4AJIA

Rat ldha in complex with 2-((3,4-dimethoxyphenyl)methyl))propanedioic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
330
structure length
327
Chain Sequence
ALKDQLIVNLLKVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 115
structure length 327
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajiA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajiA02
1YH3A 5BNIA 3IOYA 5DBFA 5B4VA 1HZJA 4MKZA 4B3HA 3N74A 1QYXA 3O9ZA 1KEPA 1GTMA 2V6GA 4R3NA 4CLXA 4AJJA 3W4IA 3JQ7A 4GLLA 3LDHA 3IC5A 1B7GO 1JDJA 2EP5A 1D8AA 1UZLA 2Q1SA 3OEWA 3LSYA 4K1LA 1ZFNA 1WZIA 2CF6A 1XQ1A 4JROA 2D2IA 4L4RA 2A92A 1XR3A 1A9ZA 1V3TA 2PZKA 4TVBA 4G2NA 5FWNA 2P4QA 4TRMA 3TZKA 4EJMA 4TRJA 4MJLA 3ENKA 2X9VA 3ZHBA 2EXXA 2GUGA 2PD4A 3NV9A 1QXSA 1RJWA 3H9QA 2BI8A 4EZBA 5IXSA 3KETA 4QSMA 1U3VA 4UAGA 3RIHA 2F1KA 1JW9B 2C0CA 5BSEA 3AI1A 4ALMA 1L1FA 1DHTA 5DP2A 3WMWA 5K9ZA 1PL7A 3L77A 1TLTA 3PQFA 4B4OA 5T5QA 4BGVA 1TVEA 1FDVA 1IPEA 5EL0A 3C1TA 1E7YA 4YQZA 3ZNPA 5JSFA 1C0LA 2QG4A 1BW9B 3AW9A 3JQ8A 3FBGA 1YOVA 1B8PA 1VL6A 4FFPA 4Y9DA 1UXKA 5IN4A 2D1YA 3E9NA 2X5OA 3KO8A 1BXKA 4BNJA 4MINA 4LK3A 2EJWA 1WDLA 5DNAA 3GVCA 5JMWA 2J3IA 3IKVA 4MVJH 4ALKA 2NU9A 1GYQA 3PHHA 2EHDA 3JQEA 4DIFA 4IZIA 4D46A 3BMOB 1BHSA 1B2LA 3QE3A 3JCZA 1PGNA 1UZNA 1XU9A 4RORA 1VLLA 1P1FA 1KVUA 5L9AA 4Y6SA 1EDZA 1T2DA 3SC4A 8LDHA 4AJ4A 1CF2O 5COAA 3WBBA 4JBGA 4E5MA 1I36A 1E3IA 5L45A 4YJDA 4OKNA 1HKUA 3JQCA 3T4XA 1W73A 1I01A 2OBYA 5KJ1A 3WGHA 5TJ9A 9LDTA 4LGVA 4OO3A 4U0JA 1IZ0A 4Z6KA 4XIJA 2X86A 5IN5A 4BNLA 1HF3A 4XJSA 4CQLB 1KVRA 2EW8A 1T2AA 3DZHA 4J1QA 4DMMA 4F45A 3SEFA 4PLTA 3X2FA 4AG3A 4N5LA 2PH5A 2I3AA 3AK4A 1EE2A 4PZDA 5AXDA 6LDHA 3UFXA 5IZCC 3DHEA 2NNLD 4L9RA 2IYPA 2VWQA 4JX8A 3GN1A 4LVUA 1LRJA 2O3TA 4B3IA 4W9NC 4JXKA 3DZFA 3ITKA 3IQDB 1LRKA 4BNYA 1I2BA 4GWGA 5DOVA 1XKQA 3H9EO 1DC6A 5ENVA 3DBRA 3DFZA 3EW7A 3MJVA 4N7RA 1F06A 4RCVA 1T1SA 1VL8A 3HDYA 4O5OA 5KTKA 4JNKA 4FQ8A 1J49A 1HE2A 1ZNQO 2ZCVA 3F4LA 4RVGA 1WDKA 4HFRA 2JHFA 2NQ8A 4DLBA 1XDWA 4QX6A 2VUSA 4X54A 2PZJA 3IDSA 3ZWAA 4GWKA 1RM0A 1SMKA 3CTMA 5L7TA 1RM4A 5G2OA 3DQPA 3ROMA 1P0CA 4P22A 4W82A 1ENPA 4BQPA 2O7QA 1D4FA 1P1HA 3V1YA 1XLTA 4NBWA 4OJNA 4KP7A 3JD2A 3GHYA 3K96A 1V3UA 1SOVA 2EIHA 3A14A 3CMMA 3QW2A 2C7VA 2AEFA 5L4LA 3RFVA 2AG5A 2CDCA 2D4AA 2NVUA 3K31A 2HSDA 4DPMA 1BRMA 1X14A 3ZNQA 5KOIA 2E48A 3H2ZA 4GVXA 3MOGA 1S6YA 3PP8A 5JO0A 3JYPA 4YA6A 1PR3A 3ZCXA 6ADHA 3A4VA 4XQGA 3DFUA 2FSSA 3EVTA 2VHWA 3PFFA 1Q1NA 1DIBA 2ZCUA 3HN2A 1JVSA 2BGMA 3PK0A 2QRJA 1X1EA 4D7AA 1B0AA 3PQDA 1FF9A 4IXTA 2VOJA 3GFBA 1HDXA 2Y1GA 4P4LA 3H6KA 3I5MA 4YVFA 3WYCA 2ZK7A 1MFPA 4E32A 4YAKA 2CF5A 4BUCA 4DGSA 3B70A 3WGIA 2Y1EA 1DAOA 2NU7A 3W1VA 2Z1NA 2CVOA 4B4WA 5A04A 1C0PA 4OH1A 4KOAA 5F1PA 4ESOA 4GKVA 1KVQA 2DUUA 1LSUA 1C1DB 4INAA 1KVSA 2BH9A 2E6UX 3L07A 4ZQHA 3WQQA 3CZMA 1Q0LA 5G4KB 1P33A 4XYBA 4NR0A 4FW8A 5EJ2A 5H81A 4XGNA 1GV0A 4M55A 5JAIA 4LSMA 4FS3A 4OKIA 4JBIA 4R41A 5U4QA 5DULA 1NQTA 5KVCA 1PZHA 4IDDA 3D4OA 5DCYA 2YQ4A 4NFHA 3TZQA 5JNLA 3PLNA 1MXHA 4PRKA 4K6CA 4OAQA 5FFFA 5IZ4A 1DB3A 1Z45A 3AI2A 3JYQA 4WGGA 5CEEA 5L95A 3W6ZA 3DMTA 1MC4A 4CMAA 1P31A 1PU2A 5COBA 3JQGA 3JD4A 2Z95A 4WE3A 1BW9A 4F3YA 2Y66A 4KUHA 1LSSA 1V9LA 4IS3A 4L76A 4CLEA 5DBGA 5JY6A 1XU7A 2Z5LA 1HETA 1BVUA 2CZCA 3QVTA 4Y8VA 5I8ZA 5B1YA 3EUWA 4KMSA 1M76A 3AUAA 4WOKA 1NPYA 1Y5RA 2X8LA 3JD3A 3DL2A 1D1TA 1B8UA 3BTUA 2ZJ1A 3RBVA 4IMRA 1M6HA 1X13A 3EMKA 5COQA 3KRTA 1LUAA 3K92A 5CDSA 4J9VA 2I5PO 5A9TA 3WB9A 4TKLA 4YT2A 4FC6A 1VE9A 3D0OA 3DZKA 2Y99A 1YJ8A 2J6IA 3TOXA 3E9QA 2P91A 2O3JA 2WDZA 1MFZA 2RIRA 3ADPA 4IDBA 4LRTB 4QT0A 2DBZA 4JN6B 4Z3DA 2NSDA 3MWEB 5MDHA 2VHXA 4BO0A 4J7XA 2JKVA 3EGOA 4CODB 3VPSA 5JMPA 1A27A 4CMEA 1U8FO 4JP3A 4ZICA 1LRLA 1T24A 3QRWA 1HSZA 2VRCA 1E1NA 4FGSA 2P2SA 5TF4A 5TGDA 3L9WA 8ADHA 3JQBC 4H3VA 2HMWA 4LMPA 1MP0A 2DPGA 4O1MA 2CVZA 2IZ1A 2W2KB 3TFOA 4J4BA 1KYQA 4TROA 5JCJD 1ID1A 2P5YA 3UW3A 2OHXA 4R16A 4RPKA 1VSVA 1WPQA 3DHYA 1Y6JA 2GZ3A 3M1AA 1DJQA 1ISMA 3DZJA 5HA5A 4WEQA 5G0UA 5IFLA 3ZU5A 2OGUA 3KEQA 2XXJA 1GADO 4BO8A 4LCJA 4A27A 4J1TA 1BTOA 1PQPA 1GQYA 4JCOA 2DC1A 3QP9A 2IEBA 1UUFA 4I9UA 2HRBA 3VDRA 1U4OA 5JBIA 3GF4A 2PFGA 2WMDA 5DBIA 4DA9A 3MJCA 2NTVA 4OQYA 1F0YA 2J3KA 4W99A 3RC7A 4PLCA 1XGKA 1ENZA 3N7UA 3RSHA 1HE4A 2EJVA 4AVYA 3VKUA 1EK5A 3LLSA 2EGGA 2NU8A 5DDIP 3DONA 1C0KA 3AY6A 1YB4A 2J5RA 1T25A 3BAZA 4PG6A 2WM3A 1HSOA 2C2XA 4I5GA 4P4NA 3ZGYA 1XG5A 3C1OA 3OH8A 4KTTE 2HDHA 1I10A 5EN4A 3GT0A 4XR9A 4HP8A 2CDAA 1P44A 4R5HA 3W4KA 3G1TA 2QZZA 2AW5A 3DO5A 3P2YA 3FN4A 1KY4A 2AQKA 4W7HA 1WP4A 5KIAA 1R66A 4Y67A 2ZYDA 3SXPA 3SJ7A 7MDHA 1BXZA 1VKOA 1K89A 4NBRA 1MA0A 3HB4X 3PJGA 3UCFA 1V8BA 1DIAA 4R9SA 1LLQA 1EUZA 3EZLA 4KWIA 3LT4A 1A7KA 3OA2A 4HNHA 3WLEA 4E5YA 3VHRA 1BWSA 4LN1A 3GY0A 3TQHA 5A9RA 1NNUA 1JWAB 1Y5MA 4FCCA 1QSGA 3JQAD 3VH1A 5KWEA 1IE3A 2W4QA 2JFFA 1PL8A 3ANLA 2UDPA 4RV9A 4ZQFA 2C59A 5T8KA 4WK6A 4NU6A 1GYPA 5JPIA 2C82A 3GZNB 1W8DA 2R6JA 4CM6A 2A9FA 1HE3A 5F5NA 1A5ZA 3WSWA 2X5JO 3INGA 1BXGB 4XX0A 4A5OA 1ADFA 2DTDA 5KJ6A 2Q46A 3PGJA 3D4PA 2I67A 4NJMA 1R4NA 3ZWNA 3PI7A 1AHIA 3I9JA 4J3FA 3H5RA 3RJ5A 1N1EA 3GG9A 1E6EA 3Q9UA 4M86A 1O6ZA 3RWBA 3DOOA 2P9EA 3NT4A 3TPCA 2D0IA 3AWDA 1NM5A 3OM9A 1Y8RB 3H65A 1CWUA 4WKGA 2AA3A 3VOSA 1GQQA 5A03A 4ITUA 3S55A 5JYDA 3IS3A 1Y9AA 2HQ1A 1E7QA 5CDGA 1EFLA 2ZJ0A 4WCFA 2V7PA 4XB2A 4CL3A 3GAFA 4WLFA 5A5FA 2VQ3A 2PY6A 3TL2A 2PGDA 1NP3A 1MG0A 1OBFO 5AQ1A 4U6QA 3I9LA 4Q3AA 5C5IA 1UDBA 2D5CA 3KVOA 4NMHA 4UEJA 2VNSA 3QWIA 4OXNA 4A7PA 4F6CA 1KC3A 1EVZA 2W98A 3E03A 4PLVA 3LLVA 4DQVA 3EDMA 4HFJA 4FFRA 4FIZA 5EESA 2EEZA 4M89A 1P9LA 1LDYA 1G6KA 2DLDA 3KTDA 4IDAA 3WYBA 3JQ9A 1F8GA 1Y9EA 4AJHA 4CR8A 1KY5A 4TZKA 5CAEA 3ENNA 3WIEA 3HQ4O 4FGWA 1A72A 1LU9A 2O3UA 3S2EA 1N1GA 2CD9A 3OP4A 3Q1LA 5CDYA 2W2LD 1ULUA 2Y68A 2X7HA 4BNKA 4Z9FA 5TNXA 2JCXA 3VPHA 3OQ6A 3FRJA 4DBVO 5T8KC 1IB6A 2O4UX 3NAQA 2FWMX 2BKAA 1DC3A 2WD8A 1K6XA 3O38A 4PG8A 5GZ1A 2VOEA 3GVXA 3QVWA 2P68A 3QQPA 5KCZA 2PR2A 4Z0PA 2YZ7A 4BGUA 4D3SA 1HT0A 1OC4A 4B7CA 2O2YA 2IYOA 1CDOA 4LW8A 3EY4A 4ZGWA 3PJFA 1GFSA 2VTDA 2H9IA 5BSHA 3SBOA 4N54A 4J91A 1SEVA 1U5CA 2C2YA 2EV9A 4LSWA 4UEOA 2C20A 4TQGA 3Q9NA 4L0QA 4D0RA 3U4IA 1U2GA 2IDZA 2B5WA 1KEVA 4CV3A 1ZH8A 3NGLA 3RUIA 4WUVA 2Y1OA 3PWZA 3LYLA 4ILKA 1O95A 4CMCA 1CQIA 3DAGA 4BNXA 4R9RA 1YB5A 4ALNA 2DVMA 3IUPA 1ENOA 1R0LA 4DLLA 1J4AA 4B4VA 4WCFC 3RFTA 1JLLA 4URFA 2FSVA 5TQVA 1JKIA 2QZ9A 4ND2A 2EP7A 5ILGA 5JDIC 2PKQP 1QYDA 4ND1A 3RI3A 2DU8A 5JCXA 3RQSA 4BB5A 3K6JA 1B14A 2RHCA 4WASA 1EDOA 3DEYX 1WDMA 3LF2A 3M2PA 3BTSA 3DXFA 2AQ8A 3U4CA 3ZWYA 2EKLA 4G81A 3V2GA 1HDZA 1YVEI 1EZ4A 4TWRA 3RAJA 3ZWCA 1DXYA 3HE3A 4G65A 1O94A 1E1MA 1UXIA 4ID9A 4MIEA 4DIBA 4E21A 3IJRA 4FPXA 2X1HA 1N8KA 2ZTVA 4NFSA 3OJOA 3DZGA 1PIWA 4UULA 2FPPA 4BNHA 5C3MA 2FHSA 2XOXA 2ZTUA 3OICA 2YFQA 4IMPA 3BMNB 4WLNA 3KHUA 1N2SA 1LA2A 3R1IA 4K28A 2P4HX 2CUKA 5JC8A 4EI2A 2E82A 4MO2A 3PVZA 2BI7A 4R01A 2E37A 2XPCA 3NKLA 4CLHA 2GDZA 1N9GA 2WTBA 2CDBA 1M66A 3KOUA 1WZEA 2PNFA 5K6AC 3ITDA 3VTZA 1V0JA 1ISJA 1G1AA 1YQXA 3KEOA 3H7AA 3JYLA 1MXFA 4PG5A 5CG1A 4RPJA 3ZV3A 1BVRA 4C7KA 3QVOA 4EJ6A 1K5HA 4CM9A 2JFGA 4CQMD 3BHJA 2YQ5A 3GZNA 3OIGA 4PZEA 3RC2A 4IM7A 4CPDA 5ITVA 5DOZA 1N5DA 4XD2A 3D5QA 3FWNA 3CSDA 3NTOA 3PIDA 3RUAA 3C8MA 4BL5A 5B12A 1HE5A 1K0UA 3L4BA 3MCVA 4NBUA 4CR6A 5HS6A 5KJEA 4HXYA 1YBAA 3PWKA 4FFMA 2J5QA 2NQTA 3BTVA 1ONNA 3OJFA 4U7WA 2ZQZA 3AOGA 3TZ6A 1U28A 1DRVA 4GAEA 4O63O 3DBHA 1JU9A 2NACA 5AOVA 1W0CA 1T2EA 1LLDA 1TB4A 1P77A 3W8FA 5THQA 5IG2A 1OFGA 2H1SA 2HMTA 3U3XA 1RWBA 2VZ0A 1C14A 4NBTA 2DBQA 1ZCJA 5FYDA 1NX6A 2D59A 4B79A 3AU9A 4IPTA 4UVEA 1G0OA 3CUKA 4WEOA 5EQDA 5FI3A 3DZIA 5JCJA 5JS6A 1ZSVA 3GRKA 1R6DA 1ZBQA 4R69A 4CMIA 4J7UA 1MLDA 2BFPA 4JLWA 1ZJZA 3V8BA 4TZTA 4YB8A 4F6LA 4ONEA 5K0ZA 3HDHA 1LDNA 3ULKA 1UDAA 3JYOA 1W4ZA 4A03A 4R5MA 4JQCA 3UN1A 2UUPA 2VZ8A 1LQUA 4IGFA 2AEMA 3FCOA 1C1XA 1C3VA 1ZEJA 3CXRA 4RVSA 3JQ6A 3PEFA 3F5QA 4IQ0A 4WCDA 3INTA 4A26A 1R12A 5ITWA 4RVDA 1DFIA 5JYEA 4OQZA 5JXWA 3UVEA 2OORA 3ZHYA 4HFMA 5A06A 2YDXA 2YHIA 2Q50A 5BQFA 2IE0A 1LC3A 2B4TO 3D3WA 3DAPA 2R00C 3HADA 3H8VA 5TT1A 2JAPA 2Y0DA 3JD1A 3RBZA 2HJRA 5HM8A 3K5PA 1PGJA 1Y1PA 5EPOA 1V35A 3HWRA 3KUXA 1UXGA 3V2HA 3GNSA 1IYZA 1KEUA 3DAFA 3E6AA 4GSLA 1Z73A 1AHHA 1GZ3A 1WNTA 3PRJA 4I9NA 4KTVE 2OO5A 4NIMA 3ROPA 4B7XA 4CUZA 2HK7A 4AFNA 4Y6RA 2HAEA 4YAEA 1ZXLA 2YV2A 3QVXA 2PKQO 1PS0A 4J6FA 3WDSA 1B3RA 1QYCA 1GL3A 4MVJD 4CM8A 2ZB3A 4A73A 3R3SA 4CM4B 4BHTA 2ZYGA 3RC1A 1VRWA 5L7YA 3X2EA 2ZQYA 3RC9A 1LX6A 3ABIA 3ZWVA 1T26A 1DRUA 1SNYA 1FDSA 3PDJA 3D64A 3WFJA 4EEZA 4J16A 1AXEA 4UUMA 2PGJA 2Q1UA 1WLYA 2NM0A 2B83A 3GNTA 1EVJA 1LNQA 4RL6A 4BNGA 4CLRA 2GYYA 1UZMA 3H9JA 3U4HA 4XGKA 2P5UA 3ZWWA 3JQAA 4XJTA 1DBVO 3PZBA 3ZHXA 2BHLA 2XAAA 5ER6A 4XRRA 3OQBA 5F21A 3TWOA 4CLDA 1T4BA 4IQGA 2PZMA 3QV1A 1ZW1A 1RYEA 2GR9A 1I3KA 3GFGA 1ML3A 3MJSA 3W6UA 4CQMB 4E2YA 1H5QA 2PLAA 3GEGA 1SAYA 2ZKLA 4YQYA 2BELA 4Y98A 1NFRA 4FJ2A 4TSKA 3WNVA 4YWJA 1U3WA 5C7OO 2AE2A 3VPXA 4IUYA 1P0FA 1ZIDA 3RD5A 2QQ5A 1ISGA 5G0WA 3WBFA 3JQDA 3KLPX 4HFNA 4J1SA 3TRIA 4I1IA 3ZU4A 1PJQA 3ZWBA 4DVJA 2FZWA 2JD0A 2WD7A 3CH6A 4YAIA 3GDGA 1AN9A 2RHRA 3W4JA 4OL9A 3P2OA 2FMUA 5FEUA 3SVTA 3RU9A 3P5SA 3VKVA 4XDZA 4O0LA 2D8AA 4EITA 1E3WA 2DBRA 1VL0A 3TZCA 2V6BA 1MB4A 2YJZA 2X58A 3W8EA 1YE3A 1OAAA 1I32A 4D3DA 4DMLA 3U4DA 1P1RA 1DDOA 1VI2A 1LBEA 3O8QA 2HMUA 2HCTA 3IKTA 4XRGA 3QA9A 4D41A 4YJGA 4XGIA 3UUWA 3VH4A 3VZSA 3WQSB 4YJHB 5ICMA 3VAZA 1BGVA 1H0KA 3K2BA 4WPGA 3RUFA 3GGPA 1SOWA 1A7AA 1H2BA 4NHEA 2NTJA 3OECA 3G17A 4OXYA 1Q0HA 2CVQA 1GDHA 2BFAA 2NUAA 1NQAO 4ALLA 2VRBA 1E6UA 4GGOA 1UH5A 4EUHA 1A4UA 5EERA 3WMXA 4IIVA 5TRTA 1GCOA 4OOEA 2BF7A 4FB5A 3PZRA 2X0RA 3OQ1A 3A9WA 2WYUA 1EEHA 3QWBA 4MKXA 5A4DA 1OOEA 4GBJA 3H9UA 2QX7A 3DC2A 5A05A 3AFNA 4YDRA 5JC1A 3FTNA 1QG6A 2CSUA 1QLHA 2JAHA 1UP7A 3HSKA 3BMQB 1E5LA 2YW9A 3FWZA 1LLCA 4IXWA 3ZV6A 4D79A 3VPFA 5KJCA 2Q1WA 3IUSA 1JWBB 4JJIA 2IXBA 3OSUA 1CQJA 3AFMA 1BG6A 2E4AA 2ZTLA 4KUGA 5BNTA 2GD1O 2WE8A 4ZD6A 3UOGA 4D42A 4M54A 4JJGA 4XWYA 3GPDG 1ENYA 3C7CB 3ZH2A 2X4GA 3M2TA 4JK3A 2I66A 1LTHR 2WYVA 3S2FA 3K30A 4MIOA 3LC1O 3GVIA 3NX4A 3RKRA 4DC0A 4KQXA 4I08A 1YL5A 2EKQA 1E7WA 4TRNA 3TOZA 5J23A 2H6EA 4BNFA 5JY1A 1JKJA 4J0EA 2JCYA 1RM3A 2I65A 1Q0QA 2O7SA 2YFHA 3VVCA 1OI7A 1UJMA 4CM3A 1NVMB 2Q3EA 3FF4A 3HJAA 3L6DA 1LDEA 1X1TA 1Y8QB 3TFQA 1O5IA 1NPTO 1TT5B 4OMUA 3TL3A 3BHIA 4XCVA 2ZATA 1M6WA 3RKUA 5GY7A 3IAHA 4RDHA 4A10A 5L4SA 1U7HA 1H6BA 3OFSA 5U9CA 1TXGA 3PDUA 3V2UA 1ZMOA 1JKFA 1Q7CA 2HKIA 2NV6A 3L6EA 3BMOA 1KETA 5A9SB 3TF5A 2DFDA 4MP6A 2B69A 4J9UE 3UAGA 3DB2A 4JIGA 3K2EA 1GR0A 3GGGA 3HFSA 3PYLA 1ADGA 1PSDA 3NTRA 3ZHZA 1GYRA 2B5VA 3AUUA 4C4OA 1JQBA 4D3FA 2H63A 4II2A 4Q3CA 1M2WA 1XA0A 1PJ3A 2O3QA 1B15A 4CQLA 1WVGA 4QTZA 5L51A 1SPXA 1SB8A 5AXCA 3WGZA 4CUJA 3W8DA 3ZDFA 1NR7A 3OA0A 4FN4A 2RCYA 1DO8A 3V1UA 1E0DA 5A1TA 5CEFA 1D3AA 2GASA 3ZW8A 4IDGA 4S3MA 3GUCA 2Q4BA 4FBGA 1PX0A 1DPGA 1I2CA 3G3EA 1LSJA 5I7EA 1UXHA 5IAAA 4BNMA 4DREA 2G0TA 2WJPA 1CIVA 4JP2A 4D44A 3ON5A 4PLHA 1QYVA 1DAPA 4R4JA 1LXCA 3NGXA 4R1UA 1ISFA 1M67A 4DXHA 1BSVA 2VN8A 3DBLB 3WGOA 2GZ2A 4RQTA 3OJ0A 3DMTC 1F8FA 1PS9A 2ET6A 1LDMA 3KM0A 4QO8A 4RF5A 4EUFA 3JYNA 2HJSA 4UVDA 2X23A 4GVLA 4W4TA 4IZHA 2QYSA 3CINA 4Z9YA 2OBNA 3ZN2A 1HYGA 3CE6A 3GEMA 3FSRA 1QMGA 1AUPA 3NT2A 1GEEA 2VCYA 4BO1A 4RO0A 3QWAA 5F5LA 1E7MA 3G0OA 4JJFA 2HK8A 1JAYA 3HDQA 2C5AA 3D7LA 1KBZA 1ZK4A 1NVGA 5DF1A 4E2ZA 1YL7A 4D0SA 5JDCA 2IEDA 1O8CA 2B4RO 2VYND 3KLMX 4QXMA 5H82A 3OJLA 2RH8A 4XQCA 1YBVA 1GY8A 2HMVA 4FD3A 1ADCA 4MVJI 4ROSA 1YQGA 2ZYAA 4KDFA 3JV7A 5DZSA 5B4UA 4FOOA 1ZKMA 3SJUA 4N18A 1NVTA 2IRWA 4ZU3A 4QQRA 4EUEA 3QHAA 4CL8A 1QV6A 4MP8A 4CMEC 4LCEA 3WOHA 4CMBA 2X6TA 3ADOA 3GRPA 4XA8A 5ICSA 2CMDA 3FPCA 4DYVA 4MVJG 1ARZA 3TZHA 2Y0EA 3UF0A 5LC1A 2B37A 4A2CA 1PS8A 1I30A 3EK2A 4MKRA 2Q2QA 3D1LA 3PHGA 4FOSA 1T2FA 5T6BA 3A1NA 3FNFA 2J8ZA 3AOEA 2V65A 5H83A 5JAMA 4CM7A 2ZIZA 3ETDA 1DIHA 1C1DA 1R16A 5LDGA 3U0BA 5BSFA 3LT2A 3S8MA 3UICA 3UCXA 3GN2A 3GDOA 4R1SA 5G4KA 3WG9A 3ONFA 5ER9A 1ISHA 1BMDA 1HYEA 2BLLA 4YR9A 3GZ4A 4EJ0A 3GGOA 4GH5A 4L75A 4OIMA 3HNPA 3I9OA 3U9LA 4ZN6A 3UXYA 4BO2A 3BIOA 3FHLA 1J6UA 3OIDA 4PZCA 3ZU2A 1YRLA 5JW6A 4BKOA 4WNCA 5I7FA 3R3JA 1HDRA 3OJEA 4MVJA 3TSCA 4YT4A 3NDIA 5FF9A 3WSVA 3RUCA 1MC5A 2NVBA 2DKNA 2O3SA 3MWDB 1Z82A 1GPDG 1EQUA 3GR6A 4YEDA 3FNEA 1VJ1A 1P1KA 1P1JA 2C5EA 2I76A 4ND4A 5GZ6A 4FFLA 3BTOA 4NG5A 3DOJA 1JTVA 4GGPA 3MEQA 5L4NA 4W7IA 2NU6A 3BYZA 4IIUA 1ONPA 3JQ7B 2OUIA 3F9IA 2FPGA 1PJBA 5IDQA 4DPKA 4XYMA 1T4DA 2QHXA 2BGKA 5IF3A 5L53A 2VUUA 4IJWA 1S7CA 1OC2A 2HO5A 4BS9A 1YJQA 2B4QA 3VPGA 4CLOB 4DBZA 1IZ9A 1UAGA 3GMSA 2VHVA 3FR8A 1T2CA 1K6JA 4BO5A 2J5KA 4E33A 1NHWA 4IY1A 1NWHA 2Z1MA 3ZWPA 3LC7O 4GX0A 5CDUA 3AY3A 2YY7A 1DJNA 3JQFA 4IS2A 1I3NA 3IIEA 4FFNA 4J2HA 3WFIA 1YGYA 4BNNA 1DLIA 4J43A 1IULA 2Y1FA 4RF3A 5G0VA 3ZWXA 3GK3A 1HRDA 3I52A 3ORFA 2GCGA 3UHAA 1EFKA 2B35A 3ZWOA 3S2IA 4PLFA 5KVVA 4NDNE 2Y93A 5JLAA 4E30A 4ALJA 4YAGA 2ZTMA 4L4XA 3ZU3A 2PWZA 3JQ8B 1YOVB 2PGLA 2A94A 4YT8A 3Q2IA 2C07A 2B0JA 2W2KA 1AE1A 1XIVA 3INRA 3CEAA 1WMBA 3VH3A 2YDYA 1PJ2A 5B4TA 1EUCA 2C7GA 2A4KA 2V6FA 1GPJA 4U6SA 2VZ9A 5IDYA 1EVYA 2NADA 1IHYA 1PEDA 3B1KA 4J90A 2I99A 3E82A 3WX0A 3H5AA 2PTGA 3RUDA 1HL3A 1QORA 3UCEA 4H16A 1EE9A 1HEUA 2GO1A 5B37A 5HTOA 5EINA 3GUYA 2DUWA 3M1LA 3PPIA 3KSDO 1K3TA 3NYWA 4DWVA 4MVJE 2AEJA 1SBYA 4ZQBA 5DT9A 4GSKA 1DC4A 4XEHA 5T57A 3WGYA 1QRRA 4RF4A 2EKPA 4QUKA 1K6IA 4KWHA 1QLJA 3QVSA 4E6PA 3BHMA 5L3ZA 2O48X 4XYGA 1TT7A 2EF1A 1HTBA 3VVBA 4JBHA 4DUPA 4PIVA 1NR1A 1Y7TA 1E92A 1U7TA 4RVHA 4PGFA 2R2GA 4AJIA 5TLSA 3ONDA 5AVOA 5EMHA 1DEHA 1SEPA 4NFYA 4CJXA 4XIYA 2WE7A 4PLWA 3STHA 1NXQA 1U9JA 2OMEA 5KVQA 3RJ9A 3RU7A 4D43A 3ROKA 2UYYA 2G17A 1CYDA 3PQEA 2EW2A 5A02A 3HZZA 3LT1A 3LZ6A 3KSUA 3JQ9C 4UREA 5G0TA 3WJ7A 4IBOA 4PVDA 4DTIA 1M75A 1Z7EA 2HU2A 3DBRB 4H15A 4ND5A 3U5TA 1U3UA 2PZLA 4HBGA 1AGNA 4YJFB 3IP1A 4L73A 3GLQA 4CM1A 3TN7A 1E3JA 2G1UA 3QY9A 5KVSA 1IUKA 1H9BA 3LF1A 4GKBA 4CV2A 5CEJA 1XEAA 3PYMA 4KQWA 3I4CA 3VDQA 1I5RA 4BMNA 4K26A 3U09A 2BMAA 3AJRA 2CNBA 1ZK3A 1H2HA 4Z3KA 1GV1A 1ZMTA 3AI3A 3F3SA 3I9MA 3ICCA 4NJOA 3B6ZA 3RVDA 1GZ4A 3DR3A 2NVUB 3DOCA 1VC2A 1VJTA 1BXGA 4WJZA 3NDJA 2XXBA 4RJTA 1E7RA 4RQUA 4C7JA 4EDFA 1ZEMA 1PJTA 1TA4A 4IDCA 1QP8A 1GZ6A 2JHGA 1ZK2A 3ANMA 3KB6A 3MTGA 4RLSA 5DP1A 1LLUA 3Q11A 3AUSA 4NBVA 4BO9A 4E3ZA 3HN7A 4NPCA 1YONA 2HK9A 4JGBA 5CP8A 1U5AA 2VHZA 1Y8RA 2AMFA 4YYZA 4BNZA 1E1LA 1E3SA 4AJNA 4BV8A 2VYVD 2UV8A 2GGSA 4P8RA 4GX5A 1NAHA 1OZAA 2IODA 3E48A 3FTPA 4S1VA 1WW8A 2FR1A 1KIFA 3NEPX 3V5NA 4DYDA 1NPDA 2HLPA 2VWHA 3KSZO 4E5PA 4CLOA 4MP3A 1VJ0A 1NWCA 4IQ8A 3L0DA 3K9QO 1HZZA 3ZZNA 2EWMA 2Y1DA 3PIIA 4Z0TA 5IZCA 4PRLA 3DDNA 1VM6A 3TNLA 2QW8A 3NDRA 5CFZA 1J0XO 3GDFA 4BMSA 1ADBA 1PQWA 3L4SO 4NK4A 4NZ9A 3B20A 1O89A 3O26A 1H6DA 2W8ZA 3KYBA 2DT5A 2OP1A 4W9NA 4BGEA 4IINA 2GLXA 5IXYA 3U49A 3WJAA 1B3BA 1IHXA 2Q49A 2GSDA 4ZQEA 2VWGA 2WSBA 1YDEA 5I7VA 2VYNA 3JQGB 4XQEA 2UUOA 1YDWA 4IJVA 7ADHA 3ETEA 3R0IA 2DPHA 4WLUA 4AICA 3NTQA 3ZV5A 1DHRA 1RM5A 4BKPA 4BOYA 1Y81A 1ZVMA 3PJEA 2QYTA 1XYGA 2O4CA 2J3HA 5TC4A 3QWFA 2YHUA 3AU8A 4FC7A 1MV8A 3FR7A 3PGXA 2AE1A 4BO6A 3L4BC 2PK3A 1E1KA 3KZVA 1B8VA 1YQDA 4AJ2A 3PXXA 4W6ZA 5G0SA 4N5MA 3T4EA 3WWZA 4Q3NA 2IZZA 3GG2A 1H93A 4PLPA 3NJ4A 3PJDA 2AQHA 4RLHA 2SCUA 1LDGA 3WXBA 1FDUA 3QSGA 3ZNNA 4BV9A 1LQTA 5F3RA 4J1NA 3I83A 4PG4A 1E7SA 3F4BA 3RUHA 3C7AA 4BO3A 3U62A 2NLOA 4EEXA 4IJUA 4BNWA 1BDBA 1P1IA 1U3TA 4OOFA 3N58A 3DZBA 3F6YA 1C0IA 3RROA 3SLGA 1GAEO 4IGEA 3COSA 4J49A 3S1LA 1YB1A 5MGBA 5DCWA 2JD2A 4TKMA 5A3JA 5ADHA 2BFMA 1PGPA 1SO8A 2JD1A 4B3JA 4XB1A 3LQFA 5GMOA 2QRLA 3ROQA 1F14A 2WYWA 1DOHA 2OL4A 5C7IO 2LDBA 3HHPA 4OSPA 3B1JA 4XYLA 1TEHA 1X0VA 4HADA 2OFPA 3EHEA 2O23A 2LDXA 4BGIA 4XYEA 4L74A 3OBBA 4MVJM 3I3OA 3CMCO 3LT0A 4CMJA 1MX3A 2FR8A 3CZRA 5JO9A 5KJFA 3RBXA 4YJFA 3F1LA 4P4GA 3BMNA 5I9NA 1SZJG 4ZRNA 3F5SA 1YL6A 3UGKA 2ZB7A 2GN6A 1DIGA 3DTTA 3TDKA 4M49A 3K8ZA 1ZXBA 2V6MA 1EK6A 5T64A 3VZQA 3FPLA 4TMFA 2AG8A 5TSDA 5LDHA 4I5DA 4GLOA 1KERA 1WAMA 3MOIA 1XHLA 5U1PA 4DLAA 1NBOA 5DCUA 5T67A 1P45A 1Q7GA 1RYDA 1A9YA 4K6FA 3PTZA 4UEKA 1D7OA 1ZSNA 4ZQGA 4XR4A 2GN9A 3NT5A 1HDYA 1ZSYA 3KYDB 1PWZA 4IDEA 4QO7A 4HV4A 1GU7A 2C29D 1DIRA 1W6UA 3H4VA 4BKUA 1DFGA 4ZVVA 5A5EA 2IXAA 5I7SA 2I6TA 2UVDA 3ZI0A 1XQ6A 4E2WA 4Z0HO 2OZPA 2TMGA 1Z7BA 3PYXA 4N5NA 3I6IA 3GAZA 4O6VA 4LVCA 1PZGA 3AM3A 3IJPA 4FJ0A 4RZHA 4H7PA 2W2LA 3GOHA 4UVHA 2GERA 1UAYA 1RPNA 4PLZA 3D5TA 2B36A 2DTEA 4J4TA 4E4YA 5KKCA 2DM6A 5C37A 3ETGA 3L9XA 4LMRA 5EIOA 3C1AA 3MZ0A 1PQUA 1WWKA 3EVNA 1KOLA 4HKTA 4U5QA 4WLVA 1GQ2A 2G82A 1Z75A 1I2ZA 2NVWA 1CRWG 1WXDA 1GUYA 3D3EA 1LDBA 1KVTA 4J7CA 4G5HA 4PN3A 3T7CA 2Q2VA 3JQBA 1HWYA 2FOIA 2GZ1A 5TJHA 2X0JA 1NHGA 1FMCA 5FI5A 2X9GA 4NNJA 3V1TC 4I5FA 5HBRA 1RKXA 1O9BA 3CPSA 3I6QA 4E5KA 2FN7A 4CMHA 3NRCA 1U8XX 1GEGA 1IL0A 3GC6A 4XKJA 2Q45A 1T1RA 4NJMB 3MJEA 3FBTA 1R4NB 3L6OO 3VC7A 4CMGA 1MG5A 4DC1A 4RZIA 5ENDA 1V3VA 2UAGA 4E5NA 4NH4A 2O3RA 3E5MA 4BB6A 1QYWA 4EBFA 2Q2WA 4BKRA 4BO7A 1NYTA 4R3WA 4FR5A 4ALIA 4B8WA 1P74A 3SX2A 1OMOA 1VPDA 3H2SA 2RAFA 4Q9NA 3LC2O 3ASUA 1UXJA 5CHEA 3WWYA 1XSEA 3F1KA 2HMSA 2QRKA 1HDCA 1GD1O 4WLOA 2W90A 4RPHA 4E13A 2POQX 1PJCA 1YBMA 4WCFB 1X7DA 4UVIA 2NWQA 3IMFA 1U4SA 3C85A 4PCVA 4K9DA 2Q99A 5L7WA 1KS9A 4CM4A 1E6WA 1Z74A 3RASA 4Q39A 3OETA 2GRAA 3BMCB 3DMYA 4EGFA 4AJPA 4U0KA 3ST7A 1E77A 5L40A 4ZJUA 4CM9D 1EVIA 3IP3A 1FXSA 1KC1A 3OF2A 1PJLA 2AHRA 2ZB4A 3JD0A 2CFCA 2YUTA 4AJ1A 1R15A 3WTBA 1VKNA 5BR7A 3SC6A 1G0NA 2PA3A 2X0IA 3HG7A 4AJLA 5I8WA 3QIVA 3E9MA 3KYCB 1O0SA 4RGBA 3WGQA 2QIOA 1LC0A 1GCUA 1HDOA 2DBVO 4GMFA 4E2XA 3I1JA 1PZEA 1NAIA 2VNAA 4OXKA 4YRDA 4CQMA 4CM5A 1JVBA 3ZWMA 4XDYA 4CR7A 1R4MB 1DLJA 1Z6ZA 4L8VA 4YPOA 2BD0A 1KEWA 1EUDA 3QWHA 3UKOA 3ZW9A 3GVHA 2JJYA 4Q3BA 2TMDA 2RH4A 4TVOA 1ISIA 3C24A 1L7DA 1TI7A 4PLGA 4I9HA 4YAJA 3D4NA 5JAQA 1SCUA 4KDEA 3VZPA 3H9GA 1ORRA 4FFOA 3DTYA 4ZHSA 2JFHA 2EG9A 1NTOA 4U8GA 4GPD1 1A4IA 1PJSA 1H94A 2Y67A 4OGWA 2I3GA 1ZK1A 1GUZA 1NFQA 2O2SA 4M8SA 4Q3DA 3HFGA 3BZUA 4BQRA 3PWSA 2VYVA 3O03A 4LISA 3E5RA 4IJKA 2PKRA 5AYVA 2XF8A 2JCVA 2F00A 4YCAA 5CG2A 4P38A 3H3FA 4B7UA 2FZEA 4EYEA 2CY0A 3NJ8A 4YJHA 2YV3A 2Y05A 4KZPA 3QJ5A 3EYWA 3WR5A 3KBOA 2Y1CA 4M87A 1H6CA 3WGTA 2ILTA 1MGOA 4RPLA 4GQAA 4QECA 4MIYA 2ZB8A 4TRRA 1P3DA 3ZNOA 4CUKA 4RDIA 3UH1A 2DQ4A 2DTXA 3HB5X 2C54A 3KYDA 4MVJF 5BNFA 2FP4A 3ANNA 3LVFO 2Q4EA 1ZO8A 3HUDA 2IZ0A 5C7LO 2BRUA 2VWPA 2VUTA 1FJHA 3KV3O 1I0ZA 2AQIA 4A0SA 1ZK0A 1YO6A 1PR9A 1HXHA 3RUEA 1F12A 4XZ3A 1EBUA 2FRDA 3BMQA 4PG7A 4WNIA 1X0XA 1N7GA 4Y6PA 1JAXA 1PL6A 5LCXA 4YT5A 3TJRA 3GNQA 2E49A 2FR0A 3GH3A 3PHLA 3ZV4A 4II3A 3G1UA 3FD8A 4DQXA 1HLPA 4YACA 1EBFA 1NASA 1B26A 1E5QA 2X9NA 2X22A 4AJOA 1N7HA 4DQUA 1N9GB 1NQOA 1FDWA 4GX1A 4YXFA 1XWFA 3AY7A 3GVPA 4PLYA 1SC6A 1Q2XA 3FNHA 4J2OA 4OSOA 1NFFA 3Q6IA 3A28A 1ZZEA 1PWXA 3MJ4A 5HRUA 3GMDA 4YBZA 9LDBA 2O50A 4AJEA 2VTEA 3R6DA 3CKYA 3OEYA 4FSHA 3E1KA 5JDCC 1X15A 1X7HA 1Y8QA 4BNIA 1TT5A 4DRYA 3WGGA 4UUPA 5I9LA 1R37A 3Q0EA 3AM5A 1I3MA 3MTJA 4BNVA 1IPFA 5F1KA 1F17A 2D3TA 1I3LA 4DPLA 4E31A 1PTJA 2VT2A 2OOSA 5THKA 5IDWA 1FK8A 4QFDA 4WOJA 1L7EA 3NUGA 1ULSA 5A9SA 1NQ5A 3DBVO 3DBHB 1YS4A 4R51A 4GL4A 3VH2A 3RFXA 4D45A 3MJTA 5JE8A 1LSOA 1PZFA 3OHSX 3Q3CA 4RVFA 5KNLA 4L4SA 2J3JA 1CETA 2PV7A 4BO4A 2EERA 4LRSB 2GN4A 5GZ3A 2HRZA 4HWKA 4J4HA 2JL1A 3EAGA 4YRAA 3G79A 4RVUA 1K2WA 3E18A 4YRBA 2AXQA 1GUFA 3I9NA 3DWFA 5DN9A 4BKQA 5BSGA 3WICA 1QKIA 4B4UA 4CMIB 1JN0A 1MUUA 2GPTA 3PHJA 5JDIA 4MPDA 2A35A 4RF2A 3AOEC 1DRWA 1E3EA 3OIFA 3BMCA 3I4FA 3WTCA 2BGLA 3S2GA 5HWSA 3GQVA 5KKAA 2GN8A 1YWGO 4NI5A 1JA9A 4AL4A 2BFOA 1E3LA 4DL9A 3GHHA 5CDTA 3A06A 5HS4A 4OM8A 4R1TA 5ES3A 1C1XB 2X0NA 2FPIA 1ZUD1 3DHNA 3GPIA 3AM4A 5G4LA 3KYCA 2G5CA 3VTFA 1DSSG 1N92A 2FY8A 1Q7BA 3QLJA 1DFHA 1PJ4A 2VT3A 3WS7A 1J5PA 4QFCA 4HUJA 4M1QA 2YHIB 3DBLA 4CV1A 1A71A 3D3WB 1FDTA 2PD6A 4I8XA 5TS3A 1R4MA 1V6AA 5EQFA 3WQRA 1XELA 3F47A 3LK7A 1R0KA 2X5KO 2GNAA 3VZRA 1DC5A 5TX7A 1ONOA 4R1NA 4O59O 1I8TA 4YTEA 2Y0CA 4ZRMA 1H9AA 5CPBA 2EGHA 2P9CA 3C7DB 3GA0A 1QV7A 2OXIA 1HDGO 1PGQA 5K6AA 2DAPA 2YYYA 3E8XA 3JTMA 5BT9A 5IJZA 2OP0A 3IL2A 1UP4A 1UR5A 3JSAA 3H5NA 4R68A 4B8ZA 1HLDA 1CJCA 1CEQA 4Q3EA 4CM8B 2PH3A 4IDFA 4E12A 3O4RA 4BNTA 5AXAA 4RPGA 4WLEA 4XQ9A 2DFVA 4MOWA 4ND3A 4DIOA 1X7GA 2Q1TA 1LJ8A 3CIFA 5F1OA 3I9KA 2H5LA 4OHUA 4OYRA 1LI4A 3RCBA 1EQ2A 3JQFC 3OMLA 4NU5A 4HX5A 3H3JA 4EW6A 4PFJA 2PD3A 4CLRB 1EMDA 3HDJA 4GX2A 2WEKA 1IY8A 3PLRA 3JQAB 4HNGA 1UP6A 4UUNA 5JFOA 1XCBA 4FDAA 4WECA 1UDCA 3PHIA 4E0BA 3M6IA 1YKFA 4HY3A 1IOLA 3ASVA 3G49A 3P7MA 4NK5A 4PVCA 4R54A 4UUOA 2NTNA 3PFWO 1CERA 1U2DA 3LU1A 3Q2KA 1AXGA 4J0FA 3F46A 2RBEA 1WMAA 3C3XA 3K73O 1D1SA 1PGOA 1YXMA 3WYEA 3T7EA 5CPFA 1SB9A 3BXXA 3EC7A 2I9PA 4AJKA 4BMVA 1R0SA 4KUEA 2WD7B 4BNUA 3I23A 2G76A 2P9GA 4UVGA 3FI9A 3GEDA 3ONEA 4F46A 2WWRA 5AXBA 5A3VA 4MDHA 4NQZA 3P19A 2VRCD 1E3WB 4MVJP 4I5EA 2GF2A 1QR6A 3SLKA 1LEHA 5ILOA 3FNGA 3AUTA 4BIIA 5TIIA 4GMGA 3WNQA 4GI2A 4CV0A 3KXDA 3BA1A 4FJ1A 3EZYA 3ICPA 1I33A 1I24A 3WIDA 1B16A 1U1IA 3O8QB 1HYHA 1VSUA 5I9MA 4BVAA 5JAZA 4YJGB 4Z9XA 1BDMA 2YV1A 2VHYA 2R00A 3B1FA 4QEDA 2HUNA 2D5AA 3WLFA 5IDXA 4ZA2A 1ZJYA 5TT0A 1H6AA 4CMKA
chains in the Genus database with same CATH superfamily
4YRJA 1YH3A 5BNIA 1U2TA 4ER7A 2JGFA 4PCAA 3PUKA 1SWWA 4LQLA 1XKLA 2V7GA 2I62A 2QT0A 2P9YA 4RFSB 4CLXA 3O75A 2QVCA 3L41A 4N82A 2AJ8A 5CURA 5SYAA 1XE3A 2PN1A 5I7RA 2EP5A 3QOFA 1F0PA 1Q12A 5IVKA 4TYPA 3DXYA 1M6NA 3ODGA 2GMWA 2VTVA 4CZ2A 4CIWA 1XAJA 1U7ZA 3ESYA 4KK3A 3QFTA 4L4RA 2PJUA 4Y2QA 5IFKA 4BC0A 1XR3A 4D74A 2VQEB 3O8OA 4U7PB 5CIWA 1GR1A 4HWGA 3G2KA 4LBZA 4O4LA 2RK6A 4ZHQB 5A7FA 5FWNA 2QR5A 3EGDB 4INJA 1TM1E 2HA7A 3ENVA 4OREX 5IT4A 4KX3A 4EJMA 6REQA 4TRJA 4MJLA 1JG7A 2PFSA 2QW0X 2PUWA 2PZEA 1CQJB 1IXRC 2EXXA 3DS8A 4GI7A 2X6RA 1JG3A 1KFJB 3ZWQA 5IXSA 4QUHA 1J8MF 3KETA 1BWRA 3TW4A 2BBOA 4B1FA 2GEJA 2REBA 2ADFA 3D7NA 1QIHA 2C0CA 2GAJA 3BGIA 3GNLA 3I76A 4EKNB 5BSEA 3AI1A 1QFZA 1EFVA 1P4HA 3WV4A 2QJTA 2Q4DA 3AKCA 1TLTA 3PQFA 3KL4A 3DGFC 1YULA 4BGVA 3A1CA 3C3DA 3VU1A 2BUAA 3K20A 3FYUA 3NBZC 4BXOB 2ZI5A 5HRCA 4TVSA 1EWQA 5AHXA 3M5CA 3SJBA 4UARA 3KG2A 5BSVA 1SFRA 1R0RE 3U3ZA 2DLCX 4FWBA 3O31A 3RYHB 1FSSA 5DVZA 1B8PA 1UJCA 2BFNA 4IH1A 1UXKA 2JRLA 4FFBB 5IN4A 3SIPA 2JCGA 1RVDA 3T15A 3D7MA 2YWDA 3DFMA 5H80A 2IV3A 3O4JA 4Z4QA 3N8NA 3FPHA 2QN9A 1BXKA 3OC6A 1MB3A 3BBPA 3QEAZ 1XL1A 4TWBA 3ZGNA 3L8MA 2C4NA 3ECAA 2XTAA 5DNAA 4D9FA 4RAOA 1Z68A 2XY4A 1A8QA 4MVJH 3I28A 5J40A 1IVSA 4Z4EA 1GYQA 3RG8A 3RR2A 5JSZB 1A1VA 4MQ5A 5JS2A 1Q0PA 4JIMA 4D46A 2BF4A 4JAVC 2RB4A 2AN5A 1YCDA 4OEHA 4GS5A 4BAUA 4GXQA 5IH3A 3E3OA 1XZBA 4URUR 1BHSA 2WAMA 3QE3A 4NTZA 2IDKA 3K5WA 1AH2A 3JCZA 3VHXB 1R5JA 3X1DA 1E2IA 4BMXA 1XAHA 2R97A 1GSAA 1N0HA 1X8XA 3LYAA 8LDHA 4V0NA 4YPVA 1F7VA 3SKVA 1A5AB 5IBQA 1UQUA 3V9PA 1KIAA 4E5MA 3AR7A 3V4RA 1M2VB 1VE1A 5KJ1A 2JFBA 2WY2D 4OLAA 3CZ4A 5TJ9A 2EJUA 2OXEA 2IYQA 4PFQA 2ROQA 4TS9A 5SYNA 4DIDA 4YJ3A 1ZI6A 5D1HA 5L6MB 4ZAVA 3R9XA 3EJWA 5J3JA 1OKKA 4W5WA 1G2IA 1WM1A 4CQLB 1HF3A 4E7PA 1KVRA 2WTMA 3Q7QA 3KFXA 2V9CA 4IICA 4MV1A 4F45A 4PLTA 4AG3A 4F4IA 1A69A 4JUCA 3MSXA 4JJEA 4BCCA 1E9BA 1EE2A 3K1JA 3OZFA 4PZDA 2WVGA 6LDHA 2P41A 3G2LA 3DHEA 4DBLE 4ZT3A 1L3BA 1QTRA 5FUXA 2IYPA 2CDRA 4Q9HA 1WQ1R 3HXTA 3EZ7A 4O3MA 1M1NB 4YQFA 3EPPA 1HLGA 2BI4A 4IX9A 4W9NC 3DZFA 3ITKA 5C2JB 3IQDB 3FGPA 5LZ2A 1NU8A 4QBTA 3DZ8A 3NU1A 3P0IA 5FBHA 5ENVA 2Z3ZA 1ZUNB 3R5XA 3INYA 2YWEA 3QKRB 4ZCLA 1G5RA 1Z22A 4KAXA 1P7VA 3RYCA 2I3BA 3E0QA 2ARKA 1AKEA 1I7NA 1LNSA 2QTFA 3FYUC 4UBNA 4EG7A 1VL8A 2QA5A 3HDYA 1KP2A 1FUYB 1Z8FA 3L6BA 4JBNA 1ZNQO 5EZYA 1QGUA 1ITZA 1A2QA 1YNOA 5K0BA 1RTKA 1TD1A 1WDKA 2JHFA 4FNOA 1SC9A 3M6XA 3OE1A 4HFRA 4QX6A 5CYOA 4OQFA 4QRIA 7MHTA 1DBQA 1XDSA 3KKZA 1NF2A 1SMKA 2WF8A 3CTMA 3AEYA 3EVAA 4C7MA 3H2JA 2BTQA 2PRSA 2PR7A 2Q5HA 4L78A 1WD7A 4MWGA 2F1IA 2O8DA 2WHQA 4HTFB 4RHFA 4TXHA 5G2OA 3DQPA 3NORA 5K3BA 2WKSA 4P22A 3TDMA 1KXJA 4N3CA 5EC8A 4XJXA 2ONJA 1WKBA 1JSCA 1WDWB 1GDTA 1XLTA 1AZTA 2BFEB 4NBWA 5E2AA 3JD2A 4BZPA 3K96A 1Q15A 2H4ZA 4I55F 2NU8B 1PHRA 2FQWA 4XUDA 2ZSAA 3O1LA 5L4LA 2A9VA 3RFVA 4FHCA 3EQZA 4BC1A 2IS1A 2YASA 2RGDA 2Z5VA 1SRQA 3KTFA 5KYUA 3UWKA 1U6JA 4MRVA 1HI9A 1NW9B 1BRMA 3ORRA 3R0JA 3KQOA 3RODA 3TUIC 4DPMA 5EWMA 2G4LA 2E48A 4BWYA 3I2IA 4FT2A 4GVXA 1LPSA 4KGDA 3MD0A 3LM8A 1G7SA 2O8VA 1T9DA 3AR2A 3JYPA 4YA6A 5JO0A 6ADHA 1T3TA 1IAVA 4XQGA 1KYXA 1WXGA 2FSSA 3E2MA 3KSRA 1I51A 1Z6GA 3EVTA 4XLZA 1JA0A 1Q95A 1HX7A 3W2IA 2LE0A 1RKVA 1JVSA 3G0GA 5FWDA 4PGHA 1N2GA 1E1CA 1U7OA 16PKA 2IBSA 3CLTC 3LUCA 1U65A 3P5BA 3PQDA 4IXTA 3CWCA 4UE6A 3TLZA 2VOJA 5G1PA 1BJTA 3U44A 2XQFA 3A1DA 1R3UA 2O0KA 3GBVA 3GFBA 3NPAA 3IIMA 3I5MA 3ME5A 4YVFA 3SPXA 3HVRA 1I2DA 1H0RA 2RHGB 4U4AA 1JHXA 3WYCA 5AIBA 1MFPA 4YAKA 2PM8A 3V34A 2VF2A 4AN4A 4BUCA 2OFOA 1FFDA 3NNNA 5CA1A 4LXYA 5B3LA 4DGSA 3WGIA 5DNVA 3RF6A 4NWIA 1TAGA 5HMLA 3LQYA 3HKEB 3DQQA 3OBIA 2AWOA 5H16A 1MU0A 5TVKA 5AVYA 4LJ6A 4M9XA 2AFHE 2VHEA 1RYNA 5EXEA 4EB8A 4B3FX 3HXOA 1OIWA 2GHIA 2QTGA 2G9VA 1Q0LA 3F6PA 1EA7A 2ZAYA 4XYBA 4KWEA 5MGNA 1KJJA 3OEHA 1XPRA 5HJ7A 2YINC 1J06A 1NDHA 2OK8A 3DE7X 3KFVA 5EJ2A 5H81A 5AW0A 3EVEA 3JAWB 4YLYA 4M55A 5JAIA 1P5RA 1QHEA 4QQNA 5DGXA 2FJUA 4R41A 3BB1A 5DULA 4R8LA 3VDMA 5KVCA 1X9HA 3K9GA 3TNDA 4Z5XA 1ZITA 4Y6QA 4P4UA 4TV9A 4WXEA 2OXFA 4TMXA 2ALJA 3WNBA 1Z7YA 3L7JA 4K9RA 2BTOA 4K6CA 4OAQA 4TM7A 1EJBA 3ZE0B 1CEYA 1AOXA 3AI2A 4WGGA 1O94D 4IHJA 3W6ZA 4B35A 4CUJA 1TFRA 3V7NA 1QJCA 5BRJA 5LSAA 4CMAA 1PN3A 4POOA 4DIEA 2GD2A 2JATA 5AH0A 3JQGA 3IBYA 3JD4A 4GOMD 4F3YA 2RDMA 1JEYB 4KUHA 2ONKA 5JZOA 1XLTC 4PYKA 1V9LA 3OLXA 1RXCA 1L4YA 2ZKIA 5DBGA 3ZPXA 2EJCA 1XU7A 1GG9A 2D7DA 1D1PA 5BNWA 1VYTA 1BVUA 4KAFA 1W4LA 3DO6A 3EMBA 5KOJA 4ND8A 1M76A 4D02A 4PIMA 1NPYA 1O97D 1XO1A 1Y5RA 1VCNA 2X8LA 3JR7A 2VJBA 3JD3A 4FGKA 4ZOEA 1XZKA 2DJ5A 3L7KA 3I32A 2V7XA 4RIIA 2G5GX 4YXWA 3RBVA 2GOYA 1TMYA 4IMRA 5FNVB 1Y6FA 3KB2A 3EMKA 1P2UA 5AUNB 3EEBA 3GRVA 4ETIA 5K0FA 5KVAA 3RHZA 5LP6B 1LUAA 2AK2A 1LBHA 4JL8A 4BQFA 1ZA1A 3GEEA 2YVAA 5A9TA 4QWWA 3DT8A 3L0YA 1Z5UA 3K0AA 3W05A 5BVHA 3ZJ4A 3W9UA 2FOLA 3G2HA 3HXLA 1JKXA 1VE9A 4FC6A 4Y6LA 3DZKA 2B8WA 2CB9A 3GLHA 1IQRA 1YJ8A 2J6IA 4MS1B 2WAAA 2WT8A 3I3SR 4P7JA 1OZ0A 4X44A 5FTKA 5AW3A 3KCQA 2WDZA 4GZ6A 3ADPA 2ZRQA 3NBAA 4KQ6A 4LRTB 2QTLA 3G85A 1Z36A 1XAGA 1HFEL 2O07A 4I2NA 4JN6B 4QT0A 2QMHA 4WNYA 3SQWA 4CODB 1L7MA 3R7WA 2MSKA 3KKPA 5AW2A 1H3NA 4LHXA 2X5XA 2MOKA 1I1QB 4A6DA 4DJFC 1UQRA 3MT9A 1T24A 2Z4TA 1C2YA 2VNKA 2CYAA 4UTVA 2R86A 5TF4A 3WSTA 3B38A 1Z88A 3JZIA 3WWDA 3UMJA 4MA5A 5TGDA 1ZNYA 5C5DA 1BQEA 1VIYA 3D6TB 3KDAA 2FSGA 4H3VA 2DBYA 4A0GA 2UZAA 4D0NA 1XD2A 2DPGA 3BD9A 2ENUA 2IZ1A 3TFOA 2GVZC 2TMKA 1E1YA 2VJKA 4FI3F 4J4BA 4TROA 3V7YA 5JCJD 2A0WA 2QF7A 4FYYA 2P5YA 1VP9A 4RPKA 5LB4A 1VSVA 1VPVA 1ZINA 2GK4A 2JBHA 2GEFA 1KI4A 3DHYA 1Y6JA 3IP8A 3DF9A 4AF7A 5BR1A 3DZJA 4ZEMA 1L1RA 2BDUA 2I8LA 5IFLA 1D6JA 4IHQA 4PC3A 5ITZA 2DUJA 2XXJA 2JLXA 3BCUA 4KW7A 4NBNA 1BTOA 2AS0A 1GQYA 4JCOA 4AK9A 2YX1A 2L0XA 3QP9A 3EWIA 3H1TA 3TDNA 3IQEA 3TLEA 3OM8A 1UK9A 3GF4A 3FCEA 5KOHA 5JD6A 4KI0A 5BYAA 1UWCA 2XMQA 3VNQA 1B00A 1WU7A 2BFCB 2NTVA 1LCIA 2VRWA 1KFCB 3RC7A 4PLCA 4Z7JA 4F9EA 2AKEA 3CS3A 1E62A 4F12A 3THWB 4MPTA 1OZHA 3DW3X 1NW8A 3AEQA 3QEMB 3KZCA 4KXNA 4LFCB 2FZKA 4NOKA 5HK8A 3VTAA 4URWR 3M4JA 3VKUA 5BV2P 5LQKA 1N2OA 1ZPDA 2QAGA 1C0KA 4HLNA 1SVNA 3GFSA 4G1FA 4JQYA 2J5RA 4NDZA 1NQUA 4NZZA 1MNQA 5IASA 2F7SA 4EFLA 3SJAA 3PT5A 3QBVA 1S2OA 1SWVA 5F7JA 4CU2A 3FCYA 4GRAA 3CSUA 4IP0A 4KTTE 4V03A 4DQ0A 2HDHA 3UHPA 1RD4A 4FZ5A 3SG0A 1F2TB 3VR2A 2NNWB 2VDMB 3MNFA 2R6ZA 4RSHA 4BFYA 3BXFA 4TYYA 4G8JA 3Q3JB 2C2ZA 2SECE 1TDJA 3G1TA 3NBFA 2AW5A 4G9BA 4OQEA 3UGJA 1RWXA 3ZKAA 1Y6GA 3ENZA 2HL6A 3DTVB 4IR7A 1KY4A 1NXWA 5HJ2A 5ALTA 2C96A 2OO7A 4UCXA 5JCOA 5K99A 5LQUA 4ZOBA 2GBCA 5KIAA 5DIZA 3IMCA 4PBRA 2CE7A 2VEOA 5CH8A 1BXZA 2RGWA 2WWFA 4CN8A 1K89A 1MA0A 5H4HA 3UCFA 2RGBA 4OIFA 1PQ4A 4ZC8A 3UUFA 4R9SA 2WWVD 4L28A 2G9NA 1Q7TA 4KWIA 4EPTA 4F7WA 3ZHSA 2NPIA 1XZAA 2QTBA 2FZCA 2ZSUA 1A8SA 1RTTA 5LLTA 3CPHA 4DR5B 4JLOA 1E2UA 1E4EB 1LVHA 1JWAB 4I7EA 4FCCA 4Q4JA 5KWEA 5KJCA 4V1CI 4GRIA 3FPEA 4HSEA 4F2DA 2PXAA 2RHOA 2E4XA 4L8YA 1CE8A 2C59A 5T8KA 3GLFE 1A96A 2BCEA 3UMVA 1U02A 2ERCA 3HKBB 2AZDA 5TEVA 4REOA 2R6JA 2HXSA 3U1BA 4TWJA 1LS1A 4US0R 3WSWA 1LW7A 3IPRA 3CZPA 5AKHA 3E8SA 1ADFA 4A5OA 5FPPA 4ASUD 1L6RA 4QTXA 2DCUA 4MVXA 3AV3A 3QH4A 2UVPA 3WOVA 3DEIA 1R4NA 4LNAA 4W8HA 5IBPA 5H68A 3MUOA 1AHIA 4P3KA 3I9JA 5G1NA 3ZXIA 1JEEA 1KHHA 1N6PA 4DCTA 2AUMA 4OXIA 1N1EA 1WLSA 5DYIA 4UM8B 1HQYE 3NXKA 1O6ZA 2G1AA 2OBBA 1CW2B 3SHWA 3TPCA 3EYAA 3IAAA 1NI4B 2HLDA 1SQ5A 1IN6A 1Y8RB 3IUQA 2QAGC 2AFIA 2FPKA 1GQQA 2EFCB 3WKDA 2IYYA 4ITUA 3RAEC 4ZODA 4PONA 5I01A 1OH7A 4RZQA 1J8YF 4BLQA 4M88A 1Y9AA 2HQ1A 2MR5A 3MTEA 4KZKA 3RNOA 4AY3A 2WBLC 4DGQA 3HU2A 4JI0B 3GZTB 2H54A 3T35A 3LJKA 5J1SB 4EA8A 4XWTA 3DE6X 2Z2YA 5LZ8A 2OA0A 3COJA 4WLFA 1KDZA 1SCIA 2VQ3A 4IG9A 5A5FA 4CI9A 1C5KA 4X8HA 1D2MA 4G0QA 4I81A 4M21A 5AJTA 4DM4A 1GA1A 2PYZA 3FH0A 2DWQA 4CG2A 4HVCA 2ZREA 3IKJA 2LZ0A 2QU7A 4NCKA 3DULA 5F2NA 3ZE6A 3KVOA 2IZ7A 4A7PA 4OXNA 3LTNC 1QZXA 2DH6A 1K0FA 3VO8A 3EC1A 2CLEB 2W98A 3DXZA 3E03A 4IFIA 3LLVA 3JS5A 5JJCA 5LYJB 1CS0B 2BBTA 3IX7A 3IEUA 2CMFA 2EC5A 3RTBA 3S5JA 1FRVA 2DLDA 3KTDA 2GDJA 4EOGA 1CVRA 5CR9A 1CQWA 4QASA 5C1IA 1W0KA 5FKJA 1B0PA 3L0CA 4DV2B 4TZKA 4UHBA 3WIEA 3HQ4O 3I4LA 1XCGB 3HXQA 4MQLA 4ENRA 3TSYA 2PUJA 1N1GA 4KE8A 2H5EA 4P86A 1W44A 2IV2X 2W2LD 4QOIA 2Y68A 4IIHA 1P61B 2O7VA 5TNXA 3C3KA 3OQ6A 1Y7HA 4HAIA 3MBOA 4JLNA 2A57A 4XE5A 1ZMBA 2O4UX 5E95A 2VP6A 1G5PA 2BKAA 3F5DA 5T8KC 3WLSA 1XZCA 4B17A 2G63A 4BMZA 4X1OA 1ODIA 1YK0A 1FYWA 4TTRA 2GCEA 1T3ZA 1I5OA 2JANA 3KALA 2XBMA 2C4KA 3GAAA 2PR2A 2Z9BA 4RY0A 3QBTA 1HT0A 1OC4A 1U81A 3AUKA 4O2AB 5EG5A 4CEJA 3AEKA 3DOIA 4MLZA 5K09A 1Z5ZA 2VYCA 3DAOA 3GWZA 3O0TA 3O0DA 4X97A 2M32A 4BTEA 4YGYA 4OHBA 2CXSA 4QOJA 2Q3JA 1BU8A 3SBOA 2F8TA 5TR9A 1KAEA 4I9FA 5HOQA 4C20A 2H1RA 4J91A 2R751 1U5CA 3WIUA 1UC4B 2EV9A 1KHTA 4X6XA 4HB3A 3T0IA 5KDOA 3Q9NA 2FW8A 2OQ2A 5EWJA 4XCQA 3I9V1 3JXEA 2SCUB 2V7QA 5SY9A 4JMLA 3SD7A 1EU1A 5ECYA 5GVRA 4AYWA 4C4AA 4F9TA 4YRGA 5LUAA 1A7JA 3D4IA 3S81A 2IS2A 4DHEA 3PWZA 1AZWA 4ME6A 1EZ1A 4CMCA 4TUYF 4EA9A 4MJ3A 3Q8KA 4QM6A 4ALNA 1YB5A 3FKJA 3LBFA 2J45A 3KE9A 1L5NA 2GFIA 3CT4A 4YALA 1DOZA 4DLLA 2J6CA 5SY6A 4BBAA 3OLQA 2FPUA 2C8VA 1I1OA 1E9EA 2FSVA 2PBZA 2Z6AA 3RSZA 2V59A 1JKIA 1BN7A 2B7CA 2QZ9A 4FGJA 2EP7A 1KI6A 3IVGA 1UPXA 1VSBA 4NMLA 5JDIC 1I2AA 1QYDA 4G9EA 4ND1A 3RI3A 3EODA 5JCXA 2AI3A 3RQSA 3UUGA 1VJCA 1QHSA 2RHCA 1XCLA 4D80A 2DWCA 1J9ZA 1L4NA 2IT1A 3R3ZA 5DHSA 4DIUA 5B1EA 3AETB 1YS1X 3BTSA 1XZEA 2W37A 5JJIA 2A9KA 1BHQ1 3KTAA 4TYQA 3RAJA 2NZVG 3GL9A 4K1XA 1ZRMA 1P2TA 1QH8B 2VRNA 4BRWA 3PQ2A 1Z3CA 2ZETA 1QC5B 5BV8A 4I6GA 3LY8A 4DIBA 1BC5A 3T7KA 4E21A 3W5AA 2QQGA 4A8TA 1C7FA 3ED1A 1SUFA 2PXXA 2FXVA 4L2IB 2W0MA 4DR7B 3EVGA 5C3MA 2FPPA 4ESHA 1OCEA 4B8YA 4D3YA 2FHSA 2GTIA 2YFQA 4GM1A 3FYDA 1LD3A 2I2DA 5BSWA 4M1WA 1HA3A 4JUIA 2GXUA 2P4HX 1WL8A 3Q10A 1PZNA 4HLUC 4X93A 3N2GB 2A9OA 4EI2A 4HMPA 3LZCA 2MYNA 1JZTA 1TO2E 1QS0A 5DGIA 3HM9A 4R01A 1Z56C 1J09A 2E37A 3SYKA 2PFKA 2PKWA 2YIMA 4NE2A 5IXJA 1KEKA 2QOEA 3T38A 1SQ6A 3HY4A 5LMUB 1ULBA 1BJKA 3OM1A 2WTBA 4P0QB 4TWZA 2CZGA 1GPWB 3VVMA 2CDBA 1NMSA 3KOUA 1WZEA 4NENB 2ETVA 3HBLA 3C5WP 4ZVLA 1V0JA 1G1AA 1U1GA 2GNOA 2XTMA 3H7AA 2JCBA 1MXFA 3B9QA 3MGCA 3PSHA 5CG1A 2IH2A 3ZV3A 1ZHHA 3CONA 3EH1A 1IC6A 3GLSA 3MM4A 3LIIA 4MQBA 4C7KA 2CV1A 2EKDA 3RC8A 1YQQA 3IAS6 4KIGA 2J3MA 3VC3A 1YKGA 5LUBA 4CM9A 2C3UA 4PZEA 3IEVA 1U2ZA 2W4MA 4L5CA 4MB6A 4Q02A 2CJFA 2EOAA 2ZVJA 3I5UA 4IVQA 2PHZA 3TZBA 4RHEA 3ETHA 3D5QA 3NHAA 1ZH6A 3G5UA 3M7IA 1EP2B 5HG0A 1JT2A 3VYSB 3I37X 2N42A 4DLUA 2EQ5A 3WZ2A 2VXBA 1AS0A 1M0TA 1ZICA 1P73A 2I87A 2QLNA 4HXYA 5F3WB 3JRNA 1TIKA 2WNIA 1ZD9A 1V2GA 3EMVA 3R5SA 4RWZA 3ZOKA 3MWGA 1IZ7A 1XVTA 3OJFA 4U7WA 2HJHA 4GAEA 1JHAA 1XTTA 3B2EA 3QJGA 2CHGA 3CNOA 2CLKB 5KAPA 1OFGA 3IV9A 4D9IA 3DVLA 1F48A 1HR0B 2DBQA 5FYDA 1ZM9A 3AU9A 1G0OA 4RJJA 3DZIA 1Y9DA 5BV7A 1U2SA 3PC6A 5JNSA 1PEAA 5JS6A 3EY9A 3PITA 3P9RA 5H70A 4E09A 3K0KA 5DNWA 4LVNA 3GP5A 4MUNA 3AL0C 4V0KA 1MX1A 1RHJA 2ZEJA 3A36A 3QF7A 1ZJZA 2COKA 1RYZA 2WYOA 1OI4A 4RCZA 1WUIS 4W1SA 1EVEA 4MB2A 4E2FA 3LVRE 3NP9A 1LV7A 3T99A 1J2EA 3DAHA 3P2IA 1UBSB 1WXWA 4AMBA 3VGPA 4F6LA 3PNMA 3BRQA 4PZUA 4TLDA 1XNQB 4ZEWA 2J9ZB 4R5MA 5CDFE 4JQCA 1N5MA 1N3BA 1ZIXA 5A62A 2UUPA 1ESCA 4YNBA 3AIMA 2AEMA 1C1XA 1YR6A 3FPJA 1C3VA 1ZEJA 4I5IA 1FX0B 2QV7A 4Q4AB 1A8IA 1JH9A 2P1ZA 4B85A 3PNBA 4PBTA 4RADA 4A26A 4S12A 4U9HS 4X65B 4OQZA 4WKOA 3ETCA 4HFMA 2ZBPA 3AESA 3U6BA 1MHPA 5E2BA 5FP0A 3BIFA 4MS3B 3A9SA 5BQFA 2WJYA 5FQOA 5JSUA 2O19A 3EB9A 2GF0A 3LG2A 5TQ2B 1SXJD 3TH5A 4C6RA 4KPUA 1P6QA 3BXOA 5ENZA 1PJZA 3K5PA 5EJ8A 1CHDA 2W7TA 1UMCB 3PRYA 1V35A 2JW5A 4UTXA 3KUXA 4ARUA 1RZRD 4N9WA 1KBOA 4HQFA 3WGKA 3CG4A 1KEUA 1JHQA 1W75A 3E6AA 1Z73A 4GSLA 1GZ3A 4P3NA 4PHGA 3ROPA 3WYFA 3ZXUB 2GESA 3UK7A 4EYGA 2HK7A 4AFNA 3ODPA 5CVDA 4YAEA 1WEHA 3QVXA 4QOGA 1QHXA 2PKQO 3HV0A 2QI9F 4AS2A 3OIVA 2M1XA 4MR7B 2OD9A 1BX3A 1FMLA 3UM9A 4A73A 1QIMA 1X7YB 3ZVRA 4PAOA 4QGHA 4C0QC 3GROA 4BQOA 3PLAE 4EUKA 3NBMA 5ETJA 4GF5A 1UBLS 4RZSA 1VRWA 1UINA 1ZISA 3JZMA 5JSKA 3VNVA 4ICIA 4X84A 3RC9A 3VXKA 4ZCMA 3CHYA 2V74B 3WYNA 1WXIA 2R5NA 3UC9A 1JHYA 1SNYA 1MB0A 3C7TA 1TU3A 3LDAA 4PPQA 4B71A 1Q21A 4B40A 2Q1UA 3HU3A 2ZSDA 4DLNA 3V33A 3PD1A 1OI2A 1ZMXA 4LJLA 2Q2OA 4Q37A 4UBKA 1EVJA 1LNQA 4G4SO 4Q6BA 2HSWA 5ALYA 5EZQA 2GYYA 1K6EA 1UZMA 4LI3X 3U4HA 4BQEA 2P5UA 4AT1A 2BHLA 2XAAA 4HVLA 2XB4A 5F21A 3TWOA 3NC4A 4G1VA 5FXMA 1WZ2A 1FDIA 1A8PA 3HK2A 4DWOA 2OFXA 2V96A 1T4BA 3B85A 1NUUA 3UJ8A 4PYLA 1PSWA 2Z2XA 1ML3A 4E2YA 4UBIA 5EAIA 4D8TA 4GQBA 4B6PA 2Z2IA 4FJ2A 3WNVA 4YWJA 1EUDB 2GD6A 1P0FA 3ABQB 4HQNA 2QQ5A 3A05A 1VFNA 1FFHA 4FBMA 3R41A 1I6LA 2KS6A 3JR3A 3TQSA 1OFUX 1Z2NX 2CXOA 3KLPX 3VSAA 1UBRS 2IKQA 3M1YA 4J2TA 2TECE 5DYWA 5IW8A 1PJQA 3TTUA 3UJCA 3ZWBA 4AAYA 4IL5A 2ID7A 3PA8A 4DVJA 1CJUC 1R0XA 1DRJA 2HBQA 4HGQA 4N0PA 1AN9A 3W4JA 2JIRA 4OL9A 2JLAA 1D4OA 4MVWA 5KTMA 3K8OE 2FMUA 1YDMA 3IIKA 4QEKA 5LOVA 1D2CA 2CJPA 2I2BA 2BIFA 5KSWB 1TYBE 3ESAA 4F91B 2DBRA 2Y8EA 3FHCB 4NRDA 4KIWA 4CE6A 1MB4A 2OV8A 1ZZGA 5B7GA 4ZIRB 1VG0B 5B30A 2C42A 4D3DA 3O3NB 5HCIA 2DUMA 2WAOA 2XR1A 1AM4D 3CLVA 4IGKA 1T6NA 3QE2A 4JYBA 1DDOA 2O9JA 1NOJA 2HCTA 2PV0A 3HSSA 4HEA1 3RRFA 4YJGA 4XGIA 3VH4A 3B53X 3WQSB 3VAZA 1BGVA 1H0KA 1O96A 2LWIA 5CT9A 1FLVA 3HL4A 3IUMA 3THYB 3I09A 2RK3A 1Q44A 5U4XA 4UMEA 2C8KA 4OXYA 1XCOA 2CD7A 2CVPA 2Q62A 4U63A 1GDHA 3E3NA 4IKPA 4HXFB 3JAWA 4I1VA 4A0QA 5HQ3B 3PKZA 5JAUA 3Q8XB 5K0LA 4GGOA 1E6UA 2ZSKA 2IS6A 5EERA 2G06A 3WMXA 1KYZA 1BIFA 1LPAB 3ZY6A 4RFSA 2JVJA 1UJ4A 2C88A 4G9GA 4EHKA 3EG9A 1PNTA 2QVLA 2VPXA 2BSAA 1CR0A 1CY4A 2WVAA 3TM5A 5AVZA 2BMEA 3A9WA 4IIBA 3GEIA 3QYFA 1EEHA 4MKXA 4JBXA 4KCGA 3V46A 5A2GA 5A4DA 1OOEA 3HXKA 4J07A 5LR6A 3A3NA 4BE4A 4GP6A 3H9UA 5KTYA 1XTZA 5A05A 3SICE 3JAMA 1Z8DA 5JC1A 5ELMA 2ZI7A 3QE9Y 1NXXA 2CSUA 1P9OA 5FT9A 4IH9A 3OCZA 2JZCA 4HYTA 2Q21A 1W85B 3KAPA 4WX2B 1E5LA 1SXJB 1LLCA 1LPPA 3VYRB 1NVKA 4WINA 3A37A 2PT5A 3OZXA 3I58A 5G40A 2RGYA 3OSUA 1CQJA 1X1CA 2GH1A 2BM0A 3KD2A 1GVHA 1YZQA 4M0EA 4WXRA 1QO9A 2AH5A 5DB4A 1NF8A 2GD1O 4RKQA 4M54A 5DLDA 2QRHA 3OJWA 3FDFA 5EJ6A 1C3XA 2XYVA 3M2TA 3MUFA 2I66A 2FN8A 2VP9A 4HOYA 2JAXA 2OWDA 1MTOA 2OBFA 2WYVA 4RPCA 3K30A 4FEEA 5ALWA 4MIOA 5HJEA 1R88A 3NX4A 4D3ZA 4F5DA 3QU7A 5HK9A 2Q2NA 3UKJA 4TS3A 4BXOA 4DLVA 3SM3A 3TOZA 4C4SA 2QTVB 2H6EA 1CT9A 2B1GA 2W6PA 1Z2EA 4YRCA 1F1JA 4J0EA 1G41A 2ZWAA 3GFTA 5F76A 2JS7A 3V7FA 4JP1A 3CB4A 2F1HA 4QNRA 5JATA 3D8HA 3O4FA 2FGKA 3RYHA 4HGYA 3ROEA 4BCDA 4I8DA 4CF7A 1IBMB 3AZQA 1JNXX 1GKUB 3EPRA 3KP1A 4KMRA 3TIFA 3G5TA 1RQ7A 1X1TA 5F1YA 3SSNA 5JJ5A 4S0XA 1M2HA 1TT5B 1W19A 3DYIA 1TEZA 1GZ5A 4XCVA 3B13B 1M6WA 3N0TA 3WI7A 2WF9A 3LCUA 4A0FA 5L4SA 4NEQA 3OFSA 3WQBA 5JSZA 5KDLA 4DEXA 4JLBA 4B7ZA 1IXYA 3A4IA 1MB2A 3WJ2A 4KFCA 2CXUA 2H2AA 1Q7CA 3L6EA 3TF5A 3N8IA 2J32A 3LI2A 5ABPA 3YASA 1NMXA 1SUPA 1NOKA 1N36B 3VHXA 5D5QA 4J9UE 5EE3A 4JIGA 2GBFA 3FLAA 4JBYA 3SC3A 3IE0A 3OQOA 4G67A 3WLOA 1GR0A 1WULS 4MYDA 3HFSA 4E51A 1PFWA 1ADGA 2JDIA 2Q5JA 3EGEA 3TTWA 1V1MB 5JMTA 1DE0A 4GVPA 1ACMA 1M2VA 1AKNA 3VMMA 4D3FA 3ND6A 4WY5A 4KLCA 4BRSA 1Z0DA 4Q3CA 1QFMA 1V7QA 1T8YA 5L8VA 2RARA 1A97A 2O3QA 3K1ZA 2J9FB 3EBPA 2ZIGA 1C4XA 1NC3A 2VDRB 1WVGA 4CQLA 3EF0A 5LQMA 1MHTA 3ZEAA 1CZNA 1SB8A 2KMLA 4KPYA 3W8DA 2ADMA 1WQ3A 2P2CA 1YMVA 3JQPA 4H7FA 3OTQA 1F60A 3S8YA 2ORED 4EKIA 3BFXA 4Y7CA 1I94B 4G5RA 3GLUA 4Y2YA 3ZGOA 3GPBA 4PGMA 1I2CA 3IAXA 5E2IA 1M1NA 4KO4S 4BNMA 1ZOIA 1RJFA 2QN1A 2WJPA 3N87A 1XTUA 2O2GA 3ON5A 1E20A 3AVQA 1K7FB 1B0ZA 1BOOA 1SXHA 4ZP1A 1YQ9A 2X9LA 3NGXA 4UMVA 1ISFA 1M34E 4KO3S 1ZONA 1RLMA 5CHYA 3WGJA 1ZUNA 1Q91A 3S1AB 3QKRA 4CTNA 4I2VA 1BSVA 4MH0R 1RS0A 1HLFA 4BEVA 3DBLB 2TYSB 3KUKA 1EKXA 1FVXA 2GZ2A 2XVXA 1H2RS 4IXMA 5IARA 5E9QA 3LKZA 3WRXC 3QVUA 5C4IA 4PIPA 2YN2A 1X70A 3M82A 4HAVA 2WIKA 4EUFA 5KYKA 2O0LA 1NVVQ 4IILA 1A7UA 4AKTA 1EGMB 1FP1D 2I03A 3LL7A 4N3NA 2R66A 3KZXA 3RVJA 4W5QA 1XRPA 4M38A 3Q5DA 3TLMA 4N0QA 3UAVA 3FTQA 2W6OA 4FLEA 2OWEA 4HTFA 1XCMA 3BULA 1N6NA 3C8HA 1F2UB 3LGSA 4GOOD 4O2RA 4YCJA 5C8VA 1DUSA 2FMIA 1KKUA 2L42A 3G0OA 2VBGA 1X94A 4R2JA 1G3RA 2AZTA 2BFEA 1OA0A 3D6NB 1NULA 2IXEA 2PYDA 4E2ZA 3IP9A 3V80A 1O8CA 2ODWA 5AJUA 2B4RO 1GL9B 4Q47A 1MIOB 4TTPA 2DFPA 1UOPA 2H9AA 4QXMA 3G8DA 5H82A 5AHOA 1FRFS 4MGIR 2ZRJA 5CVCA 2KJQA 4I46A 1YBVA 4UXHA 1DRKA 1YIOA 3KC2A 2IP2A 3P2MA 4JOQA 3U1TA 1IEVA 4ROSA 4QOSA 3QVGB 3O4IA 1YQGA 3O91A 3EQ2A 2JARA 3JV7A 1X7WA 3CRW1 4MV3A 1M54A 2EFEB 2KW5A 4N18A 3SJUA 2NUTB 3ZDBA 3G13A 1SVLA 4B9EA 2WKRA 1XBTA 2ZRGA 4G1EB 1FZQA 4PX3A 3CE9A 2WLSA 4FDMA 5TGTA 4GNRA 4CL8A 4EUEA 1LW6E 4JB3A 2VDVE 3WOHA 5BUQA 4LE2A 1OTYA 3O94A 2X6TA 2BSXA 2EGUA 2PMBA 4YIHA 2PUVA 4DYVA 3LQKA 4JJ4A 4I6EA 4MDEA 4TT3D 5DIFA 3ETNA 2OT3B 2PX4A 3T9EA 2QY9A 3IQZA 1KQNA 3D1LA 1J90A 1T2FA 3A1NA 2J8ZA 3HKEA 3EJ6A 5AOBA 4EQ6B 5EHNA 3ETDA 1AKMA 3KSMA 4HCJA 2C3PA 4LWQA 4UUQA 5FDFA 3U0BA 1NF9A 3LT2A 4WBSA 3B6MA 4Z1MD 5E8JA 3UCXA 3GN2A 4DJAA 5AVTA 3MGBA 2W2QA 3ONFA 1ISHA 1BMDA 3O93A 1L8QA 3CRQA 3V00A 1R9JA 2J9GA 2C95A 1OGIA 3PXUA 3A26A 4OIMA 3OT5A 3VYWA 3I9OA 3TAUA 1RHMA 2FFHA 1DNPA 2WV7A 1EE1A 4XVCA 2C2KA 4BO2A 4NV0A 1J6UA 1WBJB 3PFBA 4PZCA 1VCOA 1YRLA 4F3TA 5JW6A 1RZUA 2GCIA 1ZD4A 2QNBA 1N33B 4JNCA 5I7FA 3R3JA 3RV4A 2HRDA 4MVJA 2GEUA 1QGZA 3ZDXB 1YU6A 5D2CA 3RAGA 3WSVA 1E63A 4PBSA 5L3RA 3RUCA 1MC5A 1SUAA 1DAHA 2NVBA 2VJMB 1ZH0A 2DKNA 3G2NA 1JEYA 3MWDB 1VLVA 2HNKA 2IXDA 1B6RA 3C3WA 3A1VA 2EBHX 3E7FA 4OI1A 4U2BA 3RNLA 4B9AA 3OZGA 1THGA 3EQ8A 3CLRD 2W8BB 4Z99A 2NOAA 1JBQA 1UWKA 4NG5A 4XPIB 1JTVA 1NONA 4D9CA 3MEQA 1G8JA 1O6FA 2H4YA 1QVVA 1J25A 4BX9A 5C1BA 4GDFA 2ODAA 3JQ7B 2P9FA 1CQPA 2HM7A 2OUIA 1USUA 2XMCA 3LBYA 1RIFA 5ALOA 1PJBA 4MI1A 1MAHA 4HTAA 4IRMA 1G8SA 4NMWA 3WLHA 3GLIE 5B3JA 1T4DA 1X7XB 2C84A 3SE0A 2OEPA 2QR3A 5F64A 1ECPA 1S7CA 4J0QA 5LP6A 2RIPA 2XOKD 5KQMA 1IHUA 4NNPA 1CUIA 1JRLA 1T8PA 1O7JA 2XDWA 4DBZA 4WCVA 4RSGA 2VHVA 4E70A 2FUEA 3EUEA 4FE4A 1I2MA 5NLLA 4HRXA 1ISSA 5AP9A 3ZWPA 2R87A 1GO2A 4X95A 2YY7A 5HFJA 2KQUA 4J0KA 1HL7A 4A6EA 3QUAA 3L93A 1JFVA 5B7NA 1DLIA 2J0VA 1P5HA 3VNAA 1E6LA 1Y89A 5JARA 5LL6P 4N48A 1FLNA 1EFKA 1V5GA 1EFAA 3LPAA 2FN3A 2IHBA 4LTMA 3WRWA 4DYHA 1USIA 5B1SA 3ZWOA 3IMKA 4NVRA 2D0OB 4PLFA 4QAJA 2JFXA 4IIJF 1HT3A 3S2IA 2Y93A 1QPGA 4OATA 4EHHA 1WPRA 1XD8A 2XMRA 3BGOS 3DDHA 2BMJA 2OCKA 1TQ2A 2BEWA 1RBMA 2HCBA 3ZU3A 1JEAA 3FPAA 2PGLA 4FOTA 1TJYA 2B0JA 3S8EA 2FGJA 4PQFA 2AMLA 3MMXA 2AOUB 2H4JA 4OJMX 5FHRA 1XIVA 5HQTA 1OROA 1NMEA 3CEAA 4AO6A 3GH1A 5EP3A 3OOYA 4BX8A 1OYVA 1V41E 4QGBA 1WKCA 2OCXA 3W78A 5DXFA 3FDJA 4ZVNA 2QRVB 1GPJA 5I9SA 4QAQA 1OX4B 3WNDA 2HJ9A 5F7XA 3F3KA 4LYYA 5H3HA 1BDJA 1MVOA 1C29B 2VZ9A 4GYJA 5IDYA 5LIPA 1F9AA 3HCOA 4M0PA 3E82A 3U3RA 2VTBA 1IZYA 3EXIA 1W59A 3TPZA 1L4UA 1VHLA 4ZQCB 1ZS9A 4L6AA 3RVBA 1EE9A 4MUBA 2GO1A 3FMOB 5EINA 3GUYA 2DUWA 3H99A 3RC3A 2QQFA 4JYCA 3KSDO 3NYWA 1XJCA 2BFCA 1KY3A 1RJGA 4H3KB 2HHJA 2GFQA 1VRCA 3IAM1 3FSEA 3QEOA 3SWWA 4ZQBA 1OU4A 2BMVA 4GSKA 4JOSA 4P36A 4XEHA 5T57A 1QRRA 4E4TA 3FWKA 1QRDA 2AJDA 2BFBB 1COWD 1JFLA 5WRFA 4TL6A 1P6XA 4KWHA 1QLJA 2HU7A 3QVSA 2QX6A 4AF8A 5LZ9A 1AMNA 1Z7WA 4QU0A 1RACA 2O48X 3EVZA 1R8SA 1XZIA 3VVBA 2CSXA 3ZW7A 1YVUA 4D99A 4WBNB 4YMVA 1WPGA 2IFTA 3W04A 4Z4FA 4TMZA 1E92A 2R6HA 4YV1A 3FMGA 3PX2A 4PGFA 2R2GA 4RTNA 4BY9