4AJKA

Rat ldha in complex with n-(2-(methylamino)-1,3-benzothiazol-6-yl) acetamide
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
331
structure length
330
Chain Sequence
AALKDQLIVNLLKEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 115
structure length 330
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajkA02
2OO5A 1U3TA 3KYBA 3WYEA 2GSDA 3R3JA 1NFRA 5A05A 3WOHA 3FHLA 5DDIP 1T2FA 4I08A 4F45A 4CUJA 2D5CA 5L53A 1X0XA 1JVSA 1LX6A 3PQDA 2RAFA 3WX0A 5KJFA 4WCFB 3CZMA 2CSUA 1XELA 2GO1A 3N7UA 1KVTA 4M1QA 3FTPA 4Y6SA 3GG2A 3EAGA 3UN1A 3H9EO 3JQGB 4J43A 3DO5A 3OA0A 1A27A 2QRLA 2WM3A 1LA2A 1ENPA 4IIUA 2IDZA 2P5UA 4BNIA 3F5SA 4HBGA 4ND2A 4RGBA 5DBIA 4XJSA 4DVJA 2OGUA 2AHRA 2X86A 2G1UA 3E82A 3IOYA 1TI7A 3ETGA 3C7CB 1QYVA 2Q3EA 1HSOA 3RC9A 1HE5A 2JHGA 1QXSA 3JQ7A 4BNKA 1DIHA 1U28A 3DHYA 1B8VA 3AK4A 1DB3A 2FOIA 2HK7A 4JBHA 4E13A 3IJRA 1GYRA 3IMFA 1LC0A 3PHGA 3HN2A 3I9KA 4HUJA 3RVDA 4CQLA 1VJ0A 5CAEA 5IF3A 4LRSB 4J7UA 3DMTA 3GNSA 4ID9A 5TRTA 5IZ4A 2W2LD 3GVHA 3CXRA 3PDJA 2NVUA 3QVOA 4JP3A 4IDFA 5AXDA 1GYQA 1I10A 2H63A 4Y98A 1CEQA 3I4FA 1YL5A 4ZHSA 1BHSA 1R0KA 2CY0A 2HLPA 1Y8RB 2VOJA 3GN1A 4W6ZA 1JDJA 4CMBA 1E7QA 2NVWA 3TOXA 1WVGA 3KLPX 3LVFO 3RKUA 1WDMA 4CV1A 3F3SA 4XQ9A 4YT8A 4E5YA 4WECA 1JKIA 3GC6A 5A9RA 2RBEA 4RDHA 3PLRA 5BSGA 3CMMA 3G0OA 1WZIA 4UEOA 3GOHA 1Y9EA 2OP0A 1EFLA 3BXXA 3JQAA 5A4DA 5JSFA 1C0KA 3PTZA 3PIIA 4IZIA 1HDXA 4FR5A 1HYEA 3H65A 4KDEA 2YV1A 4OXYA 2BELA 5JAZA 2OUIA 1CF2O 3HZZA 4ZRMA 3WGGA 4C7JA 1HEUA 4NK4A 2I5PO 3WIEA 4O6VA 4E21A 4BNHA 3OQ6A 4I1IA 1YOVB 1PGOA 4IJWA 3KYCB 1ZVMA 1RPNA 1F8GA 2C54A 4U7WA 4CR7A 4A0SA 4YAIA 1F8FA 2A94A 4EBFA 4BNMA 2EGHA 4LN1A 3WWYA 4WJZA 5IDWA 2J5RA 1ULUA 4D43A 2H5LA 2I6TA 4XR9A 1YWGO 3T7CA 1HSZA 2VT2A 2X7HA 3HWRA 2DVMA 3M2PA 3VPHA 4MVJE 2C7GA 2PR2A 4HNGA 3H7AA 4JJIA 4K26A 3LQFA 4GGPA 1ULSA 1V8BA 1VL6A 1QSGA 4IDCA 3FWZA 5KWEA 4PLCA 3B70A 5F1KA 1LQTA 3U49A 5AQ1A 2O3RA 1XKQA 1IZ0A 3R6DA 1VE9A 2HDHA 3ANLA 4MDHA 3AUSA 4YT2A 4YT5A 4MP8A 5U9CA 1DPGA 2WJPA 4DPKA 4YJFB 5K0ZA 4XGKA 1PL7A 1TEHA 5TGDA 3JYLA 1K6JA 1X1TA 4YTEA 4CM4B 2QZ9A 3L0DA 1YS4A 1E7MA 1O94A 2PLAA 3LK7A 3U0BA 2VUUA 3WR5A 1E77A 2HRBA 1RM5A 5TX7A 4N18A 1BDMA 1V3VA 5L45A 1I24A 5AXAA 3V2UA 5L40A 5BQFA 4GLOA 2FN7A 1LSSA 1FDUA 1DRUA 2PZLA 2Q50A 3FNGA 2XF8A 4FC7A 4OMUA 4PLYA 2G82A 4WGGA 3SEFA 6LDHA 5JFOA 5JDIA 2DTEA 3HB5X 4WOKA 5JCJA 1YONA 5EN4A 1PL6A 4RPKA 2BH9A 4WLFA 4II3A 1N1GA 2W4QA 3O8QA 3S1LA 3ZW8A 2PZKA 4DQXA 2C20A 4MP6A 4YWJA 1NVMB 2B4RO 3ONEA 4TZKA 1EQUA 2C82A 4W9NC 3W8DA 4EUEA 4WUVA 1UAGA 4H15A 3GAFA 3U4HA 1UDBA 4DQVA 4RPJA 1N7HA 2EEZA 5ICSA 5LC1A 4YAKA 4KOAA 4B4OA 3ABIA 4YCAA 4N5MA 7MDHA 1H2BA 3KTDA 3ON5A 5ITWA 4R9RA 2YDXA 4IJKA 3H3FA 2VCYA 3RUHA 3RUCA 4TKMA 1MXFA 4GPD1 1J0XO 1P1HA 1NTOA 1GU7A 1NP3A 2IXAA 4D46A 2R00C 4YAJA 2DAPA 1MLDA 2VOEA 5FI5A 2PKQP 2GF2A 5A04A 1DFHA 1JLLA 1W0CA 2R6JA 4MIOA 1LSJA 3PJDA 4NR0A 1ONNA 1GQYA 3W6UA 4CQMB 2D4AA 4I9NA 5G0WA 5GZ1A 1JU9A 4WLNA 1E1NA 4OXNA 1LDYA 3NDIA 4IGFA 4FJ0A 4CV2A 1LUAA 3E5RA 4KQXA 4BGIA 3U9LA 1PL8A 2IE0A 3ETDA 3Q1LA 4WCFC 4Z0HO 2POQX 3VPSA 4ALIA 5H82A 4Q3NA 3D64A 2PH5A 1NAHA 4U8GA 4BMVA 2DFDA 4PLGA 3UCFA 3FCOA 4IY1A 2NM0A 1RM3A 1XGKA 3QWAA 5JC1A 2BFPA 3QLJA 2HQ1A 3R0IA 2C29D 5TNXA 3HG7A 3UXYA 1H6BA 5F1OA 1G0NA 1EVJA 4AJ2A 3QVSA 2NACA 3TZ6A 3FWNA 1OAAA 3KBOA 3MWDB 2BFAA 3GT0A 3E8XA 4II2A 3KLMX 3WICA 3WIDA 3M2TA 2NU8A 3OMLA 3LT1A 1ZK3A 3U4CA 4NMHA 2J3KA 5BSHA 4EJMA 4IM7A 1XDWA 3GZNB 3GQVA 1XU7A 1KYQA 4BNUA 3K96A 2VWQA 2GD1O 3PXXA 1MFZA 4EEXA 3BIOA 1DXYA 1GY8A 4PIVA 3AU9A 1K0UA 1EUDA 4KWIA 4BHTA 3ZWWA 2GLXA 4FGSA 2C2YA 1EK6A 1U7HA 1QV7A 2NTJA 2Z5LA 3ENNA 3VTZA 2BHLA 3KB6A 1PS9A 5JO0A 3JSAA 3V1UA 3HDHA 1MC4A 3ZGYA 4UULA 4BGEA 3QE3A 1BXGA 1WDLA 3IIEA 2XAAA 3ZHBA 4BGVA 3HHPA 4BOYA 4TRMA 5DZSA 1N2SA 3PFFA 1N1EA 3DR3A 2Y68A 3LF1A 1ONOA 1Q0HA 3UCXA 1VKOA 3Q9UA 3RWBA 4F6CA 4LMRA 2AEJA 4URFA 1E1LA 1ML3A 3WFJA 4RVSA 1I0ZA 3N58A 5KJCA 1KS9A 4YJGA 4TVBA 4IS2A 2D8AA 4XDYA 2PGDA 2BGLA 4BIIA 2HMUA 2EERA 2ZJ1A 2P4QA 4QUKA 4ZN6A 5FYDA 2B0JA 3OJFA 3UGKA 3JD0A 4L74A 5B4TA 1YDWA 5A02A 4DTIA 5JMPA 3ZZNA 3L07A 3S2FA 3ZU4A 4D0RA 2CF6A 1GFSA 2WD8A 3LT2A 3WDSA 4LSMA 4J0FA 3HFSA 3QRWA 2UV8A 3PYXA 3SXPA 2Y1GA 4RVUA 5C5IA 5TSDA 2QZZA 3WGOA 1FDVA 4AJOA 1ISFA 1BWSA 2LDXA 4D3FA 3WNVA 4J49A 4B79A 4ALJA 1UH5A 3F6YA 4RO0A 1YJ8A 5JAQA 4JLWA 1EVZA 3I4CA 4IS3A 4E5NA 4DBVO 3HE3A 4IBOA 1IL0A 4NQZA 3I1JA 1WZEA 3AOGA 4PG6A 3DBRB 5THQA 1P0CA 2ZYAA 4J6FA 1U2DA 1M2WA 1WMBA 2X1HA 5A5FA 5A9SB 1T4DA 3W6ZA 3BMQB 4FN4A 3WGQA 2AG8A 1S7CA 4XJTA 4YRAA 4FOOA 5DCYA 3K2EA 2JAPA 3O03A 3DTYA 4INAA 3ZV5A 4RORA 4RZHA 2X23A 4D42A 1K3TA 4CR6A 4DPLA 3ENKA 3AU8A 1NVTA 4D79A 4OQZA 3KV3O 3LDHA 2CNBA 5HA5A 4YXFA 1WDKA 1PU2A 1E7YA 2Y93A 3IDSA 4R1UA 1E92A 1EE9A 1DRWA 3S2GA 4ILKA 1XYGA 5T67A 4A2CA 4EZBA 4LMPA 2J3HA 4IIVA 2GGSA 4MVJP 4BO4A 4DMLA 2VHWA 3NUGA 3E48A 1I2ZA 4L76A 4R9SA 1RM4A 2ZQYA 3ZN2A 2GR9A 5L3ZA 5G4LA 1Z74A 4NDNE 3UF0A 1ORRA 2NQ8A 3BMCA 3SLGA 4ZJUA 4D3DA 5EL0A 2JHFA 4MP3A 4BKOA 4N5NA 1OMOA 3VPFA 1V35A 2HKIA 4XQEA 3OA2A 4WLOA 1RJWA 4OJNA 1YBAA 3ZHYA 3WLEA 2FZEA 2P9CA 1SEPA 1Q0LA 2VRBA 4BS9A 1IULA 3EUWA 2BI8A 2W8ZA 4BNXA 3ZWNA 1U4SA 1UJMA 2BFOA 1NBOA 1YQGA 3ZV6A 1KEUA 1R4NB 5DNAA 3T4EA 2E6UX 5CG1A 1GYPA 3DOCA 1ADFA 3GF4A 4KUHA 3F47A 4OO3A 5HS4A 4OSPA 4BV8A 3COSA 1HKUA 1YVEI 3JQ8A 4OH1A 4EW6A 4ALLA 1T24A 1I32A 4WASA 4P38A 1P77A 4PLVA 4R1NA 4RVFA 1P1IA 4FIZA 4WPGA 1U3VA 4HKTA 4XYMA 4BNNA 4E2YA 3RD5A 1N9GB 4HY3A 3DL2A 1PX0A 1PJQA 4CMAA 4E5PA 4BO1A 2WTBA 1EEHA 2JL1A 3DZKA 4AICA 3QJ5A 4WOJA 5T6BA 1Q2XA 1HZZA 4L4XA 5U1PA 3AY6A 3JD3A 4PVDA 3TZKA 1ZSNA 2X8LA 1TT5A 4A5OA 1H93A 3ROQA 1VJ1A 3CPSA 3GR6A 3NTOA 3NT5A 5COBA 4DLBA 4GQAA 4BNJA 5COQA 1BVUA 4I5GA 2B36A 2A35A 1UAYA 4UUMA 4R01A 2QYSA 2HMWA 3BHMA 4BNFA 1YL7A 4GBJA 1C1XB 1I8TA 2V6GA 2YYYA 1VRWA 3RASA 4R51A 1Q7GA 1VM6A 3UCEA 1WP4A 2ZATA 4I5DA 4OYRA 2P9GA 2WD7B 3NDJA 2QW8A 3DB2A 3WBBA 5KKAA 5FI3A 4D41A 1GD1O 2JKVA 4RPLA 2X0JA 3MJEA 4S3MA 1P44A 2DUWA 2NV6A 2I3GA 2R2GA 2FHSA 1PJLA 5TS3A 4M54A 1E6EA 1RKXA 1KETA 1NASA 1ENOA 2HMVA 3EC7A 4MVJM 2BMAA 3VZPA 4H3VA 4A7PA 4R69A 3OF2A 2ZYDA 5C7OO 4M55A 4YQZA 4BQRA 2B35A 1F06A 4B3JA 5KOIA 1Q7BA 3MEQA 2FR1A 3BMNB 2VHVA 1ZK2A 1ISJA 2ZIZA 1E3SA 4M87A 4WEOA 3KHUA 4JBIA 3MWEB 3X2EA 4U0JA 5GY7A 1E3WA 5A3VA 4ND4A 2V6FA 1O95A 5FWNA 3MJVA 1SOWA 1ISHA 3BMOB 5EQFA 1ZSYA 5CEJA 4QQRA 4EI2A 1I30A 2HAEA 2DBVO 3KYDB 5G0TA 3GGOA 3O9ZA 1H6CA 1IHXA 1X7DA 1A7AA 3C3XA 3D7LA 3QSGA 3JQDA 3TFOA 2YFHA 3GRPA 4KZPA 3ZNQA 4R41A 1L7DA 1NPDA 5DF1A 1EDOA 3KM0A 4TVOA 3IP3A 1YB5A 1NQOA 1EDZA 4RL6A 1ZJZA 2FSVA 3R3SA 2DUUA 1A71A 3D4OA 4CMIB 3VH3A 4CLEA 3NJ4A 1XLTA 3PPIA 1DFGA 1WW8A 1WLYA 1D4FA 1QR6A 1ADCA 1PIWA 2X5JO 3ASVA 2D3TA 5G4KB 3ST7A 1SEVA 2Y0DA 1MG5A 3OM9A 3AFMA 3C7AA 3I9OA 3PVZA 2ZQZA 2O4UX 3A14A 3QVXA 4PLWA 3WQRA 1NWHA 2W2KA 2DBRA 3F1LA 3RC2A 1WWKA 3PGXA 4J2OA 5DOVA 2O23A 2Q1WA 2DKNA 3GPIA 5JLAA 4RJTA 3C7DB 1T2CA 3PYLA 2FPGA 4KTTE 1UZNA 1ISMA 4GWGA 4ZQGA 4FQ8A 2PGJA 2WE7A 1ADGA 1PGNA 4F6LA 2Y1EA 2H1SA 1P1FA 3ROKA 1UXGA 1MXHA 4PLTA 1B26A 1XIVA 5B4UA 3G3EA 2I3AA 3RSHA 3E03A 4YT4A 3WS7A 5JXWA 5CDTA 4E4YA 2A92A 1UZLA 3DBHA 4CLOA 3NYWA 4DPMA 5CHEA 2GUGA 5ENDA 3GH3A 3VPGA 4DA9A 5L95A 2YZ7A 4U6QA 4QEDA 4GMFA 4KP7A 2VZ0A 1R4MA 4W9NA 5A9TA 2IZ0A 3A28A 1PZEA 1C3VA 1QYWA 1E3JA 4L4RA 4KTVE 4EUHA 4P4LA 4BNZA 3UICA 9LDTA 1E1KA 1AHHA 1S6YA 3QVWA 5KIAA 1GEGA 3M1LA 4C4OA 3A9WA 1GUFA 4NFHA 1FDSA 4GKVA 4U5QA 2YW9A 4RPHA 5AOVA 3RI3A 4BO6A 2DU8A 5AXCA 2J8ZA 3WYCA 2Y0EA 1HZJA 3UKOA 2ZTLA 2OFPA 4R16A 5JBIA 4GVLA 1HDYA 3RCBA 4CV0A 4U6SA 1W4ZA 3PDUA 1X13A 1AE1A 4CJXA 2VYND 4NJMB 4RF3A 1X7HA 4HP8A 3A4VA 4YRDA 2X0RA 3EZLA 2UAGA 4QFCA 2CMDA 1HWYA 3PHIA 2O50A 1RWBA 1DHTA 2CFCA 1X1EA 3H9GA 3RUEA 1EVIA 3H9UA 1VSUA 4WCFA 3DTTA 2NU7A 3HN7A 4XIYA 1QYCA 2E48A 1IE3A 4NK5A 3JQGA 4RVHA 1LNQA 3UUWA 1O89A 4CUKA 3H9QA 4JP2A 2W90A 1EK5A 1YB4A 4GX2A 4LW8A 2GASA 4CM3A 3G1UA 1V0JA 1DC4A 3QY9A 2BD0A 4ND5A 1B15A 4HFNA 3PWSA 3LYLA 3TF5A 1GUYA 3B20A 1ZZEA 3IAHA 2Q2WA 3EZYA 1M67A 1UZMA 4D3SA 4GAEA 1FK8A 1HETA 3RC1A 4F3YA 3BTSA 5DN9A 1NQTA 4UVHA 5ILOA 4MVJA 4NBRA 2VQ3A 3DOJA 2D5AA 1PGQA 4DIFA 4LGVA 3FI9A 1DC5A 1XEAA 3LC2O 2ET6A 4NPCA 4UEKA 4X54A 1BDBA 1GR0A 3PWZA 5L51A 1MX3A 3BHIA 4RVGA 3PRJA 4O1MA 1VPDA 4PG4A 2FP4A 3ADOA 5GZ6A 1WXDA 4J91A 1Y8RA 2DPHA 3C1AA 3K6JA 4ALMA 3RU7A 3F1KA 1SB8A 1SZJG 4PN3A 3GVPA 4DGSA 4JK3A 2XXJA 5G2OA 1LQUA 1DRVA 3GG9A 1GADO 5F21A 5I7EA 1P1KA 2AA3A 1B8UA 5HWSA 3DBLB 4NZ9A 1NX6A 3CTMA 3EGOA 4CM8A 3JQAD 3EK2A 3VH1A 2EF1A 4AVYA 4YQYA 4CUZA 2AQ8A 4WLUA 2YV3A 1HE4A 1LSUA 1LXCA 1PJBA 3LT0A 3ICPA 3PQEA 4YRBA 1ZMOA 2WDZA 3AWDA 4UVIA 3OSUA 5C7IO 3ZWXA 5TIIA 3ZHXA 3VPXA 3HB4X 2PGLA 5B4VA 1J49A 4Y6PA 1YOVA 2UUOA 3KYCA 3O8QB 4FSHA 1ENYA 1PSDA 1T25A 3F46A 4NFYA 1UXJA 1DIRA 2AMFA 3VZQA 2Q2QA 3D5QA 4FFOA 2VWGA 4L8VA 1CJCA 3KEOA 2JAHA 1V6AA 5CDGA 1LTHR 3L6OO 4XIJA 3H6KA 4GGOA 5HRUA 4LVCA 3OICA 4HV4A 1NPTO 1P3DA 3GLQA 4GX5A 3EMKA 5JDCC 3HUDA 4MKXA 1FJHA 2HUNA 3FR7A 1VKNA 1GCUA 1P31A 1LDNA 1VL0A 2EXXA 3RKRA 3O38A 3ZH2A 3GNTA 4WK6A 3T7EA 1W8DA 2Q45A 4Q3AA 3TJRA 3RFVA 2EKLA 2J5KA 4JNKA 2WWRA 4R1TA 1R37A 3WMWA 2OBNA 4TZTA 2EW8A 4BKQA 3IL2A 1E5QA 3D4PA 1IPEA 2A9FA 1BW9B 2PZJA 1YGYA 2Y1DA 2IYPA 3E6AA 5BNTA 1Y8QA 2H9IA 4O59O 1WNTA 5T5QA 4AJKA 5BNFA 3Q2KA 3PK0A 3DDNA 3ZWPA 4RQUA 1E3LA 3MTJA 4TKLA 3K92A 3WTBA 3U5TA 1J5PA 3L4SO 2P2SA 3OEYA 1UP4A 4AJLA 2I66A 1DSSG 4E5KA 3RFTA 3PIDA 3V1TC 4DQUA 5K6AA 1HTBA 5JCJD 3IC5A 2X4GA 1ZXBA 2AEFA 4ZGWA 1GPDG 1YL6A 2GZ3A 4DLLA 5GMOA 1H9BA 4YJHB 3VVBA 1T2AA 1WMAA 2GPTA 4JGBA 3I9LA 4BO5A 1P45A 4M89A 3ZWVA 5KVQA 1EBFA 2QRJA 4KMSA 4ZICA 3S2EA 4B3IA 1UDAA 3CE6A 2JFFA 4IGEA 3WQSB 2PK3A 3K9QO 4WE3A 1A7KA 3B6ZA 2IODA 4DXHA 2O2SA 3GZ4A 3H3JA 2X9NA 1QV6A 2EIHA 4OOFA 5L9AA 2V65A 2WYWA 1PQPA 2A4KA 1LEHA 1VJTA 1IB6A 1Z75A 2BKAA 5TQVA 2O2YA 1YKFA 3ZWCA 4PLHA 5G0SA 2FR8A 3GDFA 3E18A 4XRRA 2YHIB 1I3LA 2EJVA 4B4VA 4DIOA 3FBGA 3WSWA 1SBYA 3QW2A 3LF2A 1K5HA 3GDGA 2TMDA 1C1DB 2BGKA 3ZWMA 1HDGO 2NTVA 4CQMA 1PJTA 2DBZA 4JQCA 2NTNA 5IZCC 3A1NA 2V6MA 4MKRA 2CD9A 4PGFA 4R3WA 3TN7A 2BI7A 1BRMA 4E30A 2GN6A 1EQ2A 3SBOA 3DFUA 2DQ4A 5EMHA 1JAYA 1U2GA 4OOEA 4HADA 2I9PA 2VYVD 1A5ZA 3EDMA 3GFBA 3HFGA 4BO2A 4A27A 4BB5A 3KEQA 2FMUA 3QP9A 1D1TA 1I3MA 3V1YA 2PKRA 1Q7CA 2X9GA 3DAPA 1YH3A 2HK8A 3RROA 3TWOA 4BKUA 1E7SA 2ZKLA 4UVDA 1GPJA 3FBTA 4TMFA 3ZNNA 3FR8A 2IRWA 3GPDG 1U4OA 1XCBA 1KEVA 4RF5A 3W4IA 4EEZA 1HYGA 3T4XA 1U3WA 1C0LA 2Q2VA 1VI2A 3BHJA 4ZVVA 4YAEA 2C5AA 2HO5A 2DLDA 3L4BC 5JPIA 3JQ6A 5ER9A 2Y67A 3DXFA 5BR7A 1GDHA 3KRTA 3GFGA 3JQBC 3GZNA 2PZMA 2DFVA 2IXBA 4UUNA 4JXKA 3BTVA 4KUEA 1CETA 4CPDA 3S8MA 1E7WA 1TA4A 2WEKA 3BA1A 3GN2A 1NR7A 1DO8A 3LU1A 3OETA 1N7GA 5DT9A 1U5CA 1U1IA 3TQHA 4ZQEA 4B4WA 1GUZA 3GVXA 3AUTA 4BB6A 4Q39A 1P0FA 2JD0A 3INRA 1YQDA 1YXMA 2O7SA 3WWZA 4HFJA 1NFQA 3EYWA 1AXEA 3F4BA 3WLFA 2Q1UA 4AJJA 3GMSA 2O3SA 3ASUA 4CMEC 2AE1A 3KOUA 3KZVA 2GYYA 3UHAA 2P9EA 1YJQA 5IFLA 4CL8A 2F00A 4FBGA 1N5DA 1PJ4A 3OJLA 4PLZA 1DC6A 2Y66A 4PZEA 4PRLA 1NHWA 3UH1A 5EIOA 3DAFA 3H2SA 1GQ2A 1KVQA 5FFFA 4IINA 3E9QA 3GGGA 1PJ3A 4DMMA 2UDPA 5F5NA 3IUSA 1FDWA 3UFXA 1MGOA 3PJGA 4I9UA 4BL5A 3H5NA 2PA3A 1P1RA 4AJHA 2PD4A 3LC1O 1K6IA 1FF9A 1ZXLA 4XYBA 2PH3A 1HLDA 1ZSVA 2P91A 3PYMA 2JCYA 3G79A 3I83A 4MPDA 3OP4A 2J3JA 3OJEA 1DAOA 2Y99A 4BUCA 3HADA 1B14A 3Q6IA 4WKGA 2IYOA 3VZRA 5I9NA 4BO3A 3FTNA 1LLUA 4YJDA 3R1IA 2C59A 3SJUA 2B37A 1ZBQA 5EQDA 4R5MA 3H2ZA 4GL4A 4WLEA 3H4VA 5MDHA 4B8WA 5DP2A 4AJNA 1U7TA 4K1LA 2ZB8A 3LSYA 3W8EA 2NLOA 4CM9A 1LC3A 4EYEA 2ZTVA 3WJAA 3BTUA 1NPYA 2CVZA 5IDXA 1UXHA 1C14A 2EHDA 2YQ4A 4JX8A 1H5QA 3PHJA 4J90A 5JY6A 4E3ZA 1LJ8A 2V6BA 1P9LA 4CLRB 2VRCA 3JYPA 2AE2A 1HT0A 3F5QA 4MIYA 3JQ8B 4ND1A 3SC6A 1ID1A 3VDRA 1YQXA 4BKRA 3DBRA 3RBVA 2D1YA 5A9SA 2IZZA 4IXWA 3RUAA 1NYTA 3VHRA 4R68A 2PTGA 1ZH8A 1I2BA 1I36A 2QYTA 4RLSA 3G1TA 5J23A 2QHXA 2X5KO 3JD1A 2EJWA 2HMTA 4MVJF 3TL3A 3WXBA 4OKIA 4MVJH 5L7YA 4TQGA 1AXGA 1H2HA 4FGWA 4XA8A 3JV7A 2D0IA 3KUXA 1A9ZA 2PWZA 3VVCA 4K6CA 4AJ4A 4FFLA 1O9BA 2JFGA 4FCCA 3QIVA 4TRNA 2O3UA 3ETEA 5ER6A 3X2FA 4EJ0A 3GHYA 3ANNA 4DC0A 2PNFA 3ADPA 3JCZA 2UUPA 3PHHA 3UOGA 2QRKA 1CQJA 1UP6A 1Z6ZA 3NT4A 3MOIA 1SC6A 4Z9FA 1RM0A 4NBTA 5JC8A 2JJYA 3GVCA 4G65A 3AM3A 5I8WA 1OC4A 1K2WA 4TROA 2O4CA 4FFRA 3STHA 1OFGA 5CEFA 3JD2A 5I9MA 4XRGA 3D3EA 3FNEA 3NRCA 4DREA 1WPQA 4JROA 1ZFNA 1IHYA 2Q49A 3ZDFA 1PJCA 2VZ9A 5T8KC 3OIGA 5AVOA 1IUKA 2HJSA 3NTRA 4H16A 3S55A 1R4NA 1Y81A 2NU9A 4UREA 2GN4A 4Z9XA 1LBEA 3PQFA 3AOEC 3HDJA 3DZHA 4GH5A 3OIDA 4GVXA 3RQSA 3SX2A 1CWUA 1GEEA 4B3HA 5TJ9A 1CDOA 4A10A 4UVEA 4LSWA 4CMJA 3OJOA 1X15A 3PFWO 2B4QA 1ZEMA 4AJIA 1H0KA 2EP7A 2FPPA 1MV8A 3CKYA 1N9GA 4MKZA 4MO2A 4YBZA 4EJ6A 1BSVA 1A9YA 2G76A 2Z1NA 5CDUA 1Y5MA 1QYXA 3ZW9A 1MG0A 1PR9A 2TMGA 3ORFA 3RFXA 3EVTA 3OECA 2YUTA 1JAXA 1IZ9A 1PZFA 1ZK1A 1SAYA 3PJFA 3FPCA 2VWHA 4OIMA 4Z0TA 1D7OA 4Q3DA 4OM8A 4GSKA 4LISA 3WG9A 2YFQA 4PZCA 5I7VA 5JY1A 4EDFA 2PV7A 5ILGA 3AW9A 4Z3DA 1QKIA 5DCWA 3PZRA 1X14A 4OXKA 1BMDA 1C1XA 1D8AA 1OBFO 3W1VA 1AGNA 3C24A 4PZDA 2DC1A 2EGGA 2EW2A 4E6PA 2P5YA 1Y9AA 2OP1A 1YRLA 1J6UA 1ADBA 4N7RA 1GZ4A 3CINA 2WD7A 4GWKA 4Q3EA 2OZPA 3ONDA 4KUGA 4MVJI 2GN8A 4YA6A 5BSEA 1P33A 1T26A 6ADHA 1V3UA 3D5TA 5KVVA 2VTEA 2YY7A 4RF4A 2EWMA 4ZU3A 1HL3A 3DZIA 4E32A 1B8PA 3WYBA 4YAGA 3WB9A 3OIFA 3FSRA 1DHRA 3GAZA 3V5NA 1LDMA 1YB1A 2BGMA 4BNVA 2W2KB 4RQTA 2Y1CA 4RCVA 5A3JA 1HLPA 1R66A 3C1OA 3IS3A 4FD3A 3I9NA 4BQPA 3L9XA 4R1SA 4BMSA 4EGFA 1YO6A 3EW7A 3JD4A 2VZ8A 4FC6A 4J1TA 1G0OA 2HU2A 2VNSA 3Q11A 5COAA 4XYLA 2QQ5A 5LDHA 4J9UE 4E2ZA 2X22A 3GGPA 4KDFA 5U4QA 4NNJA 3JYOA 4CLXA 5HM8A 3OJ0A 1PZGA 1Z73A 3NGXA 3BMOA 1T1SA 1DLIA 4FDAA 4CM6A 3L6DA 1KEPA 3GVIA 3RUFA 4ZQBA 3WSVA 4IDDA 4JJGA 2RHRA 3DHEA 3TZQA 1NHGA 2QG4A 4IZHA 1Y7TA 2GCGA 2XXBA 1N92A 2YQ5A 4FPXA 5TLSA 2FPIA 1UXIA 4W7IA 4WNIA 3WGIA 4YDRA 3ZU3A 1PWZA 4J1SA 3SJ7A 2VNAA 1RYEA 2W98A 3B1FA 1AHIA 1BVRA 5A5EA 1XHLA 5JDCA 2WMDA 4CMIA 1TT7A 2JD1A 4IQ0A 1NR1A 1OI7A 2I99A 5BSFA 3ZU2A 2CF5A 1TVEA 1U9JA 2I67A 3JQ7B 1PTJA 5G4KA 4NH4A 3PJEA 4XX0A 4ZQHA 1LLQA 4R3NA 3NAQA 3TZHA 4CQLB 4OSOA 1N8KA 2GERA 2RH4A 4CM7A 5CPBA 1M6WA 1Z45A 2W2LA 2NVUB 3ZCXA 2IZ1A 1E6UA 1I33A 3L77A 3LLVA 3B1JA 3D3WA 4XYEA 1JA9A 2Y05A 1D3AA 4A73A 2AG5A 2EKPA 1J4AA 2DT5A 2GNAA 4L9RA 3GUCA 3JQ9C 4XR4A 1Z7EA 2DBQA 1QLJA 3ZU5A 2G5CA 4WEQA 2SCUA 4DRYA 4XB1A 4FJ1A 1TB4A 4OAQA 3OH8A 1ZCJA 1DC3A 1M6HA 2R00A 3RAJA 3EHEA 4ZA2A 2AQIA 3K31A 5EESA 1GV0A 4PVCA 3ZNPA 4ROSA 1QLHA 5EINA 4QECA 3Q2IA 4IQGA 1E3IA 1ZO8A 3FD8A 3ZNOA 3JQAB 1PGJA 5JS6A 4GX1A 4PLPA 4B8ZA 1Z82A 1B2LA 2ZJ0A 4I5FA 3E5MA 1EZ4A 1E0DA 1YBMA 1IYZA 4HX5A 1HDRA 4RV9A 1O8CA 3ROMA 3JQFC 4DC1A 2I76A 5JAIA 2B69A 1PR3A 4HXYA 3V8BA 3HSKA 3IP1A 4IPTA 5TT0A 4CR8A 1C0IA 1EVYA 1QMGA 2FY8A 3CZRA 5T64A 5C7LO 3NGLA 4WLVA 1DBVO 2IEBA 4OQYA 1HXHA 1KY4A 1ZJYA 2NADA 3MJCA 3U3XA 2YJZA 5AXBA 4GI2A 3E9MA 2GDZA 2Z1MA 1LSOA 1C0PA 5B37A 1R0SA 3AFNA 3H9JA 4FJ2A 4O0LA 1LLDA 4J1QA 4NJMA 4DWVA 3DC2A 5KKCA 1LDEA 5KTKA 4R54A 1EFKA 4P4NA 4L0QA 3QHAA 3HNPA 2OBYA 4CM8B 2X58A 4J2HA 4J16A 1BXKA 5LCXA 3TL2A 1NXQA 5IZCA 4LCEA 1DDOA 3VOSA 2ZTUA 3RIHA 1B16A 3SLKA 3VAZA 1H6DA 3U4DA 3DEYX 3UW3A 5JE8A 2C5EA 1Q0QA 4IMPA 1Z7BA 5CPFA 1ZIDA 4D45A 4BMNA 1ONPA 1QP8A 1RYDA 2CDBA 3MTGA 4JCOA 4AJ1A 1KOLA 2HCTA 4Z3KA 5KVCA 4FB5A 4GLLA 1OOEA 3AY3A 3P5SA 4Q9NA 4D44A 4BO9A 4KQWA 4G81A 1PQWA 3JQEA 4E33A 5EJ2A 3Q0EA 1CIVA 5BNIA 1M76A 2VUSA 5KJ6A 2G0TA 4IDEA 1KVRA 3PI7A 4BO7A 1QG6A 2ZB3A 3PEFA 5L7TA 5F1PA 3K5PA 3RBZA 2GZ2A 3TPCA 3P2YA 2HK9A 3I6IA 3NKLA 2C07A 1PZHA 1AN9A 3K8ZA 1PQUA 1ZW1A 4MVJD 4D7AA 5GZ3A 1BTOA 2CZCA 1GL3A 1XR3A 1I2CA 5TJHA 4W7HA 3L4BA 3IKTA 5IG2A 2OHXA 4I8XA 1Q1NA 1ZK0A 4NIMA 4BNYA 8LDHA 3E9NA 3JQBA 1PJ2A 5IAAA 3Q3CA 1Y6JA 4XDZA 2O3JA 1Y1PA 3MJSA 1YDEA 2PY6A 4LCJA 2NQTA 3ZWBA 5JMWA 1Y8QB 1LDGA 1LRLA 2JCVA 4Y67A 3AM5A 4IDAA 4QO8A 3VTFA 1TLTA 3RC7A 4CMKA 2EP5A 2PD3A 3OQ1A 3DBLA 1H9AA 2VUTA 2Y1FA 4QTZA 4CMEA 3F4LA 1D1SA 4IUYA 3BTOA 5H81A 3S2IA 4E2XA 1NWCA 2V7PA 2Y0CA 3QQPA 4YEDA 3RBXA 5THKA 3TDKA 2DM6A 2B5WA 4CL3A 4XD2A 4JIGA 1BG6A 1GCOA 4J7CA 4E2WA 1MB4A 1SB9A 4MINA 2AQHA 4YJFA 5JAMA 4K6FA 4NBUA 5C3MA 5B1YA 4J7XA 4CM4A 2JFHA 3GK3A 4B7CA 2CVOA 3M1AA 4YVFA 3P2OA 4JBGA 1PEDA 3GA0A 3W4KA 4BNLA 1KBZA 3I23A 5G0VA 2IEDA 4DYVA 5K9ZA 2VHXA 3NTQA 4BV9A 3IUPA 1W73A 4Y9DA 2DTXA 5F5LA 3IKVA 3UVEA 1R15A 4ALKA 3CH6A 4LVUA 2OOSA 3I6QA 1K6XA 3CSDA 2YDYA 4J4HA 4OL9A 5EPOA 5JCXA 1T1RA 1UR5A 4G2NA 1E7RA 4C7KA 5CFZA 5I7FA 5L4SA 4M8SA 3FPLA 2P4HX 1OC2A 2DPGA 3MJ4A 3RU9A 2VHYA 3WJ7A 2ZCVA 1XQ1A 1LDBA 2XOXA 4FFNA 9LDBA 1MP0A 4XKJA 4NU5A 3ROPA 3QWFA 1GZ6A 3D1LA 1XQ6A 2J6IA 4RDIA 1P74A 1HDCA 1BW9A 1KVSA 3DMTC 3ITKA 4OKNA 2CDAA 1MUUA 4JJFA 1O0SA 4E31A 1F12A 3VKVA 4U0KA 5I7SA 4R5HA 5ES3A 4XQGA 3VZSA 3ULKA 2RIRA 3OEWA 4G5HA 4TSKA 1CYDA 1KIFA 1R12A 2ZYGA 3E1KA 1U5AA 3QWHA 5KCZA 4ND3A 1HE3A 4I5EA 1JWBB 3FN4A 5I9LA 1X0VA 5A06A 4HFMA 3H5RA 3JTMA 4PCVA 3MOGA 3DZGA 3LLSA 4M49A 4RVDA 4MVJG 2O48X 2VYVA 3WTCA 4MOWA 1SMKA 3PZBA 2NUAA 4Q3CA 5DOZA 5BT9A 1ZK4A 4E0BA 3HQ4O 3CMCO 3U62A 3KVOA 4BNGA 1BGVA 4BNWA 2I65A 1DIGA 1BXGB 2X0NA 4CMCA 1HE2A 4YJHA 1F0YA 2JD2A 3DZFA 3HDYA 4W4TA 2J5QA 4DLAA 1UP7A 2NNLD 3JQCA 4RF2A 4GMGA 4J1NA 4DYDA 3C85A 3NEPX 8ADHA 1NFFA 4UVGA 3OQBA 2DTDA 4L4SA 4WNCA 1CQIA 4YJGB 4A26A 4JN6B 2UVDA 5L4NA 2QX7A 2P68A 4UEJA 4PG7A 4UUOA 1XA0A 1HYHA 4MJLA 2NU6A 4WCDA 3MZ0A 2X6TA 3I5MA 4NU6A 4TRJA 3VC7A 1R6DA 3GEDA 5CP8A 5DULA 4B7UA 1R16A 1JN0A 2YHIA 3ONFA 4QX6A 5T8KA 1NM5A 1TXGA 4UAGA 4NHEA 4FFMA 1C1DA 2WSBA 5T57A 4CM5A 3AM4A 3AUAA 1IY8A 4CQMD 5CEEA 4J4TA 3G49A 2AEMA 4IJUA 2J3IA 1NQ5A 1NNUA 2UYYA 3AOEA 3B1KA 4J0EA 4ZD6A 1FXSA 4PFJA 4EUFA 3GMDA 3H5AA 2CDCA 1XU9A 3JYQA 4BVAA 1GZ3A 2Q1TA 1I3NA 1ZUD1 2EG9A 1NVGA 5KJEA 3RUDA 2YV2A 4L75A 3KSZO 5DBGA 3I3OA 4RPGA 5IXYA 3DZBA 2NVBA 3P7MA 4Z0PA 1ZNQO 2PD6A 2WE8A 1L1FA 1VL8A 1XSEA 3CIFA 4CLDA 2WYUA 3OHSX 3RJ9A 3WGYA 1H6AA 1Y5RA 3ZV3A 5TF4A 4CMGA 1HDZA 2C0CA 3W8FA 4DL9A 2NSDA 3GEMA 4L73A 4FS3A 1ZMTA 4XGIA 3DQPA 2ZB4A 1DIAA 3AUUA 3FF4A 5JDIC 5JW6A 2ZCUA 4XQCA 4PLFA 1U8FO 1IPFA 4B4UA 3FNFA 2Q1SA 1O5IA 2EV9A 2BLLA 4J3FA 5JYDA 1O6ZA 4PG5A 2PKQO 1M66A 3D4NA 4BNTA 1KC3A 4QO7A 3MCVA 5G0UA 1VLLA 4ONEA 3WGHA 4QFDA 5EERA 2OORA 1SO8A 4NBVA 1T2EA 1UXKA 3FNHA 3TRIA 1U3UA 5F3RA 4W99A 4AFNA 4FW8A 5MGBA 1E5LA 3UAGA 1GV1A 2AW5A 5A03A 4Z6KA 4YYZA 4K28A 1EMDA 4KWHA 4XB2A 1B3BA 5KNLA 1QYDA 2BRUA 2XPCA 3BMCB 3Q9NA 3BAZA 3O26A 3ANMA 4NI5A 1SNYA 5ADHA 4R4JA 3WGTA 3HDQA 4J4BA 2B5VA 4H7PA 5L7WA 3TZCA 1GQQA 4XWYA 4NG5A 1EE2A 3DFZA 2E82A 3BYZA 4I9HA 1ENZA 5K6AC 1KVUA 2OL4A 1PS8A 4XCVA 3NDRA 1VSVA 4QT0A 4IDBA 2B4TO 4NFSA 3SVTA 3NV9A 4BO0A 1U8XX 3QWIA 4FOSA 5C37A 3NJ8A 4EITA 3WMXA 1DIBA 2E4AA 1UDCA 1SOVA 3AI1A 1V3TA 3VH2A 3WBFA 1DJNA 5AYVA 3HJAA 3BMQA 3A06A 3TFQA 4O5OA 1LLCA 5I8ZA 2BFMA 2HRZA 5HBRA 1P1JA 1L7EA 3FRJA 4CM1A 5HTOA 1MFPA 1FDTA 3INTA 4DIBA 3ZV4A 4Q3BA 4RLHA 3TOZA 1ZKMA 2VTDA 4BGUA 4ALNA 1LRJA 2E49A 3I9JA 3DZJA 2Q4EA 4Y8VA 4UUPA 4ITUA 1TT5B 4ESOA 3KETA 1JWAB 3DOOA 3RUIA 4A03A 3V2GA 3DONA 4YPOA 3LZ6A 2VN8A 4CM9D 5DBFA 4CMHA 4GSLA 1T2DA 5TT1A 3U4IA 5JNLA 1JQBA 3MJTA 2X5OA 4CLHA 2PFGA 4GKBA 5IN5A 1FMCA 4B7XA 1LU9A 1IOLA 1K89A 1R0LA 2VRCD 4CLRA 4TWRA 4W82A 3INGA 5KVSA 3AI3A 3QWBA 2ILTA 4LK3A 1VC2A 3ZI0A 4CODB 1LI4A 4P4GA 4ZQFA 2RCYA 5ITVA 1F14A 3JQ9A 5FF9A 4IQ8A 1NQAO 3U09A 4E5MA 1DEHA 1YBVA 3L6EA 3VDQA 3GHHA 2X0IA 1LRKA 1BXZA 4YR9A 7ADHA 2YHUA 3SC4A 1B0AA 5L4LA 1NAIA 2LDBA 2Z95A 5TC4A 3QV1A 5CG2A 5HS6A 4NJOA 3DHNA 2BF7A 3K30A 3EY4A 2Q99A 1E6WA 1H94A 2O7QA 3DWFA 3K73O 2FZWA 3C1TA 5ENVA 1GTMA 2ZTMA 5CDSA 1EUZA 3GUYA 4OGWA 4QSMA 3BZUA 4QXMA 1HRDA 4HFRA 2D59A 4J9VA 1A4UA 2HMSA 1I5RA 1SPXA 3VH4A 3ZWOA 1E3WB 1DFIA 1JW9B 1SCUA 3JQFA 3AI2A 2C2XA 4K9DA 2FWMX 3LC7O 3OBBA 2NWQA 2GRAA 3P19A 3GRKA 1KC1A 3GNQA 4IJVA 1MC5A 3IQDB 2VT3A 4XGNA 1QORA 1G6KA 4YB8A 3DMYA 4XEHA 1DJQA 4AG3A 2O3QA 1PJSA 1EUCA 5JYEA 1W6UA 1ISIA 2D2IA 1HF3A 4RZIA 5KJ1A 2O3TA 3F9IA 3I52A 4Z9YA 1WAMA 1YE3A 2JCXA 4GX0A 4OHUA 2H6EA 1AUPA 2C7VA 3JYNA 3VKUA 3ZWAA 4HWKA 2Q46A 4ZRNA 1B7GO 2WYVA 5DCUA 1DAPA 4TRRA 3PHLA 2FSSA 3I9MA 4N54A 3RJ5A 1X7GA 3CEAA 1EBUA 3DAGA 4FFPA 4PRKA 2F1KA 4AJPA 4XYGA 4PG8A 3DBVO 2QIOA 4IXTA 5IN4A 3O4RA 1PS0A 4N5LA 4HNHA 5ICMA 2HJRA 3C8MA 2X9VA 1B3RA 5FEUA 4IMRA 4YACA 5IDYA 5B12A 1E3EA 5IXSA 1KERA 1PWXA 3IJPA 3WFIA 3H8VA 4P8RA 4F46A 1HDOA 4LRTB 4BKPA 1DLJA 3KSUA 1V9LA 3LT4A 2ZK7A 5JO9A 2Q4BA 2OMEA 3PWKA 1F17A 1A72A 2FRDA 2Y1OA 3TSCA 1G1AA 2HSDA 1I01A 3ZWYA 3BMNA 2ZB7A 3PGJA 1MA0A 3L9WA 2AQKA 3D0OA 2VHZA 3QA9A 4AJEA 5IJZA 4M86A 1XG5A 1DOHA 3ZHZA 3DBHB 2OXIA 4CLOB 1ZEJA 2VWPA 3PLNA 3GEGA 2CVQA 4CV3A 1UUFA 3NT2A 3AJRA 2CUKA 2FR0A 1PGPA 1OZAA 1R4MB 3M6IA 5CDYA 4D0SA 1KEWA 1T4BA 1JKJA 3KYDA 3EVNA 2B83A 4E12A 5IDQA 4MIEA 3TNLA 5DP1A 2AXQA 4P22A 4O63O 3N74A 3NX4A 3CUKA 3QVTA 3W4JA 3ITDA 4BO8A 1ISGA 3WNQA 3G17A 1CRWG 2GZ1A 4NBWA 4Y6RA 3GY0A 3KSDO 1A4IA 4S1VA 3D3WB 5LDGA 4XZ3A 3GDOA 1QRRA 3AY7A 2E37A 4DUPA 3ICCA 1CERA 1XWFA 3K2BA 3KXDA 1KY5A 2VYNA 1JKFA 2RHCA 3WGZA 2GN9A 2EKQA 4DBZA 4IDGA 3WQQA 1JTVA 1I3KA 1M75A 3KO8A 3PP8A 2G17A 2RH8A 5H83A 4AL4A 1GAEO 5A1TA 3V2HA 1E1MA 1ARZA 3OFSA 1JVBA
chains in the Genus database with same CATH superfamily
3N2LA 4N0DA 1JL3A 2GSDA 3FJOA 4KAAA 2FQWA 4CF4A 2VQFB 4D81A 5EPUA 1XZJA 4ZC1A 1H2FA 1OTXA 2AFHA 1X0XA 1Y0BA 2I3DA 3GJ8A 3B9QA 2BI4A 4OJKA 5KJFA 3CG4A 1EB8A 2CSUA 2NU7B 3N7UA 2I6QA 3EQZA 5FQNA 1F8YA 4EO4A 2WILA 4CTKA 3FTPA 3DWIA 3GG2A 4Y6SA 5IP5A 2LCQA 2QUHA 4J43A 3CVYA 1A27A 1KE2A 2J0UB 4CKEB 3VU9A 1IHPA 5LN1A 3H2KA 3H1FA 3M5DA 1K6EA 4NWIA 3ZDZB 1O0CA 5DBIA 4D6XA 4DVJA 4JU8A 2ZSFA 4C6RA 2QLLA 3BF8A 4IIGA 2AHRA 5JPDA 1L7QA 1TUEA 1RAAA 3E82A 3Q85A 4KBGA 3K32A 3UJBA 3RHTA 5TY0A 2VP5A 4JSRA 4QJBA 3AF3A 4U7GA 3LBFA 1G8JA 2AF3C 1QXSA 4UE2A 3A2NA 4WKNA 1DQRA 5CIWA 1CLEA 1U28A 2MCFA 1FVXA 1B8VA 3DHYA 4DG8A 4E51A 3BGDA 4U3JA 1JECA 1GNLA 1XJCA 4KK3A 1GA1A 2H4HA 3IMFA 4E13A 3AR5A 4UOEA 5MGBA 5IF3A 4CCYB 5HIKA 1N33B 2GETA 1K3FA 5TRTA 1FJGB 3AF2A 1UAAA 3GVHA 2ZUTA 4W6QA 3RTBA 2J3QA 3FYCA 2NVUA 4JP3A 5AXDA 3HP7A 4IDFA 4W1SA 5DT2A 3HDTA 1GYQA 3JRXA 2H63A 4MKHA 1YZKA 4WQMA 1EYZA 1RQXA 1HV8A 1WSDA 1O7JA 1YL5A 2P8SA 5KX5A 3U1TA 2VOJA 3QPUA 1H4SA 4CMBA 4QTTB 1I9GA 4JZKA 3PKJA 3B36A 2ZRQA 2E3JA 3SJZA 1Y5NA 2NVWA 1P18A 1UJBA 3CRQA 3RKUA 2C9YA 4M9RA 4BE7B 2ZREA 1KZ7B 4YJ3F 1F2TB 4MQEB 1II8A 4CV1A 5C2JB 3B51X 4G5FA 4YT8A 1QQ6A 5MHTA 1AKWA 4PPGA 5DGHA 2PQ0A 4FR2A 1WQ1R 3LTNC 4ZCPA 3CMMA 3WB0A 5TF0A 2TMKA 3KOOA 2ZP1A 5A4DA 3KALA 3PTZA 1K4YA 4JBYA 1BU8A 1UMCA 1E2IA 3IKMB 3H65A 3G23A 4FUQA 4TT3D 3V4SA 4BP8A 2YV1A 4JU9A 2N9UA 2BELA 2LVBA 3QEAZ 2PGNA 5J40A 1WXHA 2XECA 4AM8A 2GB4A 2XCIA 4W8HA 4E21A 4EENA 3OX2A 1YF3A 2EQBA 3U7FB 1O95C 3EGWA 1C7FA 1YOVB 2F8LA 2XDYA 3OUZA 4I1IA 4OFZA 3RYIB 1ZVMA 4WFIA 1F8GA 3UK2A 3DBOB 1RTKA 3LIIA 4D4HA 5A0TA 5CTAA 2BF4A 5D51S 2GTPA 3DO6A 4A0SA 4ZAVA 3PR1A 1F8FA 2A94A 2ZRJA 4Y9TA 3QE9Y 2EGHA 1VMAA 2ZJYA 1L3IA 2J31A 3L05A 3OM8A 3R6WA 1KWGA 3G1WA 4D43A 4IH9A 5C8YF 4XR9A 2WHRA 3IIKA 1Z83A 3MTBA 3T7CA 2X7HA 1XDBA 2DHDA 1MQ9A 2HD4A 4DMUB 4PQYA 1WUHS 3SYTA 4HNGA 4HRXA 3G8DA 4WNAA 4YRJA 3GI1A 4Z7NB 2WJHA 4NYIQ 2PUGA 1V8BA 2X41A 2ARKA 2P2NA 4IDCA 3DYVA 1XWIA 3SF8B 5LZ9A 1OXTA 3DDUA 2BMJA 3DMFA 1MAUA 3E9RA 1LQTA 3L8ZA 1E9EA 3TD2A 2O3RA 1WUYA 3R6DA 4R8VA 1VE9A 1ZWKA 3F49S 5F2OA 1VDMA 5ES4B 1L5HB 1XLUA 4MP8A 5AUNB 2WJPA 3E61A 1VG9B 4DPKA 1SQ0A 4YJFB 3SSNA 2RG7A 3AUJB 3UJAA 2ZE6A 2WK1A 4YTEA 4JHXA 3EIWA 3OG9A 5GVRA 5FDFA 3HR7A 5JD6A 2QZ9A 3R7SA 1FNCA 3G9UA 1E7MA 1O94A 4JA0A 5K03A 3R2JA 1QGAA 1TM4E 2HRBA 5DTIA 3KTAB 5HCIA 2J9GA 3AESB 4M0UA 5TX7A 1JFRA 2I7XA 3EQ7A 4ARBA 4BUCA 1QP7A 1V3VA 3T1QA 5AXAA 4LHWA 5D84A 4PSAA 5L40A 2C9BA 3ES9A 1CG6A 1DRUA 2Q50A 4OMUA 1XQVA 2XF8A 4DDVA 3UPTA 4TVKA 2BFWA 3G8BA 4LOJA 1WBDA 4YMUA 3U7JA 1JEEA 5LXTA 2BEUB 4FKBA 5DBEX 1O97D 2B8NA 3LQ2A 5EN4A 2XR1A 4C0SA 5CFLA 1JR6A 2E4UA 4WLFA 1N1GA 5FUYA 2LIPA 5DNUA 5HZGA 2Q2OA 2O14A 1MNAA 2RI0A 4YWJA 5LPNA 2OLEA 4QDJA 4DLUA 4URYR 3W8DA 4EUEA 1IG3A 2OV3A 1UAGA 1P80A 4DQVA 3MBOA 4FNAA 4RPJA 1U1FA 1UFQA 3B3QA 5ICSA 5DM0A 4S04A 5CM9C 3ABIA 5EEGA 3IA7A 2GK3A 4HVAA 1UDXA 2R66A 4CL2A 4BVKA 2OZVA 3ZHVA 2VJAA 3EBOA 5D3ZA 1G59A 2HDWA 1NMXA 1SZPA 2YDXA 2WVAA 3CA8A 1RI2A 2QZJA 1BE1A 3CONA 3ELYA 4IIBA 2VSFA 3O8NA 1R9JA 3H97A 4TTQA 1P2GA 3SSOA 1U4NA 3RUCA 1MXFA 4K40A 4GPD1 1DDIA 4OJTA 2YOFA 3ILYA 3TSWA 1SHJA 2ANBA 3K9GA 4XVRA 3K71B 3DNPA 1K8ZB 4D46A 3IESA 3A37A 8ABPA 3VUEA 2EKZA 2B2NA 3QMWA 5TMDA 2VC2B 2H92A 2A1IA 2BBTA 4N0EA 3GZJA 1MLDA 2FFRA 1UK6A 2VOEA 4HRVA 4PZ0A 2BFFB 5HVNA 3OOSA 1P73A 1U7WA 2HF9A 4NR0A 5AJZA 5A04A 1LSJA 2X6QA 1ONNA 1GQYA 1W5AA 3C5WP 3LCRA 4FYMA 4JLSA 3FZEA 1JU9A 3W6UA 2R1ZA 1XYYA 2IBMA 4QHTA 1YJXA 1RWXA 5CVJA 2ZWPA 1T4CA 1YZTA 2UXCB 4JUIA 1Q21A 4BGIA 3U9LA 1E20A 2IE0A 3VO9A 3PNVA 3Q1LA 4BUJA 1OAOA 3KP1A 2AZMA 3EBPA 2Z9BA 1G2PA 1KFKB 2K87A 2VPZA 1P72A 3BIJA 3KJHA 4Q3NA 5EZYA 4F8JA 4B84A 5KTMA 3X0DA 2DFDA 1QF6A 4PLGA 3UCFA 3FCOA 1P6QA 4IY1A 3LCCA 4DEVA 5ALVA 1EFRD 2BFPA 2PLWA 2QR3A 4DCJA 5AW9A 5CBKA 1JG2A 1V8ZA 1WU7A 5CGZA 3WTBA 4F9FA 1YI8A 1OASA 1R0RE 5K0EA 1P2BA 2R85A 3NWOA 5F1OA 3HTXA 5AVUA 2QTCA 1BOFA 2CW5A 4Q9HA 2GJSA 4AJ2A 3WO1A 4OBWA 1U7ZA 2NACA 4MR9A 1E0JA 3FWNA 3PXEA 4I66A 4BCBA 2Z2JA 3EPRA 4KXWA 4EQZA 4QLAA 4KJXA 3MWDB 1AQJA 2CV2A 2X8JA 3C0KA 4LIPD 2AC4A 3BJEA 3O7MA 4U7JA 3CF4G 1IJBA 4RV5A 1S2LA 3GLIB 3E8XA 1PR0A 3KLMX 4HYEA 1D4AA 1M1YA 5C35A 3CUSA 3VR6D 4ENVA 3G9QA 4BCCA 4F4FA 3CLTC 3IHTA 2J3KA 2ZE5A 3AVPA 5BSHA 2J07A 4Y7CA 1XDWA 4D9GA 2BEVB 3KAQA 4HEJA 5EP2A 5JCPA 2XJ4A 3OLWA 2CFOA 3KFLA 4BNUA 2UZAA 3LHIA 1ST2A 1JE0A 1VI5A 2ZRKA 13PKA 3PXXA 3QGMA 4K1XA 4E07A 1MFZA 4OBBA 1QK3A 1FYVA 1RU3A 1GY8A 2C5SA 2D1QA 5CUQA 2VK4A 1VTKA 4G5RA 4PV7A 1BU5A 4MPPA 3ZIAA 1GM5A 4JI8B 1CX9B 2WIAA 3FI0A 3ZWWA 2H9AA 2C2YA 1U7HA 2NTJA 4NF2A 4YP6A 4QG7A 3RUPA 1M6VB 1VYTA 2V4ZA 3HDHA 4HQLA 3N2KA 3ZGYA 3AUYA 3FE2A 3QE3A 4OMCA 4WBXC 4WT7A 2WHPB 4YQEA 2XAAA 2X9LA 1Z5GA 4KPFC 4BOYA 4TRMA 1DOAA 5DZSA 4JT9A 5CA0F 2BZSA 5JI2E 4XQ0A 1N1EA 1WXXA 2JGDA 2PN1A 1G21E 2Y68A 3FDIA 3LF1A 3P94A 4WXPA 1DTWA 1X38A 2IHUA 3C5HA 3HU1A 3Q9UA 3WZMA 3AM1A 3TX2A 4JEUA 2HQBA 2QMQA 1E1YA 1MABA 1QTNA 3DL0A 5EY5B 4EIWA 1IXKA 1K63A 1ETHA 3T7DA 1FTWA 1A5AB 3HWWA 2PKEA 3UQYS 3WFJA 4UPEA 2XCTB 2C58A 5AHRA 3UFXB 1XXHE 3N58A 1KS9A 2WOJA 1CD5A 4F38A 1XMSA 2WTXA 3JASA 2ZBRA 2VQSA 2D8AA 1KI7A 4XDYA 2BGLA 4HNAB 4QDKA 8OHMA 4QZVA 2N47A 1AUQA 5CTJA 3DGEC 2PZ8A 4WTOA 3C16C 4MUAA 3S0JA 3R7NA 5TQ2A 3VI4B 4E1AA 4QT4A 3X1YA 3SY8A 1UKYA 1WEHA 2EBHX 2QPLA 3AC0A 4L74A 5B4TA 2QLMA 3IHKA 4RSHA 1RYZA 1L5GB 4KYUA 4DTIA 2XKKA 2XBLA 5HM6A 5I7OA 2OHJA 3L07A 3CS3A 3OEHA 3S2FA 4IRXA 2ZJ7A 1EFPB 4PNZA 4C1BA 1HNZB 2D6FA 1CB0A 3WDSA 4LSMA 1E58A 4J0FA 2ZS8A 1BD3A 2G9QA 2HRRA 3E22B 4BUZA 2YOGA 3SXPA 2QZZA 5HDBB 2ZWAA 2YUIA 4ARZA 4G63A 4TV9F 1RXEA 3WQBA 4BQNA 4X8MA 3LXXA 2C4WA 3HEMA 3O1IC 4B79A 1W0KA 1YJ8A 5DO9A 2EZTA 3KXIA 3GNLA 3NQ41 1U0SY 4EPVA 1EVZA 4CHTA 2RB5A 4DBVO 1Z4PX 1X8KA 2FSFA 2NN3C 3HE3A 3MK31 5GWXA 4TZ0A 1Q6YA 2RGAA 4P35A 3CYFA 3M8KA 4FZ5A 4LK2A 5LB2A 1BAPA 1V7QA 3EODA 2IPNA 2HSZA 3ZVMA 3OPMA 3DYIA 5THQA 1XJWA 1Z6PA 1QAMA 4J6FA 4P08A 1M2WA 1ZRHA 1VPVA 3WLIA 5A5FA 5EJGA 2XLBA 1QNLA 1AK9A 3W6ZA 2H85A 4TSFA 3PSHA 2QTAA 2XA1A 1TAQA 4GT1A 3CWCA 5BPFA 1RQRA 2IOHA 3DTYA 4INAA 4URWR 3GFQA 4LV5B 1FA9A 2H08A 2X23A 1OYYA 1EX1A 2Q9CA 3MCAA 4EHLA 3ENKA 2EDCA 4P93A 4N03A 1Z5VA 4HX9A 1ULBA 4PM4A 3ET5A 5KSYA 2I6XA 2XOKA 4QIHA 4WCVA 3KV3O 4DJTA 3LDHA 2AG0A 3CSUA 2QU7A 1NKSA 2CNBA 4ZQCB 1X92A 3GRZA 3SBXA 1TCCA 1E7YA 2Y93A 1G8HA 3O4VA 5EJFA 1FNNA 3T1OA 1F7VA 1QMPA 3IVGA 5ITSA 4ILKA 1CFZA 2JI4A 2VVTA 1T3SA 3SZOA 3UHJA 4EZBA 2AOUA 4MVJP 4LZPA 4HN9A 3KOWA 4QUDA 1M2GA 1JQAA 1RM4A 2FPRA 2ZQYA 1FMLA 1UPAA 1PZMA 1QYRA 3BCHA 3E9DA 3EN0A 3K15A 5FWYA 2C3YA 1JBQA 1QWSA 3G6KA 4EAQA 1HG1A 1RXCA 3U56A 4M1ZA 2GCNA 2J9XB 2JHFA 1Z29A 3N7TA 3ONWA 3Q87B 1OMOA 2WTAA 4JJ8A 1WUKS 3DPSA 4BKOA 1QZTA 1JIJA 2HKIA 5BN4B 3TUJC 2FR8C 1QH8A 4WLOA 1RJWA 3ZXIA 4BMDA 1YBAA 1YCFA 1DAMA 3PNBA 1P0MA 1SEPA 2P9CA 3N05A 4MRNA 4UNIA 5DWDA 3TRJA 4P4TA 4BS9A 1N3LA 3EUWA 3HCCA 2BI8A 1O4WA 3HA2A 1SY7A 3UW1A 1SXGA 4Y6GB 1NBOA 4BN5A 3E8SA 5IH7A 3A6LA 2Y76A 4P83A 5HS4A 4ENRA 2GQ0A 4DMHA 1HKUA 1MENA 4LG1A 2WNSA 4NTZA 2QORA 2YX1A 3LHSA 4OH1A 1JF8A 1KDRA 1RLUA 1Y7IA 2FH5B 3NVDA 2WU3A 3FVTA 1L7OA 3KEFA 5TGTA 4RVFA 4V39A 3WGLA 1L9KA 1P1IA 1P5FA 4WPGA 4TS4A 2CVHA 4K2HA 4I4CA 2JFPA 4XYMA 1FUIA 2FPPB 5IJAA 2J08A 3NHSA 3QFHA 4MQLA 5DNCA 4D97A 1NLYA 1PJQA 1PX0A 4CMAA 3TLEA 1M34B 5EOVA 1WV0A 2R6FA 4LFBB 1T0HB 3QW4B 4HD8A 4FBMA 3QJ5A 5F7ZA 1X94A 3WLQA 5JNTA 2W0MA 2UZ1A 1L1QA 1UKAA 1Q2XA 3UAZA 4K6OA 3O93A 4L4XA 1GNPA 5C5DA 4PVDA 1SOAA 2P2CA 4CU5A 3K70D 5EYPB 3E5NA 4NHOA 5EQTA 1UIRA 4A5OA 5ETJA 3N28A 1VJ1A 1M2HA 5J59A 3RVOA 1SCAA 4GE3A 2ZSUA 1GIAA 3BH0A 4GQAA 3CY6A 3LM8A 1CR0A 4I5GA 5LYJB 2R11A 4V0OA 2R6CA 4W1PA 1LBIA 1JYEA 2BMDA 1PQ4A 1KE1A 2LP4Y 2D4HA 3HCDA 1KJWA 1T9GR 2G1JA 4BNFA 2VP6A 2NZYA 5EWMB 3FFAA 3MN1A 4JSTA 2V6GA 5D87A 1UJCA 3PUKA 4MB2A 1QNFA 5ED0A 5FA8A 2X0DA 5BY2A 4DRXB 2P77A 2EBWA 4QRHA 2DUMA 4R51A 4FSXA 4WXMA 3G5UA 1WP4A 3RASA 4JP5A 2P9GA 1N6NA 3DB2A 4DZRA 1AQUA 1BQ3A 2MR5A 4M1TA 5EWLA 5KYXB 3VM6A 1CEXA 4QATA 2M6SA 3VNSA 1NVKA 2D2XA 2NXEA 3D7SA 3O3CA 2WABA 2G08A 2VDWB 2W58A 3MJEA 2FWJA 3GLUA 1UBGA 2FRXA 2R2GA 3P9YA 2FHSA 5TS3A 4A0HA 1E6EA 1O4VA 3C3CA 5TS2A 4OLAA 1ENOA 1VZ2A 1X9HA 1RC0A 1YI0A 3DTVA 4KN6A 2ZJ8A 4MVCA 4O8ZA 3RQIA 3VZPA 2VJBA 2MJLA 4H3VA 4F2WA 3KKPA 4FE7A 4C89A 4YQZA 3LPLA 4M2LA 1TMYA 1Q7BA 1QCCA 1KFBB 4HDNB 3FFTA 2FR1A 2ZWVA 4P0TA 3R9KA 4K9MA 1CZOA 2IPMA 3K0AA 3R5SA 1X8JA 4BKMA 1V1MA 2AOTB 1RI1A 3REQA 3E4DA 4HNQA 5DBOA 4JI3B 3ZBQA 4P98A 4M0PA 2GM5A 3DVLA 2FPMA 1CY7A 4WEOA 2I71A 2J7PA 2PUJA 1CQPA 2AOXA 2F43A 2QAIA 2WFLA 3IUBA 3O3MB 4U0JA 5K0FA 2IH4A 2XWJI 3O73A 4OGFA 5J4YA 2TYSB 5ILQA 1HO3A 3CHYA 5J2TF 3WNCA 3COVA 4OI1A 3NBFA 1ISHA 1QIKA 3BMOB 1MHTA 4L5IA 4JP8A 4OQPA 5CEJA 3LY8A 1A2KC 5E9WA 4EI2A 1I30A 4G0UA 3CCBA 3ZJVA 2DBVO 3KYDB 2HIMA 4CDRA 3AB3A 5AJVB 1NN5A 3PLAE 1E0KA 1A7AA 1RQGA 3QSGA 4RE6A 3LX6A 2YFHA 1I6LA 4CKZA 3G0DA 2ZSEA 5BYAA 1H8HA 2W43A 1WMSA 2O7VA 4DDMA 4R7TA 3IP3A 3WYFA 1FW8A 3TXYA 3T5MA 1E2FA 1ZJZA 2FSVA 4POAA 2WHQA 4EL0A 2DR2A 2DUUA 1MOPA 1T0JB 1TLFA 3FROA 4MK4A 2A78A 3VH3A 4DNXA 3NJ4A 5DEIA 2V8BA 1DFGA 2NPFA 2JFNA 2DPLA 2OQIA 3MB8A 4URZR 1ZUNA 3RPEA 2WAAA 3STXA 5G4KB 3H3XA 3ST7A 1SEVA 4XX0B 4TYWA 1MG5A 2CXTA 3A2MA 3OM9A 1SHLA 5H8WA 1KH3A 4L5JA 3TL6A 3C7AA 4BYMA 1YRYE 2ZQZA 2OMKA 4C0BA 2R87A 1PNTA 2P79A 2H2AA 3FNQA 4UHDA 1UBKS 3QVXA 3OIUA 1TECE 2FOXA 3EPJA 3W6PA 2PXAA 2IIQA 2W2KA 1UINA 5BSMA 2WMOB 1US8A 2DBRA 1RJ9A 1AGXA 2YHBA 1ZY2A 5FRDA 2V3CC 4YUVA 3HB9A 2L69A 4C2UA 4REMA 1XTSA 4R0NA 2DKNA 2ZBQA 3WVNA 1Z28A 5CH3A 3CCFA 4NICA 4ZJZA 5K8CA 3T1NA 1XZHA 4EYOA 1J97A 2X4LA 1JHPA 4MS3A 3Q0IA 2PGJA 4B7ZA 3A1FA 3QX3A 4CZ2A 4F6LA 4LYHA 1KI9A 2Y1EA 2UZ0A 3EPPA 1TOAA 4POOA 5A62A 1JDNA 3HCRA 1MXHA 4PLTA 4F1KA 3SE0A 5B4UA 3R5FA 2WIKA 4LWZA 4TM8A 3WS7A 4YT4A 1U11A 4BLVA 4BDTA 1IN4A 1SVIA 4J3NA 2A92A 3DBHA 4E4YA 2IH2A 1OU0A 3QVUA 5BOSA 5CHEA 5F35A 4F9EA 2GUGA 3VPGA 1ZPDA 4MUIA 5DM60 4FMDF 1NV9A 1G18A 2DR0A 3TNYA 5FAKA 2Z3WA 2IHYA 5KAMA 1KMQA 3A28A 3T0FA 4B81A 3LDFA 3UANA 2Z04A 1M2EA 2CLDX 4LECA 1QYWA 3WB1A 1E3JA 2FX2A 2OCLA 3M83A 1C7QA 1OD6A 1VLZA 3QXJA 3F8WA 4EUHA 5EVCA 5FH9A 3PRHA 2V03A 1NNEA 3UICA 1E1KA 2FJ0A 1S6YA 1YDFA 2GT1A 2PRIA 3QVWA 5KIAA 1JPNA 2W4IA 4C4OA 5IRCD 1GUFA 4NFHA 1FDSA 2IC5A 2YN4A 2EFGA 4RPHA 4U5QA 4WINA 5AOVA 2DU8A 1Z16A 5KSPA 3C3YA 2P2GA 1RCFA 5EIXA 2G9UA 3BGWA 4JMPA 5D8DA 5KEIA 1GSAA 1HDYA 4HAWA 3ZZ1A 3ZCQA 4M53A 2EW1A 1T13A 4U6SA 2R9VA 1X13A 3PDUA 2YRXA 4DDWA 1NQXA 2FUG6 2QT1A 4FMPA 5DYGA 5I9BA 4Z49A 1BA2A 3JU3A 2VYND 3LNCA 2C7PA 1T9KA 1V8OA 1ODSA 3K4PA 3UT5B 3M6WA 4KJZA 1KJIA 1Q0TA 5IJ9B 1L5MA 5EHZA 1CJMA 2X0RA 4KAXA 2AMLA 1NJ2A 3NM4A 3PWTA 1YQEA 2AMYA 1R3UA 3EVGA 3Q88A 4QFCA 3A1DA 1LS1A 2VNKA 1FTNA 2VHCA 3CPEA 3HU5A 4D82A 5KC8A 5BT8A 2AD1A 3UTDA 1SRQA 1GU0A 2XJ9A 2IZ6A 4ZTBA 1M74A 5ELLA 1ACLA 3BGSA 4NYMR 3ODGA 4WCFA 1GKIA 1F20A 1CE8B 4JFAA 5J1TB 3S8EA 2I4MA 4NMXB 3NORA 4QODA 1FW6A 2I7CA 4MB6A 2Y1XA 1UOPA 3BFJA 3QZUA 1G20E 1H5NA 3L6UA 1LNQA 5JWHA 1O89A 1Q0RA 2PFKA 1QTIA 4J0GA 3EPHA 3WGJA 5JYBA 4YASA 1PR5A 3Q7QA 2IHVA 4C5BA 3G1UA 2JC3A 3OZUA 1DC4A 2FPUA 2XMRA 3QY9A 3VR2A 2JDID 4I4IA 4ZVRA 4KU4A 2OCAA 5ALKA 1JA0A 1ZZEA 2JRLA 2W37A 3D3JA 3F98A 1XZKA 4BQEA 4EGQA 3KQSA 5DW0A 1SUCA 1FL9A 2EZ8A 2Z3ZA 3AX6A 1MNQA 3HA3A 2EFJA 4GAEA 1STOA 4KB5A 5BSWA 1SKMA 4F3YA 2IUTA 3VNUA 4GZMA 4UVHA 2QTLA 3QOWA 1JJAA 3W79A 4NBRA 2ZSIA 4TS1A 2QAJA 3O4GA 4X60A 3TZEA 4RACA 2BTEA 4N47A 1ST3A 2JGRA 3MW8A 3MUOA 4DV0B 4PZPA 2VXOA 3LC2O 4AY3A 1FYEA 4NPCA 4M0KA 5L51A 1MX3A 2Q62A 3BHIA 4Q9LA 5BMOA 3GLFA 1VPDA 3BWMA 4AKSA 2CNWA 2OKGA 2QS9A 3W5VA 1WXDA 1QK4A 3C1AA 1D4OA 1XTIA 1WXFA 1X2BA 4MW9A 1XRSB 4ZDWA 2Q4DA 1A7JA 2ZPUA 1V2GA 3GVPA 4MWBA 2GLUA 2CLSA 2PT5A 4JK3A 2BV3A 1O6CA 5HX7A 2YN0A 1SPBS 1LQUA 3BFPA 1ORWA 3GG9A 1BKSB 1GL6A 2Z58A 5F21A 1PUJA 4I36A 4BPBA 3PUIA 1XVUA 2P2LA 3Q3GE 1H5UA 4HEQA 3TIXB 2ZR9A 3JRWA 1GR1A 3PJRA 3CTMA 1DO0A 1HQYE 3JQAD 1TQDA 3QOYA 2O05A 2ZZKA 4AVYA 4Q34A 3MXTA 2YV3A 2O2DA 2HGZA 1HE4A 4HXGA 4OHCA 4F21A 1PJBA 3LT0A 1W4BA 1C4WA 1ZLXA 2COKA 2E5FA 1FFWA 1XOIA 4P3NA 4DRZA 2H2HA 3VJRA 3PQEA 1ZMOA 2PSHA 3AWDA 4UVIA 3VSEA 2WAMA 2B61A 2P7IA 3W2HA 5ALPA 4YP7A 2H31A 2PGLA 2Q3BA 1J49A 4TLCA 2ZWOA 1JS1X 2JGAA 5JVDA 1I94B 3O8QB 4FSHA 1ZNWA 2Z9DA 1AVTA 1NJFA 1ND5A 1T25A 3I2GA 3NHUA 3KK0A 4XE5A 3VZQA 4JLKA 5KNCA 4WXRA 4FFOA 5BR4A 4EPWA 3M6AA 5JAPA 3IOBA 4XUEA 2H29A 5D1HA 1ZRNA 3RAEC 1LTHR 1QVVA 2QYOA 3FMFA 4GGOA 4LVCA 5HRUA 3SZMA 1IZZA 2BGTA 2JJ2A 1OVGA 3QBEA 3E9CA 1OX4A 3TX6A 3ZKWB 4AX4A 3GLQA 3OCYA 3HUDA 3FYSA 5E6SB 3G59A 1R00A 1ZNXA 1NF8A 1YB7A 1UMBB 4KXMA 5MF6A 2NUTA 2RHOA 2XKBA 3GNTA 4WK6A 5EGSA 1W8DA 2MYPA 2Q45A 3FY4A 5ESRA 5ERYA 5AHOA 1KNQA 1T10A 3I04A 4FNMA 4JNKA 1OLXB 3K2QA 4NAHA 1QRTA 4LI0A 1RD4A 3HUFA 3ADKA 2P9TA 4EHHA 2IYLD 4BWYA 3A31A 1BW9B 2PZJA 3GEHA 1YGYA 4CKWB 2G63A 2QIPA 2RBKA 5AWFC 4NOKA 2FLWA 3ZDRA 4HVLA 4J2TA 1WNTA 1ECLA 1GCAA 1TFRA 1YCHA 2WU4A 5T5QA 4JUAA 3TLBA 3OD5A 2MTBA 3ZWQA 3Q2KA 4AK9A 5BV0A 1O5OA 1PR4A 1VSQA 1AZTA 3PK0A 4R2WA 4RQUA 3ZWPA 4BFVA 1E3LA 5IC5A 4CCSA 4GGMX 5JOQA 3DXZA 4TKLA 2WJVA 2J9YB 1E9FA 1F3LA 1JT9A 3FHTA 3V7FA 1XPJA 4QLOA 4OQQA 2FSPA 3DNFA 2L19A 3QPBA 3PIDA 3RFTA 3V1TC 4EYSA 3NWPA 5GTDA 3AGPA 5CBPA 4LDJA 1HTBA 1F2VA 4MX8A 4Y3UA 5AVRA 1ZOSA 5B6JA 1T6XA 3FAKA 4BDSA 1GPDG 2GZ3A 4A1OA 1M8KA 3VVBA 3AY0A 4Q4JA 1GO2A 1GZ7A 4DARA 4JGBA 3I9LA 4E88A 3VYVA 1P45A 1Y4DE 4RTOA 1CUDA 3KQWA 2F1JA 2PS3A 3DLIA 4GLBA 4IL5A 3VKFA 4JX9A 3TQRA 4WERA 1CB7A 4G9BA 3GJQA 4B3IA 1UDAA 3ZPXA 2ZZNA 5F76A 3VNQA 2BMWA 3EG5A 3JATB 2JFFA 4IGEA 1APBA 1CQIB 2J7KA 1SM4A 5IBRA 1A7KA 1V37A 3C3PA 4GF5A 4L7VA 4RTMA 3WV5A 4C4RA 2JJ8A 2GYVA 4CI0B 1SUEA 2PT7A 4D5EA 3H9CA 3RJZA 4OKSA 4EK9A 4D02A 2YXNA 1W0JD 1N2EA 1JKXA 2BMFA 2DCUA 2X9NA 3K7EA 3LA8A 2YWJA 3U0VA 3EMVA 1Q2UA 4HZUB 3A3YA 1TQ8A 4WFJA 5JJBA 3QY0A 1NSYA 4QULA 5TQVA 4ROTA 3RB8A 1L7NA 1YKFA 1X1QA 3TIVA 1NMEA 1YVUA 1E2QA 5SZIA 1JQJC 3CNNA 4OQNA 4EI9A 3GJ5A 4F93B 1CNEA 3QW2A 2O7NA 5REQA 4Z9BA 1L5VA 1OTYA 1JQKA 1QIFA 2XT6A 1KI3A 2NTVA 1MT3A 1R4ZA 3PL5A 5IAJA 2DBZA 4JQCA 5BXYA 1NDUA 2KBEA 4MKRA 2K6GA 3RLFA 4LZNA 3N8GA 4IIJA 4KQ9A 2A5GA 4AMYA 1DKUA 4UCFA 1EQ2A 4B4KA 4O5AA 3ZY4A 1G21A 1QCYA 5EMHA 2CXPA 4XD7D 2ISSD 3BE5A 4MVWA 1IAQA 3IE0A 3OQIB 4Q00A 4GLJA 2I9PA 3PKZA 2YICA 2RGRA 2B1RA 1TAGA 4UBNA 3TTYA 2YHSA 3CGGA 1TEVA 3CKKA 2ZYHA 3GFBA 4OQXA 4JV5B 1WCWA 4OU4A 2P9HA 1XXHA 4Z54A 3KEQA 1CULC 3ANXA 1ECJA 1W5SA 4PQRA 4K2AA 1UJ6A 3FYUB 3QF4A 3EXEB 5EZQA 2WVJA 3ZEAA 2RI6A 3W2TA 2I6SA 1SVLA 3HWX1 3SEAA 1ABEA 3IQIX 1R5NA 3RROA 1EXWA 4YCLA 2OHGA 1E7SA 3T4UA 4CIAA 1B6GA 4JB0A 3BH7A 4BB0A 3OPVA 3Q7PA 3QG1A 3GPDG 2C4VA 1U4OA 2IUEA 3IQGX 4QQFA 4EEZA 2O2HA 2XWSA 4RTQA 1OY1A 1N5MA 2QN6A 1L0BA 3T4XA 1K2VN 4UDXX 4D9KA 5IPFA 1GQSA 1RC1A 1ZUWA 3MGBA 3PT9A 5CT5A 4ZO9A 2DT8A 4ZVVA 4ETWA 4HNVA 1VLVA 1W76A 2DLDA 3CN7A 3DXYA 5JPIA 4TXNA 5ER9A 4MJ3A 1FVFA 4V1CI 4QNNA 5FLYA 2FZCA 1U6JA 1L4EA 2X2FA 3GZNA 3I34X 5AJYA 4BVJA 2IXBA 3KUKA 4BIMA 1UPTA 2ZYTX 1YRAA 4CPDA 1M73E 2CHFA 1TA4A 2YNMA 3BA1A 3TD9A 4C78A 3SKXA 3F8SA 1XRNA 4AYXA 5BNWA 3MSCA 2VCHA 5KC9A 1N7GA 5DT9A 3AEUB 3KWMA 1KMHB 3UTCA 5FLXA 3AUTA 3LWZA 3CSSA 3GLIE 2RGWA 3L7YA 4TPKA 4GRIA 1WV1A 4B09A 1YQDA 2O8FB 1EGHA 4Q18A 3VVMA 3GMSA 4FYKA 1NVVQ 4C05A 3HJNA 3KOUA 3KZVA 4HAUA 1FX1A 4X3OA 1SXJB 1XF9A 3FUTA 2ZVPX 4BLPA 3KQKA 3AGQA 4K88A 1N5DA 4BX2A 2QRHA 5JASA 4PZEA 1CY8A 3ETLA 2PX4A 5FL3A 5KQGA 4PRLA 2R4UA 4ISBA 1Q0UA 5E4YA 2ECPA 3UH1A 3QLVA 5ALXA 1GQ2A 5A5VA 5FBHA 1N5LA 2F6RA 3GGGA 1XTZA 4AF7A 4FHGA 4UMDA 2BR3A 2IF0A 3DE1X 3IUSA 3AHHA 2I6FA 2XE4A 3ZZTA 1SZCA 1M1NA 3B89A 4BL5A 4NCBA 4PPYA 3H5NA 1TVMA 3JAKB 5LU8A 2PA3A 3OAAD 3MGGA 1Y37A 1IMOA 1CZHA 3NV7A 1UKZA 3LC1O 1K6IA 4Q3LA 4EKNB 1AK1A 1ZXLA 2PH3A 2PMKA 4H7FA 3N70A 3OPQA 2OFOA 4Q47A 1NUTA 1GARA 2ZXEA 3ZHSA 4LUCA 4R2MA 4HVCA 5KTPA 2EFDB 1ZWLA 2P8JA 2O8BA 2H2IA 4FCWA 3W34A 3UMBA 1B14A 2BDEA 1QO0A 3RR2A 5AW5A 3JAMA 4MGZR 3TECE 3FTFA 1UDWA 1P9OA 4X6LA 1EFHA 3N5CA 2OCPA 3TJZA 1E9AA 4ZI2A 3SJUA 5GJBA 1ZBQA 1J06A 4R5MA 3H2ZA 4G5QA 5L8VA 2Z83A 4GL4A 3MLEA 5MDHA 2FN3A 1QGDA 1NI4A 4FMCB 3OT4A 5BW6B 3BA6A 4GOLD 2V7QD 2NLOA 2HNKA 2PNJA 1GDDA 3P9SA 3W9YA 1B42A 4EYEA 4P3XA 2YXBA 3P9QA 4RMIA 1JJBA 2QTRA 4H1UA 1VFNA 4DHWA 3PHJA 2UYGA 3FDZA 4J90A 3KIPA 1F51E 2W8BA 4NATA 1FUEA 1GLNA 1FLNA 1LJ8A 4Q3KA 3IV9A 1Q1ZA 2AG1A 2WT4A 3DXXA 2IUFA 4ZOEA 2C2BA 5BVGA 1ID1A 4LYFA 3UYLA 2C57A 3RVBA 1JIUA 1NVAA 3MAJA 3UHFA 2JJ1A 4ENQA 1JR3E 2JGEA 5K99A 1OIWA 1ZGJA 2XNHA 4LC9A 2P1RA 3CX3A 3ZXSA 1JG4A 3MVEA 1QB7A 5EC8A 3RUAA 1QC5A 3IRVA 3TAUA 1XXLA 4DCMA 2A5YB 1ZH8A 1I2BA 4F4DA 5EJ9A 4RLSA 2HZBA 2HZ7A 1IVNA 3G1TA 5J23A 3JD1A 1VBKA 2A84A 4MVJF 3TL3A 4BVHA 4XUGB 3VXKA 2BM8A 2GKOA 4ZVOA 1P4SA 5B64A 1YZYA 1TTHA 1LF0A 2OZEA 2HCBA 3DHVA 3PUXA 4KOEC 1RWNA 3S44A 3SDZA 4DDHA 3EA4A 3KUXA 3SI7A 1DTSA 2FOLA 1WM1A 3D9QX 3W9UA 1WMFA 5GONA 2RHWA 3VVCA 5KYGA 2VDJA 2Q3MA 4PINA 5BWNA 3LY5A 2IIVA 1S4QA 3GHYA 2ZRFA 2PNFA 3O91A 2UUPA 4F7DA 2I29A 1QQBA 1DOZA 1XRRA 1VFPA 3IDQA 1OLSB 1JDVA 1R1DA 1SCUB 3ZJYA 2CFRA 4F5YA 5JC8A 2V45A 3L0IB 4G65A 4B3CA 1QQAA 1XZGA 4RA9A 2DH5A 4FB4A 2A9RA 2JHCA 3PNQA 3COYA 2KWIA 2O4CA 4RHYA 1OFGA 3GRCA 1KFEB 1NXXA 4RD2A 2WJZB 1TUGA 5I9MA 5TPWA 3SIRA 4EHFA 4XRGA 5TVKA 4OHMA 3TO5A 1Y7LA 2CSXA 3VYRB 1SOMA 2WIGA 1WPQA 4JROA 5CLLA 1GG9A 1ZM3A 3UK7A 2IUYA 2Q49A 4DREA 1PJCA 3X1DA 2XNSA 5T8KC 1A9RA 1WBJB 2IF2A 3EIXA 4CKBB 3CJRA 4DG9A 3OEED 3R0JA 1IUKA 1J09A 1E5XA 2HJSA 3THOA 1OWOA 4H16A 4DS3A 5E1OA 1BDJA 2UZ3A 3I8SA 2GN4A 4H59A 4PO9A 4Z9XA 5AD1A 3QEJA 2ZRLA 7AT1A 4HJRA 4FFSA 1F0KA 3ROXA 1R6XA 3HDJA 3FIJA 3OIDA 4GVXA 3SX2A 4F3TA 4MW1A 4X1YB 1ZVQA 5FYQA 1X39A 4BNKA 4A10A 4UVEA 4CMJA 4OB8A 1M8FA 3QNMA 3OJOA 5KNCH 4BQSA 3JALB 1D2RA 1EHYA 2JI9A 3FGPA 3QKWA 4BASA 4X8HA 2FP3A 1OH7A 2VXBA 4RZ3A 4FOLA 1FNBA 2I91A 3KZOA 5ALMA 2EP7A 4PO8A 3CKYA 3KZXA 2JIZD 3R5JA 1GNQA 4WOPA 5E3IA 2QRVA 3FYUC 4AY2A 1NP6A 2BBOA 1A98A 3HCEA 1NIPA 1Z07A 3P4XA 2Z1NA 1ATIA 5KSZA 4PR0A 5CDUA 1UANA 3SQOA 5LZ2A 1RKUA 5D86A 1LPAB 4GVPA 3SHQA 4V3CA 3OLZA 3A4MA 3AL2A 3MINA 3OECA 5DB4A 4KE9A 5EE1A 2RKBA 2YUTA 5AT1A 1JAXA 4M99A 4UMEA 2W2MA 1EGAA 1QRSA 2ZJ3A 2VWHA 2ZJOA 4OIMA 5LZ5A 1U9CA 3QPVA 3NW9A 5LU9A 3PX7A 1HDEA 1NMQA 2ID4A 4NC9A 5H3CA 3AFOA 1H1DA 1QHSA 3DM9B 3OWHA 2MYUA 5BQ5A 2WJIA 2YFQA 2CN1A 1MR3F 3AF1A 1UBMS 3OX3A 3OX4A 4IRUB 5ILGA 1BFKA 3ZS9A 4D6PA 5I7VA 5JY1A 3N5KA 1B8NA 1NIJA 1M34E 5FUMA 4Z53A 4NE9A 2BH2A 2HWKA 4MQFB 5EQJB 1CNMA 3VTKA 3D6TB 5HP4A 1JNYA 1C1XA 1D8AA 2UUCB 2XSZA 1YB2A 2HFJA 1V5EA 2Z57A 3L6RA 2OP1A 2WAYA 1YRLA 2C0QA 4OHYA 4WWHA 2XW6A 3NHPA 4GWKA 4Q3EA 4W9RA 5BSRA 4RLQA 4YXWD 3QMVA 5KYKA 1P33A 3DEAA 1GLGA 3T5DA 3WA6A 3ZTYA 1V3UA 2ISQA 2YR0A 4JJKA 5FWXB 2WMNB 5KVVA 1QHIA 3WLPA 2QB5A 3Q7RA 3WYBA 3WB9A 2JZCA 1SVOA 3JVUA 2WWXA 4H6PA 2I7TA 3OCCA 2WD9A 4BNVA 1RAHA 4X91A 4RQTA 1SXJC 1P2DA 3L7AA 5DV9A 2DKFA 1ZG3A 1HLPA 4KVAA 1J1UA 2QTVA 2HMYB 4CFZA 1KI6A 1VB5A 4R1SA 4RA6B 3D0QA 1U2RA 5DM4A 5I7AA 1G66A 4QGHA 4U2GA 3VZBA 3U7HB 2JBHA 2WUGA 4OXQA 1DQYA 5KWVA 1RC8A 1YR1A 1FFDA 4FC6A 2RC5A 4DOMA 2ODBA 1X74A 3Q11A 3CVOA 1Q5PA 2NUPA 4YAFA 1JB1A 3F7TA 2IV3A 1BOOA 1RLJA 1WUIS 3ZLJA 1Q16A 2GXAA 3CBGA 3CZQA 1XVVA 1XVLA 2J30A 1RD