VWQA 3DFUA 1F0YA 4LRSB 1I2BA 3DZBA 2PD4A 3ZV4A 2ZB4A 4PVCA 4RZIA 5EL0A 4NZ9A 3BA1A 5L4SA 3OMLA 2WE7A 5BT9A 3PHIA 1AGNA 2BFPA 2X0RA 1LRLA 1QMGA 3SC4A 2IYOA 1NQAO 1DLJA 1IB6A 2VWPA 4GX5A 1QYDA 1H94A 2BH9A 5KJ6A 1XG5A 2A9FA 3WFJA 3T7EA 1V6AA 3OJLA 1MX3A 4IDEA 2JAPA 4OO3A 1JA9A 1C14A 5DULA 5B37A 3RVDA 1G6KA 4Y67A 5JCXA 1YE3A 2DBVO 3BHMA 3INTA 3RJ5A 1HDXA 1K0UA 2X5OA 2ZJ1A 2FZEA 3ROMA 4BO8A 5TS3A 1DC6A 1HXHA 4HXYA 4CLOA 2OP1A 2B4RO 3NJ4A 4ZVVA 4CLEA 1DDOA 1B8PA 1KIFA 1RYDA 4OAQA 3MJSA 5A5EA 5KJEA 3DAPA 3HB4X 3DMTA 4WOKA 1GCOA 2PGDA 5L53A 4OXYA 1H9BA 2GPTA 3C7CB 5CP8A 4BQRA 3JCZA 1DIRA 3H9EO 1EQ2A 2Q50A 3BMNB 1T2DA 2O7QA 3N74A 1GADO 2H9IA 1VJTA 3OQBA 5KVVA 3VZSA 1PJLA 4RPLA 2DFDA 1DBVO 2IEBA 1KERA 3D1LA 4RVFA 3DZKA 4PRKA 1UXKA 3W6ZA 4CM3A 1QG6A 4PLZA 2C82A 1KS9A 1KEVA 3S8MA 4BNGA 5G0SA 5ENVA 1O0SA 3PP8A 1NVMB 1VKOA 1ZIDA 2EGHA 3MZ0A 3QA9A 3QQPA 1LQTA 4WLVA 4PG7A 3JQCA 1J5PA 1XDWA 1NHGA 3E5RA 1MFPA 1F14A 4BNLA 4CQLA 4YJFA 3E9MA 3WYEA 4FS3A 1WXDA 4WLFA 3B1JA 3STHA 3I6QA 1GL3A 3IOYA 4LCEA 3ASVA 4WK6A 3MJTA 3VDQA 3WMWA 3BTSA 5ENDA 3L9WA 1A7AA 3RC7A 2WWRA 1T2CA 1WMAA 3VVBA 1PR3A 3IKTA 4PVDA 3VVCA 1I24A 4BNUA 3ASUA 4DQVA 4PLPA 3HSKA 1C1DA 4JNKA 5AQ1A 4MOWA 5A3JA 1WZEA 3KYBA 2D59A 3H8VA 1HDZA 1ZEMA 2PWZA 1PJTA 1PEDA 3I4FA 3LYLA 2ILTA 3AUAA 3PIDA 1GZ6A 1X14A 2D3TA 1NVGA 1PGJA 1R0KA 2AQIA 1LRKA 1EUZA 4F3YA 4MPDA 1LA2A 2QRJA 3HHPA 1ZSYA 3ZCXA 2O2YA 4Z3KA 2J3HA 3ITKA 1YB1A 1PU2A 1GTMA 2D2IA 2I66A 1PJBA 1DC5A 3S2FA 3WG9A 5MGBA 2DT5A 2CVZA 3ICPA 3U9LA 2BF7A 1YB4A 1UXJA 3LK7A 1C0PA 1JAYA 1EE9A 4LMRA 4MKXA 4AVYA 3C7DB 2TMGA 3LVFO 1H6CA 5JSFA 4J2OA 1VLLA 1Y8RB 2UUPA 4EUFA 1WPQA 1UZNA 4PLVA 4JXKA 3UICA 5AYVA 3QWFA 3GHHA 2HCTA 2H6EA 4OHUA 3KOUA 5IJZA 3Q9NA 4QUKA 5ES3A 3SLKA 4QO7A 3QVSA 1YGYA 3WQSB 2A94A 5JDIA 1GDHA 4IZIA 2AQHA 1LX6A 1K3TA 1PQWA 5JY6A 3LC2O 4DC1A 1SO8A 3ZNOA 4A03A 2D5CA 1GYQA 1O6ZA 1J0XO 1HZZA 3LT2A 1R16A 3GN2A 1JN0A 3ONEA 4D0SA 4XJSA 1Y8QB 5G4LA 2W2KB 3CSDA 3KVOA 2PLAA 2V6GA 2J3KA 5COAA 3ZHXA 1IZ0A 4CM4A 1E3JA 4AJHA 3HB5X 5CAEA 2QRLA 4U6QA 4MVJP 4UUMA 3PLRA 3BMOB 3I1JA 1X7DA 1ZKMA 3WLEA 3KO8A 3AM3A 2ZJ0A 3OICA 4JN6B 4PLFA 4TVOA 2I9PA 3EK2A 1E92A 2BHLA 1MP0A 3C85A 5B1YA 3RKRA 3GDFA 1CERA 4J91A 2NUAA 4KUHA 2NVUA 4UVEA 1LDNA 4RV9A 1QLJA 5DP2A 1YOVA 4NH4A 1R37A 5K9ZA 1JVSA 3UGKA 2NU7A 5IXYA 1BWSA 2D4AA 3WSWA 4CR6A 3H9GA 1V3TA 2DQ4A 3GHYA 5DCYA 1NR1A 1SOWA 1TVEA 4FJ2A 3RC9A 3P7MA 5KIAA 1PX0A 3BTOA 1DC3A 4AICA 1LDBA 4M86A 4FPXA 3GNQA 4RPKA 1LU9A 5C37A 4OIMA 2PR2A 1UDBA 2AG8A 4YBZA 3T4XA 4AJKA 2NQ8A 4GX0A 1RM3A 4NJMA 4FJ0A 4UULA 3CXRA 4HY3A 4MVJD 4YRAA 3BHIA 4JROA 5BNFA 4PG5A 5I8ZA 4Y6SA 4PZEA 1PTJA 2VHVA 1ENPA 3GOHA 3K31A 2VHWA 4D79A 4YT4A 2E82A 3CUKA 4ZRMA 3JQFC 3FHLA 3MJVA 4BNHA 3ZWCA 1DRUA 4AFNA 2BI7A 1ZMOA 5LDHA 3I9OA 5C7OO 2WYVA 2I65A 3O9ZA 3DO5A 3OSUA 5EMHA 1Y6JA 3W8DA 3UHAA 4FFNA 2FPPA 3H6KA 5H83A 2E6UX 4AJLA 4RF5A 3FWNA 5CPBA 1P77A 4OXNA 4BNJA 4F6CA 1HDCA 1IZ9A 4CM1A 2HU2A 2OL4A 2UV8A 1D1SA 1U3VA 2GZ1A 3GPIA 2B5VA 2Q1WA 4I9UA 2ZB3A 4C7JA 4E30A 3WBFA 1BDMA 1OC4A 4F6LA 2CFCA 4IUYA 1L7DA 2HDHA 2AEMA 4UVGA 3DBRA 4ZICA 1DAOA 2CDBA 4RVHA 4E21A 3BMCA 3DMYA 4NK4A 1V8BA 3RFVA 4IDFA 5DBIA 3PJDA 4KUGA 4U6SA 1I32A 1N92A 3JQGB 4LSMA 4IPTA 1DRWA 4IS2A 3WGHA 5A9SA 3AJRA 1FDVA 3VHRA 6ADHA 4W82A 1RM0A 3KYCA 2DTEA 2PGJA 4BGVA 5KOIA 2X22A 4XWYA 3PK0A 2WD7A 3P5SA 5G2OA 4PGFA 4ND4A 4AJ1A 5ICMA 3H5RA 4FFMA 1ZW1A 2I5PO 1ADFA 2P9GA 4M89A 1CYDA 4CQLB 4XEHA 4YJFB 3A9WA 1O8CA 3QHAA 4OOFA 1QYCA 4QO8A 4XGNA 2UAGA 1A9ZA 4BNYA 1XELA 3KM0A 4I8XA 2PZJA 3RBVA 3DBLB 3D3WB 3DTTA 3DR3A 4CV0A 2YY7A 1FDUA 3ZNQA 3GNTA 4XCVA 1K6XA 4I9HA 4HFJA 1MB4A 2P5UA 4Z0TA 1MV8A 2IODA 2DFVA 4BO0A 4OQYA 5CG1A 4BMVA 3CH6A 5L7YA 4CMJA 1C1DB 5HWSA 1QP8A 2EJWA 4P22A 1ZJZA 3E9NA 3HN2A 3R1IA 3PGXA 1C0IA 2VOEA 4DBZA 5ER6A 4A73A 2Q2WA 2BGMA 1ISJA 2AMFA 2BKAA 2BLLA 1OOEA 4P8RA 4DYDA 3GG2A 1LLUA 3OHSX 1SC6A 4GBJA 3EVTA 4XIJA 1E7MA 2R2GA 3U09A 1NHWA 3D7LA 1GU7A 4WEOA 3TZQA 3W1VA 1B2LA 3Q2IA 3AU9A 4P4GA 2SCUA 5TT1A 4IQ8A 4PRLA 1WDLA 4CMHA 4F46A 3AOEC 4RLHA 5U4QA 1E1LA 4ZHSA 3S2EA 1TA4A 1TB4A 3PHHA 4KQXA 3KLPX 3JQ8A 3LF1A 1DRVA 2ZK7A 3RC1A 5DBFA 3PRJA 3Q11A 3F46A 2O4UX 2X9NA 3P2OA 2EJVA 4BHTA 5B12A 2DTXA 3JYQA 4CMEA 2ZCUA 3WJ7A 2D1YA 3L4BA 1Q7GA 2B4QA 2VTEA 1F06A 3I9JA 1CIVA 4R16A 3JYPA 4Q3AA 5IDQA 1XKQA 1P44A 1U8FO 1PGPA 3FNFA 1M76A 4FFOA 4FIZA 4UUOA 4J1NA 4EJ6A 4IDGA 1A71A 4D43A 5C7IO 4Z0HO 3BXXA 4E31A 1HSZA 1ZK4A 3JQBC 4ZN6A 3PXXA 4LMPA 1VL8A 2CDCA 2RHRA 3KSDO 1YONA 3D0OA 1H2HA 1P1IA 3LC1O 1ZK1A 3MWDB 5HS4A 1N9GB 1Q7BA 1T4DA 1NR7A 2YQ4A 1ISMA 2X0JA 2DPHA 4DIOA 4K6FA 3WGZA 4CM4B 3HWRA 4CM7A 1JLLA 4E4YA 4RCVA 3TJRA 1IUKA 2P4QA 3VZQA 3ZHZA 1NM5A 3IAHA 1GZ4A 3RIHA 1DOHA 1EUCA 3K5PA 4PN3A 1MG0A 5JAMA 5HBRA 2EP5A 2XOXA 1D8AA 2O2SA 4FW8A 3ZHYA 2HQ1A 1IPFA 4WUVA 1Q2XA 4BO4A 1K2WA 1X0VA 1ZFNA 3EHEA 4MVJE 5IN5A 2JAHA 2O4CA
chains in the Genus database with same CATH superfamily
4JQSA 1Z7YA 3D8TA 4BNWA 1VP3A 2AZTA 1B0ZA 2JGRA 3GQVA 1ADJA 1VIDA 2I7TA 3H17A 4I5GA 3RBXA 3G2NA 4QM6A 5LZ9A 2Q21A 2CDRA 1MOSA 1CX9B 3RS5A 3W34A 2C3OA 3N28A 1C4KA 1HYBA 4RXMA 3ZNNA 5IT0A 4DV6B 3IJRA 3MA0A 5CBKA 4R7GA 3AVYA 2N0SA 1DX9A 1SCAA 3S7ZA 2Z2XA 1NY5A 1BS1A 4LJRA 3H99A 1EEHA 1GOTA 1NXXA 5IKOA 1JEQB 4WE3A 5K4HA 3G1TA 3Q1KA 2OGTA 4KSYA 3RBZA 2CNNA 2IK8A 3DWFA 1SOVA 3GLTA 3GJQA 2BCJQ 3GEHA 2GSDA 5J23A 1N6NA 1J21A 1G3UA 1O96A 3PNLA 4G2TA 3LMKA 4KYVA 3RIMA 1E2GA 5EUCA 2FH5B 2YY5A 3T7DA 2A30A 4NJMB 3RABA 2CBXA 3NEJA 2XYVA 3SBEA 5DM4A 3HA2A 4MJXA 2IV3A 1FW8A 1W581 3B51X 4JH0A 1KVSA 2FNAA 2O7VA 3VAAA 1WZIA 5AI0A 3AI7A 4G8DA 2Y1KA 2ZU0C 3K2EA 4CF6A 1ZKDA 1M3SA 3A1UA 1JL3A 4FFRA 4B3GA 1PDOA 2FSIA 1ULBA 2JB9A 2B82A 2HTFA 3KLBA 3LY7A 3QWAA 1IAQA 2Y2UA 4MQ5A 5GPBA 3UAGA 3WYFA 1KA9H 3T7JA 5JSKA 4EFMA 4ZRDA 1A3CA 1KDOA 4PZ9A 4AJPA 5KNDH 4CL3A 2PXHA 2VPYA 3R7FA 1RKVA 4Y2HA 1WO8A 3U40A 2JJYA 3VR2A 2C7PA 4J0IA 4RSMA 5E1DA 3L4SO 1TXGA 2YV5A 1B1CA 1FP1D 3G9UA 1NP6A 2V7BA 2W71A 3JVIA 3VXKA 4D97A 1NBIA 5LNK6 2Z2KA 2GXUA 2ZR8A 1SBYA 3D0KA 3H04A 4NMMA 4P0PB 1YIOA 1CLUA 1Y5RA 3CRVA 3TW4A 4ZMRA 3UYLA 1OV4A 3BFJA 4KN8A 4D9IA 4O33A 2C3MA 2IXGA 1HOTA 2QAGC 3DBRB 3IOMA 1IXRC 3EXHB 4CV3A 1NRWA 4O0LA 5GGXA 2VTVA 1QB8A 5EHNA 3VOSA 1GUYA 2IXDA 5B3JC 2P79A 4N5NA 5JYCA 1L7AA 2C3YA 2XYPA 1MAHA 3FCEA 1I10A 1QRUA 4FMCF 2QX6A 4AXBA 4NICA 1UBHS 2V1UA 1YE8A 3EGDA 4CMKA 5GINE 2O8FB 3FMIA 1Q0RA 2HPHA 4GD3Q 5F21A 1AQLA 1H93A 2PYDA 4PZLA 2MCFA 5AHKA 4OJYA 1UPTA 4DLLA 4YCMA 1LSOA 1PZHA 1U3CA 3AF2A 3MAJA 5JS8A 2HT6A 4U9UA 5TJHA 4RGVA 3RVLA 5FHRA 3PSAA 2ZWAA 4F5DA 1USIA 5DW0A 2J0EA 2X19A 2ZSBA 3FB4A 3HXLA 3I05A 4MPRA 2PYIA 2IX3A 5JNRA 4Y3UA 1N32B 2VNSA 5IAAA 1NQTA 5K5EA 3NYQA 2Y1GA 1YB7A 1L7NA 2GN0A 3O4FA 5T4FA 2ZM5A 3P19A 4YPFA 2I54A 5JXIA 3VKVA 3NDJA 1X7WB 1OFTA 3QUAA 4NABA 4MV6A 3ZGNA 1U5BA 4HWOA 2QLLA 1P0IA 5D85A 2R7LA 1VIVA 1CP3A 4HBGA 4JWTA 4O4JB 4KMMA 5CT6A 1CY2A 4OL9A 4UU7A 4EO9A 1RPZA 3QY9A 4MP3A 1ZESA 1HE2A 1B42A 1YRHA 2WIBA 2WMYA 2FZWA 1DT5A 2H1CA 2ZRBA 3H0EA 3MT9A 4DCCA 1SG9A 4EZBA 2W22A 1CK4A 4FHEA 1I3MA 4OQFA 1GSOA 1PGOA 3O0TA 5CXXA 1SC1A 2Z2JA 4BP3A 4DEXA 1EFPA 3HZRA 4BEVA 3QU9A 3KAJA 4RKFA 4JI0B 3ZQKA 1UF9A 4DNPA 4TXMA 2TYSB 4GKBA 2VYNA 1Z12A 3N6XA 3N5CA 4LV6A 4NNJA 2J5RA 1B3BA 5BMVF 5A9RA 1FFHA 1BN7A 2PZMA 4H7PA 4XUEA 4IIXA 3A4IA 5CNMA 1KJ8A 1ISSA 1NYRA 1AS3A 2P6NA 4AF7A 1CF4A 1ABEA 1IMOA 4B48A 3WIDA 2NMVA 1MMFB 1PGQA 3QJYA 1JG1A 1TM1E 2Q2NA 2VXBA 4MIKA 4BZXA 5K8JB 1NUSA 5JVDA 1VPEA 2HJRA 3KOZA 4ZO9A 5ANRB 3HBAA 1QONA 2RCYA 1HQCA 3A2MA 2OAGA 1YR2A 1EEXB 1ZW6A 5IF3A 4OXQA 1R4MA 4W99A 3G3EA 4H16A 3EEQA 4ZO4A 4EHKA 1X19A 4XQ9A 5I9LA 4K81B 2JIPA 1CCWA 2VHXA 2QK4A 2QY9A 1IN6A 3TZKA 2IXBA 3L5OA 2AVNA 5KCMA 3VO2A 3TLGB 4QWMA 1D07A 2PDAA 3AVPA 5KKAA 2CZGA 5C3MA 3AFMA 3JXEA 1J6UA 2QYSA 1ODTC 2GPJA 1V1RA 4U7TB 4A10A 4J2HA 1UFKA 3EBOA 4D74A 3QXGA 1JHZA 4G85A 4DSOA 1DEOA 3KEGA 4C88A 1J2YA 3C7TA 2DH6A 2NN3C 4TMWA 5TMPA 1JHYA 2A9QA 2Z83A 2CXSA 3E1KA 3QVKA 3QX9A 4PZUA 5AXAA 5GZ3A 3PPXA 3HXOA 2IHNA 4YCAA 2YN2A 3I04M 4RJKA 2RK3A 2XUQA 4M9ZA 3LFTA 3KQHA 2YQ5A 1IHOA 1TPZA 2R6R1 3WL4A 1SCNE 1UZAA 1ZOOA 1GPDG 1GQQA 3A10A 3C5HA 3A1FA 4KVAA 5ALZA 3NGXA 3SM3A 2H0AA 3TJZA 4DA8A 2IW1A 3ENWA 4PONA 3UJ3X 1SU4A 4EB6A 1G8GA 1I4EB 2Q5LA 1KZ6A 1Z7GA 4EPTA 4RO0A 4KXLA 1ZVJA 3OPMA 3FKSD 4L2IA 4AAYA 1QDUA 1T34A 3C16C 3QKWA 4YAEA 4BWGA 4KQCA 3DL0A 4QFDA 4U9IS 2YMPA 1R0BA 2A58A 2ANBA 4I1YA 4R8RA 2I7DA 5DZSA 1RAHA 1CUDA 2FWNA 4AXXA 3CNLA 5FF9A 1PG0A 4PO8A 2RGGA 1MH1A 2G0NA 3JAWB 2I2CA 2D8MA 3WNZA 1JLLB 1MLDA 4C2TA 1HT0A 4CEHA 1KI8A 3WB1A 4CIBA 1JXQA 1P1FA 2WJPA 1X7YA 1U2DC 4PRZA 5GOTA 5TNXA 2QX7A 3TVTA 1U1CA 1CQIA 3PL5A 3CF4G 2QMUA 3L0ZA 4HR7A 5KDLA 3EDQA 1QK5A 3ETJA 4EYGA 1PWHA 3LP5A 3FWZA 1AKWA 3WWYA 1YH3A 4BDTA 3AL0C 3L7DA 3RNOA 3TSCA 1GG5A 3I0ZA 4JDUA 2OAEA 5ALLA 1MJGA 5A62A 3CLRC 5KJCA 4UHBA 2OFPA 2P0EA 5SYMA 2HO5A 2QGNA 3GRCA 3M6AA 4J7UA 4PPYA 5AVSA 3GVIA 1Q12A 3ACCA 1D4FA 4PC7A 3RM3A 2FZ4A 1ZJWA 4GXRA 3KBOA 1QQTA 2XXJA 1VZ2A 4EJSB 2CBZA 2RAUA 4UFOA 5FBQB 4RZ3A 4A8JA 4E6PA 1SWWA 5C1OA 3WBKA 2ORIA 3NH6A 5EJEA 1CDDA 1N1EA 1NN1A 2C2GA 4RK1A 4TV8A 2HFJA 1G4UR 2XE8A 5KNCH 4MGHA 3D31A 2C7GA 3TN7A 3QXHA 1VL5A 1NT2A 4GEKA 1OXMA 4LGCA 4M99A 4OGLA 4XDYA 2E4ZA 1IC6A 3HN6A 3RTEA 2V03A 1QORA 4KN6A 4RULA 2GZMA 1A82A 2I6UA 2G9RA 4IJQA 4KQ6A 2C2HA 1A9QA 5LXTA 3ZHBA 3IOEA 3DONA 1E3SA 4KGXA 2WU0A 4G24A 2Y68A 1T5OA 5FNZA 1VE3A 2ESRA 1Y7PA 2O7NA 5CFLA 1GU0A 1PS9A 3CVXA 2CFOA 4TSKA 3V1TC 4B83A 3ADDA 2V6BA 3TEFA 4NE2A 3SZ3A 4DMLA 3BEDA 3ZWXA 4YXFA 5CG2A 4EG5A 5JYDA 1GM5A 5GWXA 2GCOB 1XQYA 2RI6A 2UKDA 2GEFA 2ZBPA 3E84A 2P4HX 3J81k 4WNYA 1CZRA 3DFFA 3KQQA 1G8FA 4OX9B 3QH4A 1A95A 2RH8A 3WFIA 4LX0A 1NL3A 2A4KA 2VJKA 4DDKA 4DLBA 1XVVA 2GN4A 4V2IA 3GUUA 5IM4F 1EFVB 3WLOA 2VJMB 1C50A 1BOOA 3VPSA 1ZGZA 1P31A 3KJHA 2IS4A 1J23A 4B0PA 1VLQA 3WHPA 5IJAA 3O94A 2ZFUA 1AK1A 4FC6A 4M7WA 2FK7A 1IRIA 1GGHA 1KJIA 1Y1PA 2P9YA 3C1UA 1JILA 1MD9A 3DTVD 3JD0A 1HLPA 4HYQA 2FN8A 4MYTA 2H7YA 2WIAA 5G1OA 4RK6A 4AJEA 2DM6A 4IDQA 5A4KA 2B4TO 2TMDA 1UPXA 2ZAYA 4I4LA 1XPJA 4QATA 3MUNA 5A5FA 4KXUA 4DV0B 3TL3A 4G5OA 3O3OB 2KSQA 4FGWA 4ESOA 3N0TA 2IYQA 3C6MA 3EARA 3HDQA 1RAAA 1EFLA 3MWGA 4FYPA 3QW2A 4LJYA 2XRMA 1BYUA 4P4SB 2CFTA 1KFKB 1NE7A 2ICAA 2ZYHA 5E0KB 3HB7A 5BR1A 1RAIA 3VO9A 2V7PA 1BMDA 3N2GA 2GBFA 5CXSA 2WD9A 2R1VB 3AR9A 4QQ8A 1V1MA 4OREX 4JL6A 2JGLA 3GY0A 1BOFA 1CRWG 2Z3VA 2GHTA 3GT0A 5L3ZA 4MRMB 1UFOA 4BNXA 3BWEA 3M5WA 4RU1A 2FR1A 4E2XA 1P9LA 2HHJA 1Z9BA 5IAOA 4NZPA 3H97A 3CKYA 2POQX 3DTVB 2Q0SA 2RDMA 3GRPA 3IBCA 3R8FA 2D1FA 3FWKA 3D8RA 4C3ZA 2IHKA 1AX9A 2HDNB 2WA2A 3ZD8A 1VJCA 5CA0B 2B36A 3GFTA 4ARZA 4YAUA 3EEIA 4MQMA 4POAA 4EI8A 2GD1O 2ZB8A 3OIDA 2IF0A 2VQ6A 1B3RA 1Q7CA 2O0HA 4OLHA 2FCAA 2XB6A 3NMUF 3CR3C 3U3JA 3VOAA 5JXGA 3ZJVA 2C4KA 4XGQA 3BH7A 1ZJYA 2P78A 3RFUA 3RUAA 4AP6A 1KDPA 2AHRA 3Q5GA 1J24A 1YJ8A 1IJEA 1AS0A 5IMBA 4AC9A 1I6LA 1T24A 1CPYA 1HT1E 3MOGA 3MYRA 4D2IA 3QJGA 1S1CA 1Z4LA 4O6VA 2N75A 3COVA 3V3TA 4BGIA 1T1GA 4AROA 1WNTA 2GGSA 3AETB 5IWCA 4BVBA 2RBEA 2G80A 1C3OA 2B7CA 3IMFA 4UMEA 5FO0A 4J90A 4E5SA 4XLZA 3AI3A 1GG8A 4L4UA 5CB6A 3LVRE 4NECA 1IE3A 3LW7A 2QRQA 4RPGA 2OILA 3BD6A 4RPHA 5B4TA 1O97D 1NNUA 2NSLA 2Z2IA 3Q7TA 2YOGA 3WLRA 3AXTA 3K53A 1NF2A 5A9TA 2COKA 3CCCA 1F0KA 3ETDA 4AKHA 1H5NA 3N2KB 2VJBA 2VEOA 4BP8A 4OQPA 3OOSA 4HWTA 3NEAA 3ESYA 2DBQA 2ZDGA 3SGLA 3T5MA 2XYHA 3AILA 4HPXB 2RHOA 3DD5A 3N2IA 3AJDA 5FOUA 4AP9A 4JCCA 4J3JA 4CIAA 4AX8A 3TTWA 2IZ5A 3NC1C 1Z0AA 1O4VA 2P2ZA 5P21A 3ZWAA 5F7XA 1IXZA 4XRRA 4EG4A 3L79A 4BFYA 4OH7A 4HWGA 1E2EA 3OQNA 1E3DA 3OOYA 2W6JD 3KKZA 2BUAA 3GL9A 1T0PA 3ZU3A 1AUPA 1R6UA 4XQ0A 1GPUA 4P2GA 2X2FA 2D06A 1XLTA 3FI9A 4P32A 3A04A 3M81A 1H0RA 4GRIA 3UBMA 1PZXA 3C87A 1IY8A 3D4NA 3ZH9B 3MOIA 4Q3KA 3TE6A 4FYYA 1E9FA 1Q1EA 2WY2D 5LYJF 2HFKA 1JSXA 3KEQA 3SSNA 3X1JA 2G1PA 1E0DA 5J1SB 4OQZA 1G8AA 1UT6A 4OLJA 1U1DA 3E8XA 4Q82A 5FAXA 4CTOA 1EWTA 1Y0BA 1N6LA 1NIJA 5A0TA 3GZTB 3DDWA 4H1UA 5L3QA 3KVYA 1YVPA 2YHAA 4B1FA 2IPNA 3STXA 2Z6UA 1B8UA 2FY8A 3KPVA 3QHPA 5DF1A 3C1TA 5DTRA 3Q3HA 1YU6A 1Z3CA 4ZU6X 4QGAA 2OXEA 3K9WA 3P9SA 4FZ5A 3TM4A 4MW9A 1KWKA 1YJQA 2XVZA 4QIHA 1V1JA 4JBIA 4ZD6A 1N4AA 3UK0A 2VOJA 2H4WA 2Z95A 5D5QA 2H4ZA 5F35A 2X86A 5B7NA 1ZOLA 5IDYA 3EIUA 2NZUG 4KDEA 4U7FA 3IXQA 1WB9A 1KMCA 1PHPA 3FUCA 4NCIA 4Y6PA 3VOBA 1JDZA 3IV9A 1GO2A 4YLGA 1QHFA 1YQ9A 2AJTA 4CLOB 1RVDA 1VYTA 3MRSA 1YQXA 3E53A 4RM2A 3UJHA 5E6UB 1FF9A 3L8DA 3LQKA 2ALJA 2F9LA 2UUCB 5FPYA 4YVFA 1DC4A 5K4AA 3P9KA 1DNPA 1ISHA 2X2PA 1ZG3A 3BXFA 4GI2A 3STTA 1S4MA 4N18A 3X1YA 4EKEA 3EGXB 3KOMA 3S81A 3Q15C 4NFYA 1E7RA 1H0SA 3K0FA 4FSXA 1R6AA 2IYNA 5EXDA 4XXHA 3A7DA 3BHJA 4RZ2A 4MQ6A 5GQSA 3VKUA 1ZRMA 5AI4A 2QBYB 3ZWBA 5HIAA 3FVQA 2H63A 2PVSA 4GNKA 1Y7TA 2F00A 4JQOA 2EF1A 2P4SA 4LN1A 4JYBA 2EX4A 3IMGA 3NAQA 1BS2A 3L7LA 4GO1A 3UJPA 1BFDA 4CFZA 1NNEA 4U0JA 5BN4B 1G8JA 3NYWA 1JAIA 2QRZA 1HDGO 1PSZA 1U2RA 1YCFA 2OK8A 2P9FA 2A7XA 4O2AA 2FQYA 3IL2A 3KT0A 1J07A 5REQA 4BFWA 3WHIA 2QRUA 4L3OA 2QUZA 5F98A 1K6MA 2ET6A 2P2SA 3GRAA 1TRHA 1NQ5A 5D1HA 4V1CA 1NUPA 2C57A 1IFXA 1FVHA 4PQFA 4X64B 3FE2A 4LHSA 3IEPA 3AUXA 3ND9A 5FADA 3GLIB 1KVQA 3IELA 2OE2A 4QFMA 3UMMA 5HM6A 1CUBA 3VR5H 4X1IA 4JVOA 4AN1A 1MTOA 5F2NA 1P1KA 3ORHA 3SIXA 1GTJ1 1L7OA 2YV3A 3V2HA 4Q19A 3LFUA 3KJIA 3HCNA 1GZDA 1E2QA 1E1KA 4ARUA 1NP7A 2PU7A 3H5LA 1Z74A 1L1FA 1DAEA 3C5CA 1H5QA 5CXUA 2PQ2A 1FL9A 1T0IA 1QM5A 3G8CA 4TYNA 5H02A 4FCCA 4YDQA 3GLGE 4DKXA 1YWGO 4UJ3A 3RSQA 1EFHA 3UUFA 3HZZA 1U4SA 4XWKA 4OB7A 2Z5GA 3R9IA 3T3DA 5B6PA 2GEUA 2GZ2A 3AR8A 4KAFA 2BUCA 2V3VA 2FQXA 1WBDA 1J0DA 3TSAA 4FBLA 1MHPA 4KFTA 5EIXA 5KWVA 1OB5A 2BFEA 4YJ3A 1M1NA 2LCFA 2AQ8A 4KOAA 1KF0A 2JIQA 1IOWA 2QTRA 2YHIB 3H05A 4O02B 4F0JA 5BV8A 3R3JA 2GPWA 3ORRA 2EU8A 1JLRA 2REQB 4N39A 2I9KA 3BKXA 4AUMA 4ID9A 4EECA 4M1EA 2VAVA 2IDKA 3IUMA 4INOA 4LYYA 4B6PA 4FBGA 1PT7A 2HHAA 2PWBA 1FXSA 2I99A 4KG7A 4PXAA 2YHBA 5IJXA 5T5QA 5IX8A 5J3JA 2QSYA 4NJEB 2BZ1A 2O5CA 2JHCA 3G89A 4JL5A 4NFSA 2OC4A 3VHXA 4KK3A 1E99A 2JHGA 1JLSA 3NT5A 1BFUA 3ZWMA 1NRIA 5K8UA 3NR2A 3WMRA 3H5WA 2GAAA 2YRFA 5BXQC 2GCIA 1F2TA 1GVNB 1VMAA 5JBIA 1B0UA 4GICA 1JEJA 3GCWA 2GQ0A 4IO0A 1KIMA 2B2XA 4IKEA 2I8CA 2C8JA 2YCBA 4E5YA 2IUYA 4LHWA 2I2BA 1E3IA 2J0UA 1FNCA 3CSUA 3JQAD 1VKHA 3A4VA 2AZMA 3CUEF 4QKQA 1YR3A 2INGX 4IRXA 1YS2X 4YMSA 2XD9A 2JI6A 3ONNA 4ND5A 1HDYA 4ZCIA 2VPPA 1WD7A 4EF5A 1E0AA 3N5KA 4JSTA 2NTJA 4XUDA 1C3EA 4OFBA 4US0R 3VTKA 2YYAA 1KJWA 4BVFA 5IBPA 1SA0B 3HY4A 4UU0A 5K2OA 1Q15A 4XB1A 2G28A 3W3AA 3A1VA 1ZOPA 2YBEA 4HDRA 5HIMA 4AURA 3PXCX 5AJHA 1CUZA 1NYQA 2P5TB 2CD9A 4QPZA 4PHGA 4QGFA 5DHRA 3ZVRA 5JCJD 3NAZA 4DCGA 2C61A 4KQJA 5H16A 1NVVQ 5FHQA 3G0IA 4Z99A 2OHVA 4PZ0A 3ZCPA 3FYHA 5A2GA 1PF7E 1U6JA 3JD1A 1KJYA 1YMUA 3HDVA 3I2FA 4V03A 3JQAB 3V97A 4AJIA 1NG9A 3WK8A 2PD6A 1G291 1DJQA 1WLYA 3S70A 2A0YA 3B2EA 3GQBA 4V24A 1U9IA 2ZRAA 4Q9HA 5I7RA 2AN9A 3L1IA 1XMSA 2JIMA 1WHSA 1QMPA 5EHGA 2D00A 3W6UA 5TMBA 1MENA 4KZKA 5G4KA 2I6SA 1V11A 2BFDB 3HHEA 3H2GA 1B6GA 1XE3A 4OHFA 4DJFC 1Z0KA 2FUEA 2F3QA 4GYKA 4QJ3A 3RJ9A 1EU1A 1Y8CA 4JBNA 1BE6A 3FGNA 3FMPB 1WP4A 2WU8A 3FUWA 1WAMA 3MXTA 4B3CA 2FX3A 3OJOA 3JWEA 4YJKA 1VGVA 4JB8A 5IK2A 3KSBC 4H4DA 5EAIA 2NVUB 5H0IA 4EGCB 4W63A 2X2OA 3IQGX 1YA4A 4GHWA 4KVFA 1Y9EA 3L8HA 3LYAA 4RBNA 5DX1A 2XMDA 3GJTA 2H11A 1TIBA 1O0CA 5K0SA 4YHHB 4IX1A 2DXIA 1G3RA 4UZEA 2LDBA 3HBMA 4PC1A 1G5PA 3UJ9A 2ZWPA 4F6RA 3FSRA 5I9BA 5IBQA 3WMXA 4HEA6 4BO5A 2NUTA 3DE2X 3OT1B 4FMCB 1Z38A 3QVLA 5BVGB 2UXDB 5ELMA 2Y77A 4EF4A 2WJZB 4DSNA 3UFBA 4LHEA 1FYDA 4KQWA 1SXJD 3HO8A 1NJFA 1UBUS 4IO1A 5J2TF 3BJZA 4ZCPA 4XR9A 1D2AA 4BN5A 3NNSA 1YQEA 3R3YA 2HQBA 1QANA 2ACVA 3G2HA 1R9NA 2YVLA 4HQRA 4XX0A 4CEIA 1DXYA 2J30A 2A35A 4OOEA 1XKLA 2QF7A 2Z4SA 1E2UA 3C4QA 3PEVA 3HSYA 2IP2A 2MOKA 4PIPA 4IXTA 3O8NA 4H1HA 4OFZA 4RCZA 3W5UA 4YCCA 2XV1A 1MW9X 3K92A 1MC5A 1I4DD 3P0HA 4ITUA 3JRWA 3T9EA 1DKMA 2XNJA 3BE4A 3OM8A 1JQ5A 2RGYA 2WOOA 2E37A 3NLLA 1O08A 5FL3A 1WLSA 2XMZA 3FR7A 5GM2A 3BRSA 4D41A 2J07A 1DIGA 3QNMA 4DBLE 4QYIB 2C83A 3SSOA 5MF6A 3FX2A 2JHFA 4XQEA 4E5KA 3PYMA 3D8BA 3LCRA 3HA5A 3MTBA 3UWKA 4I4TA 1FCJA 1E4EB 1L5OA 1LPPA 1SXJB 2ZPTX 3MLAA 4YJ2A 2QN9A 2GN8A 3E4DA 3GFQA 4HDSB 1FFWA 4QUDA 1JG4A 2WINI 2AWOA 3PF9A 3AVTA 1NKVA 1U65A 3K1AB 4W7HA 1YJCA 1ZC3A 4XD7A 1L0BA 2FEWB 3WZMA 3OO1A 2VBGA 3AXSA 4RK7A 4RDXA 3KXLA 1GITA 1Z0DA 3LLCA 3AF3A 4U8GA 2IYXA 1JBKA 3W7AA 3EXG1 5BMVB 2A5FA 4WLUA 5CFMA 1C2YA 1TGYA 2ANCA 2HU7A 3DMHA 3FTPA 2C42A 4LFBB 4NCAA 2F17A 4CDRA 4AW9A 3ROQA 1SUPA 4MVJM 2VHJA 3DFZA 3CGGA 3E48A 4PTLA 1HKUA 3W8RA 3WLQA 3LDHA 2C96A 2EOAA 1NNSA 2XOEA 3HJHA 3I01A 3ME5A 1POXA 3MINB 1ISIA 2VNAA 4W9NA 3STVA 4U2KA 5D01A 5BW8A 3JYLA 2G76A 3NKVA 1T9GS 1SKUA 3WJAA 4YV1A 4KXWA 3ICCA 1ZCBA 1EDDA 3RHZA 3WGQA 1KAQA 4L85A 3NPMA 4AYXA 4Q12A 3BF7A 4ESHA 4ZVRA 2FW9A 5JSZB 4V0LA 2OBNA 4HP8A 3KYIB 1ND6A 3AI2A 4DIMA 2CLCX 5CDHA 4Q5IA 1J2RA 2NG1A 3OFNA 4RW0A 5DDIP 2QQFA 4C4PA 2XIQA 3K0CA 5D2CA 1E20A 4Z8YA 5LC1A 3D5TA 2Q9AA 4I1VA 3DH0A 1BRMA 3ZX4A 2GM5A 3OWOA 3QVGB 1XRNA 3FFWA 1OR8A 1ORTA 1R5OA 1XVTA 3GF4A 3IIIA 4O4HF 3FOEC 3LD9A 1Q1GA 4RMNA 4L8WB 4TTQA 4HWSA 2F43A 1U2SA 2P41A 1HNNA 1X74A 3Q2KA 3ROEA 1GKUB 3UKOA 4YC7A 4DXHA 3KB6A 4F9EA 2XUHA 5TDHA 3D02A 3TINA 5IJWA 2FMUA 1RM4A 3BHNA 4K7JA 2PBRA 5IXSA 3GD5A 1N7JA 1QO7A 1T1JA 3CCFA 2DRIA 4I9GA 3C97A 4QRHA 1H4VB 3AQ4A 3SQDA 4J0EA 3IALA 4QNMA 4LK2A 1SUWA 4AMYA 3ST7A 1W88B 3VKFA 5K6AC 1JB9A 1MH9A 3GEPA 4U3JB 4ANFA 3N05A 1B2RA 1USWA 3AUSA 3MQFA 3MGAA 1F12A 3MGBA 1DKPA 5BQOA 4OI1A 1NC1A 1V8FA 3CLTD 1IHYA 3IBFA 1BG6A 1VI2A 4A16A 3GCGA 1QBGA 5HFJA 5HRCA 4FI3F 1JPUA 5H80A 2NO9A 3BTUA 3CRW1 4MKZA 4TMFA 3L8GA 2CSXA 4ARSA 3HVKA 4UHFA 1IG3A 2JGMA 2QLFA 2HHLA 3I23A 3ZTTA 4GOLD 5ALUA 1RHJA 1QZTA 5IPFA 1L3CA 4F2WA 3GZNB 3W77A 3D6HA 3LLSA 2OXRA 3ZY2A 1GSIA 2FP4B 4QT0A 5F5LA 4BMOB 4AI6A 3ZD6A 3B6EA 2Z1MA 1UBNA 1G5HA 1PR4A 1NRJB 1N2ZA 2QMHA 3BEOA 2WG0A 4MV0A 2O23A 4TKMA 5AQEA 2CHEA 4CHGA 1RSZA 4M6WA 5C1BA 1KI3A 4F12A 3U49A 2Q3LA 4HAWA 5NLLA 2DPGA 3GXBA 1AOXA 1WUYA 1CZKA 1VBNA 1M72A 1TK2A 1ZONA 4C0SA 1O58A 5JBQA 1HE8B 4H4CA 3KQVA 4JAVC 1OH6A 3N75A 4D7AA 4X95A 5KYYA 4FM9A 3RUEA 4D99A 1NXSA 2IYFA 4JUIA 4JMLA 1GILA 4PO3X 4G86A 5GV7A 4ADSG 4Z54A 3BRCA 4QXQA 5JPIA 2A1TS 3IXMA 1OGJA 4R9RA 1QX3A 4DA6A 5K01A 2EJTA 2WJAA 3NUQA 4S1OA 3SF8A 3F7OA 2P6MA 2YJZA 3QVJA 2UZ1A 2EKDA 3NTQA 3UANA 4RD3A 4DDTA 3PWKA 1IBKB 4N40A 4TV9A 2ZCVA 3O3NB 2WNHA 4JJZA 5BT8A 1YO6A 2XWQA 1JKXA 1N5OX 1W48A 5ERXA 2ZRDA 3ZV7A 4DLNA 4F97A 2C7BA 1I7DA 2ZYSA 4C4SA 1XZBA 1U5AA 3KUUA 1G20A 2ZAOA 3AUTA 1JHPA 4BXOB 5LL6P 1LLFA 3IEXA 5BYJA 3G0OA 1LGYA 1JKJA 1TEXA 5C7YA 1T0UA 3HKBB 1P0FA 4BN4A 2W6MA 4XI9A 4B2YA 5FUQA 2IDJA 4HQOA 3FSGA 2WHPB 1HOXA 3V32A 2VRWA 1N25A 5GVSA 3K5IA 2AEFA 1LDGA 3ER8A 4P5DA 2A9OA 1FYXA 1YD7A 2BZSA 3LECA 3ICOA 4B46A 2Q4OA 1WW3A 2QTMA 1ZITA 2E9SA 5FWYB 1OLXA 3AEYA 2EWVA 2H1LA 2NGRA 3W5AA 2OCBA 4C6RA 3D3JA 1Y6GA 4BGUA 2DWQA 2F1OA 4G4SO 1KE1A 3VV3A 3R0XA 1I1HA 4UFPA 1RRFA 1P45A 4Q03A 4IQ0A 3PFBA 4LPKA 5HFNA 3MT0A 1QHIA 1B15A 2ZSKA 1AQUA 1RCFA 3FPGA 3N3AC 4JLPA 3DE7X 2JD2A 3BT7A 5KMGB 3WKAA 5JADA 2AG0A 2EV9A 2D7JA 3EZGA 3MJCA 3R76A 3ZE9A 4DRXA 4FJ1A 4D6YA 4E7OA 1L4EA 3O83A 3A1SA 1XAJA 1FFEA 1JLHA 1PQ4A 3JALA 5BUCA 3SC2A 2Y0CA 5CHEA 1ZJ6A 4G5SA 3QTLA 3OIWA 2Q3FA 1X1RA 5JJBA 1MO6A 1NBME 3L18A 3PC8A 2GD0A 1WP9A 4JDPA 4B8ZA 4C0JA 2HWUA 3DMTC 1UEXC 3L04A 5JZMA 1MW8X 3O3MB 1ZOIA 3BXEA 3K9HA 5FRDA 2YWCA 3LKZA 2VSXA 4M9RA 4RGQA 1T4CB 3BVPA 4Q24A 3RUIA 3MGCA 1EBFA 4ZAYA 1E7QA 4TMTA 1DJPA 3H2JA 2VDOB 2JLWA 4P36A 1N6KA 3HBLA 3FETA 3U3KA 1PJCA 4HC4A 3U7QB 5CDSA 3ZE7A 1ZD1A 2X5NA 1AA9A 4OXXA 3VR2D 5AW7A 3CLVA 1O96B 2BMFA 4W5WA 2Q5QA 1PZNA 2W2VA 3BWYA 1O94D 2UYHA 1EAYA 1KAOA 4Z4EA 1QDLB 1U7UA 2JS7A 3QVOA 1KC3A 1P17A 2BP7B 3D8HA 3QW4B 2DFTA 2V55B 4REQB 1YRYE 3U4CA 4B6RA 4YXWD 2OCAA 3MWJA 3E3LA 2CNWA 3NX4A 1LC0A 2NVWA 3CEAA 4MI3A 1Q84A 1YB5A 4OHYA 1KR2A 2B0JA 1AF4A 2J3MA 1H6DA 1Z5GA 3RHSA 1T6YA 4JQYA 1BHQ1 2C4MA 1XHLA 5DBOA 3JPWA 4LTDA 2EQBA 2YR0A 3IE1A 2XMGA 4JKOA 1V26A 4R2XA 3I5YA 1K3UB 3M83A 4X5OA 3UPDA 1PR1A 5CITA 3PXEA 4PZCA 4Y2PA 2IZOA 4WOPA 3TUIC 3KSUA 3ESZA 2QXUA 5KNCA 2SKEA 4QX6A 4YRDA 4BZZA 4TZKA 3OI7A 5A3VA 1ZIPA 3OIGA 3NXSA 4P0TA 4BWVA 3H5NA 1ZI9A 2YV2A 3IUEA 3A9RA 3PFWO 3RYFA 5KHOC 2Z6QA 1D2NA 3QMWA 4TWAA 1MEEA 3WLTA 3QVVA 3IE2A 4FOLA 4RVUA 1EJ2A 1IXKA 3PDWA 3ZR4B 4Z4FA 3EXEB 4C29A 1V39A 3C8HA 3THSA 3EWNA 5DWVA 4BBZA 1W29A 3MLEA 5FNVA 4MYDA 2Y1DA 2PPLA 5E7IA 3C3MA 3CWZA 5HX7A 1QQ7A 2FHSA 1Q0PA 3L7JA 4G1MB 3ZLTA 2OB1A 3ZW9A 4NK5A 1AV6A 1CTQA 4EMTA 3H3FA 4Q9NA 4DJJA 4S24A 4PCVA 4GMXA 3DHYA 3HQ4O 1N1MA 4CFYA 3DL4A 3RWBA 3H4IA 3LYUA 4K3UA 3BF8A 4GXTA 4UE6A 2IFTA 3BQ9A 2PRJA 1ZN7A 4UTPA 3U61B 1T8TA 3N8DA 3WB9A 1ODKA 2RI0A 1W4CA 3MCVA 5AM4A 4C0AC 4NX2A 2AE2A 2HWYA 3HP1A 3L05A 5C8VA 2W2OA 2Q3EA 1JV2B 2IZ6A 3ANLA 4KJXA 5EN4A 4O08A 3I83A 1CUUA 1U0BB 5HF9A 3PA6A 1YL6A 1NXOA 2CKDA 5DMXA 2OAP1 2NYUA 4PN7A 3KRTA 2Q4EA 2JJ1A 2ZIWB 4II3A 3T1YB 1BDBA 4XVQA 3QI7A 4RORA 4QLBA 2VP2A 4V0KA 9LDBA 3KZVA 4JENA 1XWWA 2BCGY 2VYND 2YFQA 3CLUD 3NTRA 1BS9A 1JFFA 5CX4A 4ZREA 2BN4A 4XVRA 1IZZA 2GCEA 1P19A 2GKGA 3T1OA 4PLCA 3A06A 5DBGA 1ZM2A 5DHUA 3H2ZA 4KV9A 1GCGA 4JJIA 3OHPA 4BMNA 3IJEB 4CMAA 2HLPA 4J8PA 2GAFA 1A9OA 4W6QA 3W8FA 3SU8A 4HB2A 3FDJA 1OGYA 4JY7A 5DE3A 4XARA 3GPCA 1Q1BA 5DGHA 4CNQA 1D1QA 1WY5A 5C32A 2BGKA 4HYEA 3UKJA 1O95A 1T6BY 3W8NA 3ENQA 2I2WA 4GRAA 6ABPA 2OV4A 2HD4A 4ECAA 4B7ZA 1JQKA 4B4OA 4M83A 3NDBB 4E3ZA 1VZ3A 2JJ2A 1A76A 1E3LA 1XCMA 3NEYA 4LWPA 4P58A 3BWVA 3PICA 1CDOA 2C0CA 2OFXA 5AM0A 3MBOA 3UMSA 5FPSA 2G63A 3ABIA 3D1VA 3GT3A 3ZWDA 3KTAB 3D3QA 1WM1A 5B64A 1GAXA 1Z4PX 2WJIA 4YCLA 1A98A 3DHNA 5EE0A 3CRRA 2QT0A 4EPYA 3Q8WA 2I6TA 4KE7A 4BKOA 4MWOA 3G79A 2QDKA 1BDJA 2I62A 4DZZA 5JVDB 4KV7A 2NQ2C 1YACA 3QOFA 1H2ZA 4DLVA 4F2PA 2F64A 5ALWA 4GPAA 1I4TD 5EMMA 221PA 4GM1A 3R8XA 2P1RA 4GEGA 2P1ZA 2J4FA 1VSVA 1U9YA 3R6TA 4RQAA 1COWA 1HFWA 1JDSA 4JCOA 1C81A 3LSYA 4FZJA 5DHFA 3WO1A 2GD6A 3STWA 4BN0A 3RRZA 3K5HA 2X0IA 3D6AA 1A8SA 4J1TA 4BLUA 3Q8MA 1KYVA 1F9EA 1NVAA 4WXYB 4CR7A 2YV1A 3ZS9A 3HDTA 1V1RB 5K0CA 4PCAA 3EQZA 3S2YA 4ZI3A 1JAZA 3GGOA 4ZVLA 3AY0A 3SYRA 1GD1O 4EGFA 4R31A 4DTIA 4DR1B 2PO7A 1RYEA 4D92A 1H9CA 2KX7A 4QT4A 4B6GA 4YPVA 4NZMA 4Y0VA 4YP6A 3A14A 1ZJ4A 2VHTA 3R40A 3S1SA 4M2LA 1GN9A 2QE7D 3LIPA 1QO9A 3PVZA 4XQGA 5AW3A 1P7CA 4UAGA 4DR2B 3NHUA 3TG2A 4OUDB 2XA2A 4WGGA 2NNLD 3TXAA 1YQQA 3GU3A 2O0KA 3CY6A 2OHXA 1XDBA 4ZQFA 3K1YA 2QMEA 3I0MA 1KVTA 3SLGA 2A0UA 4YMTA 1YDEA 4NPAA 4XQCA 1QTQA 3LT4A 3MCAA 2WIFA 4BNIA 1EG2A 4QUIA 4FOOA 2WAXA 2B1GA 1NXPA 2J7PA 2MYPA 2H4YA 3PQDA 4IMPA 4ITVA 4N0QA 4AG3A 4BPRA 5L40A 3NDRA 2ZU6A 5A7HA 1PEAA 5JALA 2PSJA 4HAXA 3HB0A 2F1RA 4YJGA 3LBYA 4Q3OA 3PGA1 2R6GA 5AW9A 1J00A 4WD3A 2AZDA 2GYUA 1DX4A 3ETNA 4P3YA 1IOVA 2O05A 3FPBA 3OZXA 4YROA 1CQIB 3BWMA 1E1QA 2ZJ3A 4FDUA 2FW6A 4R84A 4AY6A 4R2LA 2H1SA 3IEUA 2BMJA 1H69A 2J9ZB 3R5KA 3FYTA 4LDZA 5J4KA 3QEOA 3QWHA 3B8EA 3WQQA 3K05A 2CHUA 5EFZA 1D03A 1KFJB 2LDXA 3EC1A 1X2EA 3Q3CA 1NFFA 4U7GA 1JSZA 1UXIA 1BJTA 5DSXA 1PFYA 3P0JA 4KODA 1XQVA 1FJ2A 2IEDA 3UJDA 3KWFA 1DI0A 3F9CA 5F4BA 4ZV4A 1GL9B 2CUNA 3EAFA 4YRRA 4A8JB 4DSZA 4J29A 3GBPA 2XUAA 1UMCA 1XRMA 3JQ7A 3PRKE 1FMTA 4PINA 3DP7A 1WE2A 3L8MA 2Q0HA 1BD3A 5CJ2A 1VRWA 1T5SA 1YXMA 3O03A 4TV8B 4I3HA 2QORA 1W2HA 2H2AA 5JS7A 2QDXA 1R6VA 3NTOA 1QH9A 1NFQA 3PZRA 2ERYA 5FV4A 3RO7A 1V4VA 1E6UA 2BMEA 4GLOA 4BFXA 2UUAB 1VFNA 3MTAA 4QNRA 4LGYA 2QM8A 3ZI4A 2GK4A 1C9JA 1Q3KA 2RIRA 3HFRA 2AYYA 2KS6A 2OGUA 1L5ZA 4G1FA 5LXTB 5KREA 3HBFA 3IQDB 1F8GA 1NVVR 1NZDA 3KU1A 1M7HA 2WEKA 5IT4A 3A9CA 3E9ZA 2ASEA 2I4NA 3K0BA 4EHAA 2PJRA 1WPGA 1NW3A 3ND5A 4CT4B 3A3KA 4KQHA 1A8IA 2XPCA 2DHEA 4KJZA 4EY4A 2XYGA 4CDMA 3HA3A 1KJ9A 4LX8A 2H1VA 2VNKA 4QOEA 3BFXA 2D0PB 3VH1A 2VDWA 1AKTA 1V5EA 1MB2A 4N6NA 2GPBA 3A1NA 3K0SA 1XPOA 4HMPA 4NBWA 4L5IA 3KP1A 3OMWA 2DFPA 4RE6A 3WZ2A 4ENPA 2O2GA 1GYRA 1G0OA 1C29B 3PVSA 4UD2A 1LJ8A 4EVSA 1LH0A 5CFOA 1VSBA 1RXYA 1CUEA 4WW0A 4YONB 4QUAA 4F5EA 4F04A 1FX0A 2ZS9A 5TPWA 2P75A 3WIEA 5BWNA 1Q91A 1Y37A 3FHOA 3N59A 1KYZA 1SCJA 1ODFA 5BV0A 2NU8B 1G8PA 1RAEA 2BV3A 1NY6A 4Q0MA 1E59A 1UANA 1XGKA 2W8ZA