4AJLA

Rat ldha in complex with 3-(ethylcarbamoylamino)-n-(2-methyl-1,3- benzothiazol-6-yl)propanamide
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
330
structure length
328
Chain Sequence
ALKDQLIVNLLKQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 119
structure length 328
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajlA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajlA02
4O6VA 4BNKA 1P1KA 4DLAA 3ULKA 4RO0A 4BO8A 5AXCA 1JVBA 2DC1A 2WYUA 3MEQA 1L7DA 3RSHA 3SBOA 3VH2A 4PG5A 1LQUA 3TZKA 4DC0A 1E6EA 1EQ2A 1MXFA 4JN6B 4M87A 4B3HA 1XGKA 4IDDA 4AG3A 1U8XX 2VWHA 5ILGA 5IFLA 3KM0A 3RUIA 1DIGA 1RM5A 2C82A 3WX0A 1U7TA 4BGEA 2O3QA 2YFQA 4HBGA 1BG6A 3KEQA 1FJHA 3NGXA 3AU8A 4J2HA 4DREA 5KKCA 1HYGA 3PHGA 4ZQFA 4FS3A 2FPPA 1DEHA 4WOKA 5KVQA 4NFSA 2JCXA 3NT4A 3NAQA 3IUPA 4YQYA 5JAIA 3WFJA 3HN7A 4FD3A 1MV8A 4L76A 2VUSA 1AXGA 3H3JA 4HP8A 1ULUA 3DZBA 3OJFA 5BSHA 3B20A 1LUAA 3QIVA 5IDXA 5BNIA 1UZLA 2UUPA 4KUGA 1VE9A 2PK3A 4II2A 1ZSVA 4XZ3A 5TQVA 3GF4A 5CDUA 5AXBA 3C8MA 4HFJA 4B8WA 1PGOA 3TFOA 1NX6A 1PTJA 3HUDA 2D1YA 1GV1A 2HJRA 4BO7A 1CJCA 4DBZA 1MLDA 2X58A 4GWKA 3JYOA 4UEOA 2CF6A 4GX5A 4ROSA 1GPJA 3VPXA 3ZU4A 3L6DA 3DB2A 1P1HA 3PI7A 3E8XA 2Y05A 1P74A 1YWGO 1T1RA 2DBVO 2HK7A 3EAGA 1E3SA 1R6DA 3RUCA 3BTOA 1LDEA 1ZSYA 3Q3CA 2WWRA 3B70A 4MVJF 2FZWA 4GWGA 5BSFA 2GYYA 4WPGA 3TZQA 3JTMA 3IUSA 1CERA 1CQJA 1QXSA 1UZNA 2GUGA 1WZIA 2WE7A 1P0CA 4QFCA 1DFHA 3LF2A 1ZEJA 5U4QA 3TSCA 4J1TA 2D8AA 4IJWA 3JD1A 4Z6KA 1GQ2A 3GT0A 4R1TA 4DQVA 3TN7A 2Y1GA 1R37A 4Z0TA 4OMUA 2Q49A 3ZHBA 3C24A 3UGKA 4A0SA 4XWYA 5DF1A 4IJVA 2O3TA 1NNUA 2Q3EA 2PTGA 2AHRA 1PQWA 2IE0A 4FBGA 3MCVA 3RBVA 2B83A 3DFUA 3DC2A 1OC2A 2RHRA 1ZJYA 2H1SA 3EUWA 4GGPA 3AUTA 3TOZA 3O38A 2E4AA 4DUPA 4LW8A 1U9JA 1LX6A 4AJ4A 5CPBA 4HKTA 5C7LO 2YW9A 3JQGA 4OQZA 2JFGA 3VTFA 3WTBA 4PLTA 1ENOA 1GEEA 3GK3A 4NMHA 2P9EA 5ITWA 3U4HA 2NM0A 2HMVA 1E3IA 2AEJA 4KQWA 3OQ1A 1XLTA 1KYQA 4IMRA 2H6EA 5JDIC 3JYNA 3BTUA 5T67A 4UUOA 3ROMA 3DDNA 1LDGA 3OFSA 1FXSA 2GD1O 3DZKA 3FNHA 4D7AA 4IXTA 3MOIA 2P9GA 1H6AA 2R00A 1HE3A 2NADA 2X4GA 5T64A 3RUHA 3AY7A 4F45A 1ZMOA 4BL5A 4CM3A 1E3LA 1EVZA 4XQGA 1XEAA 4P4LA 3ENKA 1ZZEA 2HMTA 2VZ0A 3JQCA 3OQBA 4EDFA 5F1PA 2PV7A 1WDMA 4BNJA 4D79A 3HQ4O 4TVOA 1EUZA 2J6IA 3RUDA 1OFGA 1I24A 3PYXA 4R3NA 3MWEB 1M67A 4U6QA 4WEOA 2C07A 4BNWA 1JKIA 3FNFA 9LDTA 1I3NA 3P5SA 5JO9A 3LLSA 4IS2A 3K2EA 3PXXA 1TLTA 1EDOA 6LDHA 1O6ZA 1DJQA 2X8LA 3TWOA 1YL7A 5K9ZA 3I9MA 3S55A 2FWMX 1CWUA 1RYDA 1EMDA 4L4RA 4QUKA 1IOLA 3LZ6A 1LLCA 3IQDB 4DGSA 2EJVA 4WASA 5B12A 2ZJ1A 1YBAA 4IUYA 1PJ4A 3A9WA 4MVJH 3H8VA 3GPIA 3GA0A 4WNIA 2E6UX 4CV1A 1QR6A 1IY8A 1VPDA 5G4LA 3BTSA 4OSOA 2B5WA 5KTKA 1XWFA 4ZA2A 3ZW9A 3JQBA 1OBFO 2IZ0A 2YFHA 3PWKA 4BGUA 4BO4A 4K1LA 4O59O 1Y81A 3H5RA 4FFMA 4QFDA 3NGLA 2VZ8A 5I9LA 1IZ9A 2CVQA 5TRTA 2FR8A 2J5RA 2F00A 4WCFC 1H2BA 4FFLA 1K6IA 4IQ8A 1HLDA 2FMUA 3H3FA 4UVDA 4IY1A 3VZRA 1P9LA 2ZTMA 3O8QB 4Y6PA 2YQ5A 1V35A 4BQRA 1HE5A 2UAGA 4WK6A 1LSOA 3T4EA 4D41A 4TKLA 4XYEA 3BHJA 3STHA 5IN4A 1NAHA 2J3JA 2SCUA 1AUPA 1BDMA 1C1XA 1HETA 1Z7BA 2RH8A 5HA5A 3E5MA 1ZK0A 1I0ZA 3ROKA 3EDMA 4RDHA 1WWKA 5HS6A 1ADGA 1MC5A 2Q1TA 3Q9UA 3RVDA 3LU1A 1PS0A 3DBHB 3WSWA 2UDPA 4RQUA 4BV9A 1DFIA 4K26A 1NR1A 3NT2A 1WLYA 4YA6A 5CDYA 3KEOA 3AUSA 1EK5A 1B26A 1TT7A 3ZI0A 1KEPA 4GKVA 3PQEA 3ASUA 4YACA 4CL8A 1QYDA 1SCUA 3INTA 4A10A 1NFQA 2PZMA 3G0OA 1C1DA 2ZK7A 5JBIA 3PPIA 1I3KA 4PVCA 4DIFA 4EEXA 2OP1A 4PLCA 3GAZA 1MP0A 2VRCD 2DUUA 4RF2A 1IPEA 3H9JA 1W4ZA 3RUAA 4XYGA 2JKVA 4MO2A 4RLSA 3ANNA 2VHXA 3S2EA 4BNZA 2NTNA 1U5CA 1KETA 3C1OA 3WLEA 1HDYA 1VKOA 1E0DA 3ADOA 5L45A 1E5LA 4XB2A 5DDIP 1J0XO 4TQGA 3LYLA 4IDFA 4GX1A 5BSEA 5T6BA 3E1KA 2P4HX 5AQ1A 5U9CA 1FDSA 4N7RA 3CSDA 4J49A 5TS3A 1ZK2A 2W90A 5KVVA 2Z5LA 3PHLA 4IQ0A 3E48A 3GMSA 4GLOA 1PJBA 4O0LA 3NTRA 5IDYA 1NHGA 4I5EA 4E5MA 4FSHA 2Y1OA 5TJHA 4C7JA 5A4DA 1E1KA 2X0RA 1KBZA 4WLUA 3U4IA 2VHYA 4J90A 3GUYA 3RQSA 1XQ6A 1V3UA 4ID9A 2PR2A 4YJFA 4JGBA 3LT2A 5IAAA 3DEYX 1Y8RB 3D5TA 4XKJA 5KKAA 3OP4A 4MP8A 1E7YA 4KUEA 5DOZA 5L40A 3LLVA 1NVMB 1P1IA 4I5DA 3O8QA 4BB5A 1KC3A 4DWVA 4GSLA 1PJCA 3GDGA 4E33A 4OH1A 2HRZA 3GNTA 4CMGA 1Y6JA 2PGLA 4XYBA 3RAJA 1GY8A 4D0RA 3TZHA 3RCBA 2C0CA 3T7CA 4XGIA 3FSRA 4BS9A 1V6AA 3AFMA 2TMDA 2J3HA 3H9EO 1XQ1A 3DBHA 2OP0A 2WJPA 2PZJA 3KVOA 4Z9FA 3WBBA 3C7AA 4E13A 1DLIA 2YV2A 3R3SA 1GPDG 3JQEA 4DMMA 2AXQA 4LMRA 1U4OA 4JROA 1HEUA 5I9MA 3PZBA 4MJLA 3OA2A 1BXZA 2C20A 1MGOA 3IP3A 1X0XA 3HDJA 3S8MA 3BHIA 4BB6A 1H94A 2H9IA 3JQ6A 2NVWA 5T8KC 1XU7A 5B1YA 4QQRA 4E30A 2CSUA 3QVWA 3OF2A 4E5NA 1XELA 4WLNA 3JYQA 1LSSA 1UDCA 3PQFA 4DQUA 4EEZA 2ZTUA 5IDWA 1WNTA 2FOIA 3CPSA 2Y1DA 2WTBA 2V6FA 1NPYA 4Y6SA 3K92A 3K5PA 4MOWA 2NVUB 1LQTA 2ZTVA 1LSUA 3HZZA 4JNKA 3CXRA 2FY8A 5JYDA 3M2TA 1GTMA 3PZRA 3AY3A 4NBUA 4RZHA 5KJ1A 3DOCA 3A06A 3JQAD 5L3ZA 4BV8A 4J7UA 5B4TA 5KCZA 2BFMA 2PGDA 3ONDA 5K6AA 1DDOA 4BMNA 3GHHA 1YKFA 2X86A 3GGGA 1NQOA 2CF5A 2JCYA 3WMXA 4B4OA 2I76A 2VT3A 4WE3A 1OZAA 1HDCA 5ICSA 3K31A 1B3BA 1A5ZA 1PJ3A 1WZEA 2D5CA 4L74A 3KYBA 1HE2A 3ZV3A 2VHVA 1DC3A 2Y66A 3DBLB 4H3VA 5JCXA 3F46A 3PIDA 3UF0A 4YRAA 3SJUA 1KVQA 3JQ7A 3JQDA 1A27A 4NPCA 2VOEA 1JWAB 2NACA 3R3JA 4XGNA 2FHSA 3DWFA 2A4KA 3P19A 3F3SA 1E6WA 1H6DA 2AG8A 4G5HA 5H82A 2Q99A 1EE2A 1X13A 1A4IA 1GCUA 1ENPA 1ISFA 3WNQA 2PGJA 4FFOA 5L9AA 1VC2A 4CM9D 2E48A 1VL8A 3E6AA 4QECA 3CH6A 3OJOA 3ZWVA 5I9NA 1SB8A 1Q2XA 2HDHA 1ARZA 2O2YA 1F0YA 4MIEA 5GZ3A 1XR3A 4I9UA 4EGFA 2EGGA 4LK3A 1AGNA 1UXIA 4UVGA 3W8DA 5CDGA 4BKRA 1AE1A 2NV6A 1ZVMA 3SXPA 4BKQA 3AM4A 3PFFA 1PJ2A 4PG6A 1YB4A 2BFOA 2O23A 1O8CA 2A94A 4INAA 3C85A 4BNXA 4BO0A 3VZPA 3ZWXA 5IN5A 3AFNA 4LMPA 2EKLA 3P2OA 4TRJA 3LK7A 1HSOA 5A04A 5JSFA 4DL9A 1SOVA 5KVSA 4FFRA 3GVCA 3AJRA 3BMOB 5JMPA 1EDZA 2NTJA 4K6FA 2QHXA 3ON5A 4D0SA 2NVUA 3MJCA 1KS9A 4BO9A 3AUUA 1GZ4A 5KJCA 2QX7A 2JL1A 1C0LA 3WGYA 1BVRA 2DPGA 4GBJA 1PWXA 4KUHA 2JHFA 5DCYA 2R00C 4TRNA 3WG9A 1BTOA 1QYXA 1G0OA 1UXHA 3OM9A 3DQPA 4RVHA 3QWFA 3GH3A 3U4DA 5F5LA 4A26A 3JD2A 3ITDA 3HB4X 2UYYA 5DBFA 3FPCA 2J5QA 1HDXA 3QVTA 2TMGA 3NRCA 2Q2WA 2AMFA 1DIHA 1M66A 2QG4A 4JX8A 5LC1A 3RFTA 2X7HA 1VKNA 8LDHA 3V1UA 3ZNPA 1VM6A 4JCOA 2O4UX 3U9LA 1K6XA 1Y5MA 3DBLA 2VUTA 4ND2A 3O03A 3VAZA 1ZK4A 1OC4A 2A9FA 1DRUA 3WGZA 4JQCA 2W4QA 1H9BA 2UUOA 5KJEA 5JCJA 4B4VA 2O3UA 3SX2A 4E4YA 1PGNA 4E5PA 1PQUA 1J4AA 2F1KA 4JBHA 4UREA 1IULA 2YV1A 4FFPA 5CPFA 3HFGA 2YZ7A 3WWZA 2ZB3A 4NH4A 2VHZA 1G1AA 1EQUA 3QV1A 3MWDB 4A7PA 1UP4A 2AE1A 5JC1A 3BMNB 4GH5A 2C54A 2VYVA 3EMKA 4P38A 3AI3A 4GI2A 4J7XA 1GUFA 5A5FA 3EVNA 3ZW8A 3WGGA 1EBFA 3WQQA 5L7TA 1IL0A 1EVYA 1XA0A 4J4HA 4NBRA 4P8RA 4PG7A 1F06A 3V2HA 2CDBA 1D1TA 4MIOA 3WMWA 3ZGYA 1WMAA 4CM8A 1NVTA 1LC0A 4TVBA 5AOVA 4EJ6A 3LF1A 4KTVE 3JQBC 3VVBA 3WGQA 3GVHA 3QA9A 3ADPA 3PDJA 4BHTA 5J23A 1XYGA 3B1KA 1P44A 2EP5A 4LSWA 1PJTA 5JCJD 3ZNOA 2X0NA 2RHCA 4GX2A 2E37A 4J3FA 4LISA 3U3XA 1HTBA 5IJZA 2E49A 4FOSA 1IZ0A 1GZ6A 3E82A 3RROA 4AJNA 4Q3AA 3V1YA 2X23A 4FQ8A 1Q1NA 4PRKA 3AY6A 2OFPA 1SMKA 2J3KA 3L6OO 1DRVA 3RUEA 1ENYA 3I3OA 1XIVA 5CDTA 2IZZA 3PLNA 4W6ZA 1U2GA 2CY0A 3VPSA 4YJHA 2I5PO 1T26A 4TZTA 3D7LA 3KHUA 1MXHA 1PU2A 3KOUA 2QIOA 3AK4A 3D3WB 5JC8A 4WGGA 5AXDA 2DBQA 1DSSG 4IMPA 2VWQA 1EBUA 2V7PA 2HLPA 3NTQA 2I3GA 1CQIA 1T2EA 1BXKA 1YQGA 5COQA 3PEFA 4EJ0A 1M2WA 1P0FA 1TT5A 4IZIA 1U3VA 1YDEA 4DRYA 4ITUA 5LDGA 1B3RA 2VYNA 1MC4A 4XR4A 3WR5A 5THQA 3JQGB 2IEDA 4E2WA 2HRBA 4U7WA 3QW2A 3ANMA 4HNGA 4PLGA 3K6JA 1DIBA 2DM6A 5BT9A 4R1NA 8ADHA 1T4BA 4JBGA 1LA2A 3GRPA 4E2ZA 4B7UA 4QO8A 6ADHA 2DAPA 1K0UA 3FPLA 3GDFA 1WDLA 3QHAA 4IDCA 3ZWOA 1PGJA 1NWCA 2OGUA 1WPQA 2O7QA 3BMNA 1NQ5A 4W99A 1YOVA 1W8DA 2OOSA 2VNSA 3IOYA 1K3TA 4CM1A 5JY6A 5JDCA 3FNEA 3GG2A 5ITVA 3DAFA 1UJMA 1A4UA 3GQVA 4CLOA 4WKGA 5I8WA 3B6ZA 2JD0A 1XDWA 3M6IA 4RVGA 3FRJA 3O4RA 3PGJA 4PGFA 4PLYA 4QT0A 4RF5A 3X2FA 3HNPA 4ZQHA 1QYVA 2VNAA 4ALKA 5A9SB 5L51A 4D3SA 3H9UA 3U0BA 3N7UA 4E6PA 5G0TA 4FIZA 3GVXA 4YAKA 1ZEMA 1DRWA 1IYZA 2GRAA 4G65A 4W7IA 4E5YA 5I7VA 1NHWA 3EGOA 1KVSA 3H7AA 3H9QA 3VPHA 1YXMA 5AXAA 3NKLA 2YJZA 3ETDA 3PJFA 1HLPA 3DZHA 2Y0CA 4GPD1 4I5FA 3K2BA 3KZVA 5IXSA 1A71A 1CF2O 5B4VA 3GG9A 3GMDA 1GYPA 3INRA 3NX4A 5BSGA 4CV0A 2HQ1A 1TXGA 4XX0A 5KIAA 3QSGA 3GGPA 1XSEA 4ZQGA 3OMLA 1B14A 2EWMA 1AHIA 2PA3A 5F3RA 1ZFNA 4NI5A 2GASA 1GD1O 3PJDA 4IBOA 4URFA 3KRTA 1E6UA 2NU6A 2O50A 1FF9A 3D3WA 1U7HA 4ZN6A 4EUEA 1VJ0A 3JSAA 4BGIA 4HFRA 3V8BA 3Q11A 3W4IA 5BNTA 5JAZA 2EW8A 1HL3A 1T24A 5DCUA 4DQXA 3F5SA 4DPKA 4RPKA 3DBRB 2LDXA 4D43A 2VWGA 3LQFA 2O7SA 3R6DA 4HFMA 4W9NA 2O3RA 4HADA 1EUDA 1UAGA 3W8EA 3I6IA 3L4SO 1N1GA 3MJVA 2NSDA 3RI3A 1ZSNA 2FSVA 4XDYA 2PLAA 4QO7A 3VDQA 1KY5A 4J0FA 5B37A 4BKUA 1ZJZA 3WLFA 4BMSA 2P5UA 4OL9A 2R6JA 3G79A 5G4KA 2W98A 1N2SA 3C7DB 4Z3KA 1M6WA 2C5EA 5ER9A 3OIFA 2DFDA 1BWSA 1DHTA 3ST7A 4AJOA 4DVJA 4BNMA 1DOHA 4IGEA 3EYWA 1KVUA 3NDRA 3ZV5A 5KJ6A 2I65A 1O94A 4YCAA 1LU9A 1IHYA 1LDMA 3L77A 3BMQA 4RPGA 3EZYA 4MPDA 3S2GA 3RKUA 4PCVA 1BDBA 2IZ1A 1BW9A 2VCYA 3KSZO 4FCCA 5FF9A 5IF3A 4PVDA 9LDBA 4DC1A 1C1XB 3G17A 4XR9A 3K96A 1JN0A 4LGVA 2G76A 1T1SA 1BSVA 4RDIA 2GR9A 4J9UE 2WE8A 3VC7A 2WD7A 4BVAA 5A9SA 1BRMA 3S2IA 3RFVA 4ZICA 3JD3A 3PIIA 3K30A 4Q3CA 3A14A 3K8ZA 2EV9A 3W4JA 2A92A 3ZHYA 3IMFA 3WGTA 3KLMX 1AN9A 5K6AC 4KDFA 1KY4A 1LTHR 4GSKA 1QV6A 3WXBA 1N7HA 4MIYA 1N5DA 1R0KA 3TQHA 4ILKA 3C1AA 1JAYA 1C1DB 3JQ9A 4Y8VA 4LRTB 1NWHA 4ZQEA 3WIDA 1T25A 3TL2A 7MDHA 4F3YA 2ZIZA 4J6FA 4MVJG 2BELA 3F9IA 4C7KA 2EHDA 1Q0LA 5THKA 3E5RA 1H6BA 1K6JA 3DZGA 3C3XA 4CMAA 3GR6A 4KQXA 1C3VA 4R69A 2HU2A 3GHYA 5TSDA 4CM4A 1I30A 2FZEA 3OIDA 3WGOA 1RPNA 2B4QA 2V6BA 3PTZA 4XJSA 4XRRA 3RC7A 4PG8A 2HSDA 3DBRA 5L95A 4WLEA 5JAMA 2B35A 2WYWA 4CQMA 4HNHA 4UVHA 1Y5RA 5FFFA 4DYDA 4B3JA 2NU8A 3VHRA 4KOAA 1VSUA 3F4LA 1NASA 4YAIA 3E9NA 3EY4A 1D1SA 1E77A 3SJ7A 3EVTA 4R4JA 4YAJA 1LI4A 4RQTA 4YJFB 1NR7A 1OI7A 3ZWNA 2LDBA 4IQGA 1A9YA 4NK4A 4M1QA 3ZHXA 2NTVA 2V65A 2X9GA 3QE3A 1I33A 1C0IA 1Z74A 3DL2A 3FN4A 4NBWA 3NT5A 2GGSA 2P91A 1T2AA 4CMJA 3MJTA 4CLDA 5FI5A 4BQPA 1I2CA 2FN7A 2Q2QA 3ANLA 4IDEA 5L7WA 4KWIA 4BO1A 1GUYA 1PZGA 3FI9A 3PP8A 3O26A 4FOOA 3VPFA 2VRBA 4CLRA 1F17A 4UUPA 3DBVO 4R3WA 3HB5X 3I1JA 3OEWA 3ZWWA 4U8GA 3IAHA 4ZQBA 2DU8A 5EJ2A 5FI3A 2OXIA 4D3FA 4HV4A 4JBIA 4YB8A 4BKPA 2Z1NA 3NDJA 4MVJA 4RCVA 5DP2A 5EQFA 2AE2A 4JIGA 1NPTO 1E3JA 3BIOA 1HDRA 3IKVA 3ORFA 5I8ZA 1N1EA 1I32A 1O5IA 5I7FA 3BZUA 5H83A 4M55A 4XQEA 3OICA 3RD5A 4EW6A 3GFGA 1N8KA 2I67A 4BKOA 2DPHA 4CM6A 4XEHA 1PR3A 4IDGA 5EL0A 5F1OA 3V1TC 4D46A 3L07A 2RAFA 4E2YA 3K9QO 4UEJA 3BTVA 3CE6A 5TF4A 3LSYA 4DYVA 5EIOA 3W6ZA 5IG2A 2AQIA 2JD1A 3TZCA 3AUAA 5TGDA 2EF1A 2HCTA 4YBZA 1JAXA 3FWNA 1F14A 2CDCA 1KEUA 3ZV6A 3I23A 2PD3A 3NUGA 3JQFA 3JCZA 4NBTA 2EXXA 4E5KA 4RLHA 1ADCA 1B8UA 3GFBA 4AJ1A 4CUKA 3PHIA 2WMDA 2PZKA 5HRUA 1I3LA 2YDXA 4YR9A 1Q7BA 4CMCA 1MA0A 1E3EA 5T57A 2DVMA 4UUMA 4PZDA 4EYEA 4XRGA 3VKVA 3VDRA 4AJHA 5IZ4A 3KETA 2CVOA 1GEGA 4JJFA 4J1QA 1YRLA 2NNLD 5TIIA 4DPMA 1DPGA 1A7KA 1ADFA 4PLWA 2NWQA 1Q0HA 2AG5A 2VT2A 2X9NA 4NR0A 2OO5A 3OJ0A 5CG1A 1T2CA 2C7GA 4E31A 4QSMA 1U1IA 1UXKA 3X2EA 4A03A 2ZATA 1E1MA 4JXKA 1J6UA 5IDQA 3GGOA 1PL8A 3C1TA 1FK8A 4ZVVA 2VTDA 3EHEA 3F1KA 1GU7A 3M2PA 4CR7A 4U5QA 5DN9A 4GX0A 2BGLA 2P4QA 2IXBA 4E32A 3JQ7B 3W4KA 5KWEA 1PL7A 2AA3A 5CAEA 5HWSA 3E9QA 4BNLA 1X14A 3D4NA 3HWRA 3VOSA 2VWPA 3NV9A 3I9KA 2I99A 2Q46A 3QRWA 2CVZA 1PZEA 4P22A 3DFZA 1C0PA 3RC9A 5HTOA 3TL3A 3H5NA 5JMWA 2WEKA 5L7YA 1VJ1A 3SEFA 3HE3A 2EW2A 4YT5A 4XA8A 3RU9A 4J43A 4OHUA 4DXHA 2V6GA 3IJPA 1QMGA 2C5AA 1ZIDA 3IP1A 3O9ZA 4I08A 1EFLA 1P1JA 1I5RA 2HO5A 2QZ9A 2YHUA 3MJSA 4GGOA 3JQ8A 3DOJA 4CR6A 4HY3A 3GNSA 3QVXA 3BAZA 3D0OA 2C29D 1L1FA 1CYDA 2RIRA 2OHXA 5TT0A 4II3A 4YYZA 4Z3DA 4TZKA 4XGKA 1LDYA 3BMCB 3KUXA 2AQ8A 1VJTA 1S7CA 1XU9A 4KWHA 2EG9A 1DJNA 1HWYA 5TNXA 3UICA 1RM0A 3A1NA 4TROA 4TKMA 3DMTA 4WLVA 1SEPA 3D1LA 1EZ4A 1FDUA 3WTCA 2Y0EA 1N92A 1NQAO 2Y1EA 1IE3A 4ALJA 1Z82A 1E1LA 4LSMA 2EEZA 4W4TA 1LXCA 4PLZA 5JDCC 1E7RA 1UXJA 3ZU2A 3NDIA 1J5PA 3KXDA 1U5AA 1X7GA 2DT5A 3DAGA 1YONA 3GVIA 3A28A 4OQYA 2R2GA 1VSVA 1H93A 1QLHA 1MB4A 4MDHA 2I66A 3ROPA 4BNNA 3EZLA 1WDKA 1K5HA 3Q9NA 4CMIB 4OIMA 1ZCJA 4BUCA 4DIOA 3IC5A 1MX3A 2G17A 3DR3A 4ND1A 1WMBA 3IIEA 2X6TA 2NQ8A 1ZKMA 4UUNA 3FF4A 4N5LA 4YAEA 4AFNA 1JKJA 1QRRA 4XDZA 2X5KO 3RC1A 4MVJM 3UFXA 3HDHA 5JLAA 4LCEA 4NK5A 3ZWPA 1YQDA 3QWBA 3LVFO 3VH4A 2Z1MA 1DAOA 4Q3NA 1FDVA 2HK9A 3LT4A 4AJIA 4CLHA 4O1MA 3U4CA 2JD2A 5AYVA 4R16A 4FFNA 3JV7A 3ASVA 4F6CA 1GV0A 2YY7A 1R4NB 1YQXA 1MG0A 4UULA 4AJEA 5CEFA 1KVTA 4L4XA 2HAEA 1GCOA 4CV3A 3ZU5A 1Z73A 4B8ZA 4TSKA 1EEHA 1PJQA 2GN4A 4BMVA 1E5QA 2CMDA 1UDBA 1DC6A 3PLRA 4FN4A 4FJ1A 3R0IA 4W9NC 3AW9A 4CM8B 2XXBA 5L53A 5KJFA 1IHXA 2Y67A 4I5GA 4RL6A 1P33A 3QWIA 2GN6A 3ICCA 3RKRA 4RF4A 2VUUA 1U8FO 1GYQA 2W2KA 2HMSA 1C14A 3BMCA 3GNQA 4DTIA 1MFZA 3SLGA 4J9VA 4C4OA 3I5MA 1K2WA 5HBRA 4E12A 5G0SA 1QKIA 4AJKA 3FTPA 3W1VA 1IUKA 4FB5A 2DFVA 1LRLA 5JO0A 5F21A 1YB1A 4A5OA 2C7VA 1Y8QB 2RBEA 3RWBA 3NYWA 1PJLA 5HS4A 4N5NA 4I8XA 4F6LA 4K9DA 1BGVA 2GO1A 1Y9AA 2Y93A 4MKXA 2FP4A 1Z45A 3PHHA 4YJHB 4WCFA 3I52A 4MVJI 5IXYA 4JJIA 5EN4A 3TFQA 1PS8A 1Q7GA 1QV7A 4OSPA 1K89A 4EUHA 1WP4A 2P2SA 4OXKA 3ONFA 1QLJA 3WB9A 4DBVO 4F46A 4JJGA 3FR8A 4CMIA 1P3DA 1ZH8A 1PEDA 1U4SA 2PFGA 4OOFA 4YQZA 3GY0A 2GZ2A 4D3DA 4EUFA 4PG4A 1M6HA 1HDOA 5G2OA 1TT5B 1SEVA 5A1TA 3JQ9C 1HYHA 3BYZA 2AEFA 4GL4A 3I9OA 1SO8A 1I2BA 1U3UA 3QY9A 1NXQA 2AQHA 3I4CA 4FW8A 3KYDB 2AW5A 2G0TA 2PD6A 3NEPX 4BO3A 5L4LA 1ORRA 1YDWA 2JHGA 4ND4A 1ZNQO 1P1RA 1XG5A 2PH3A 5ICMA 1R4NA 4ALMA 3CUKA 4U6SA 5A03A 3TDKA 1E1NA 4Q3DA 4CMHA 2UVDA 5DNAA 4LCJA 2EKQA 2BI7A 1NTOA 1YOVB 5DOVA 4BNHA 1R15A 4E0BA 4NDNE 4PLFA 3K73O 4CLOB 2P68A 3ETEA 2B5VA 2QYTA 2BI8A 3WBFA 4AJPA 3AOGA 4ESOA 2JFFA 4MKRA 4YWJA 4FPXA 3WGIA 3ZU3A 3HHPA 5JE8A 3B1FA 1WXDA 4IZHA 4J91A 5DULA 1ISMA 1YO6A 4BNVA 1WAMA 1TVEA 4GMFA 3N58A 4S1VA 3S2FA 4UAGA 1UP7A 4GMGA 4AVYA 3ZWBA 1ZK1A 1ZUD1 5F1KA 3B1JA 1KEWA 3I6QA 1YH3A 3ZHZA 2H63A 2O3SA 3HFSA 4WOJA 4E3ZA 3GZNB 4L75A 4UVEA 2ZCVA 4CR8A 1DIRA 1XKQA 2ZYGA 1T4DA 1Y8QA 2BRUA 3GEGA 4IM7A 1ISGA 2VYVD 3MOGA 3G1UA 3WOHA 1C0KA 5ENDA 1KEVA 4NNJA 3U09A 1KC1A 1GZ3A 4FC7A 4TMFA 1R66A 4BNYA 2EP7A 2D2IA 4IJKA 3KO8A 3D5QA 3AM3A 1B0AA 5EINA 1D8AA 4HXYA 4NFYA 3AU9A 2CZCA 4IDBA 4IIUA 1PL6A 4BNIA 3KV3O 2XOXA 4J1SA 4X54A 4Y98A 4ZU3A 2QZZA 1TEHA 3UCEA 3NJ8A 3PJGA 4E21A 4ZGWA 4R51A 4R9SA 3I83A 2EERA 2WDZA 4Y6RA 2ZQZA 4XQCA 4N5MA 5A05A 3DZFA 2DTXA 3WSVA 2OMEA 1LJ8A 4GVXA 1B8VA 1ZW1A 2FPGA 4CLEA 1KVRA 5G0VA 1E7QA 1S6YA 5G4KB 1RJWA 3SLKA 3VVCA 4YPOA 2D0IA 3QVSA 4MINA 4L73A 2IYPA 2ZB8A 2EJWA 3GOHA 3KTDA 3KYDA 5FEUA 4RF3A 3RASA 2Y1FA 3IS3A 1Y7TA 4OM8A 1H2HA 1EVJA 2QRJA 1X15A 2B69A 2HMWA 3H2SA 3BMQB 3JQFC 1UP6A 4GAEA 4Z0PA 3SVTA 1LNQA 1F12A 5CG2A 5T8KA 1BW9B 3V5NA 3Q6IA 3TZ6A 5GZ1A 1HT0A 2AEMA 1LEHA 2X22A 4I9HA 4QEDA 3PWZA 4CQLB 2NLOA 1UXGA 3QWHA 1Z6ZA 2JAPA 1X1EA 4J0EA 4U0KA 4M8SA 2GLXA 1PQPA 1N9GA 2WD7B 1ML3A 3PDUA 4RPLA 2YHIA 5TX7A 1KOLA 2JAHA 4AJJA 4CJXA 4WUVA 1ONOA 4NBVA 1GDHA 4XYMA 1GUZA 1QSGA 4KP7A 2HKIA 3U5TA 1ZXLA 2QRKA 2VYND 3RJ5A 3BXXA 3FCOA 3LC7O 1R4MB 3PJEA 4KDEA 1B7GO 1B8PA 5JS6A 2VOJA 4IIVA 3AI1A 3WYBA 1ONNA 4YAGA 3D64A 3GN1A 4CM5A 1HZZA 1OMOA 3GZNA 1I01A 4ZJUA 1LLUA 4NJMA 1ZMTA 2C59A 3ONEA 4A2CA 1GAEO 5CEEA 1X7DA 3RUFA 4J7CA 5C37A 3CEAA 1Q0QA 1QP8A 2GERA 4KTTE 4OKIA 3TOXA 4W7HA 5JAQA 3OEYA 5EERA 5IZCA 2WYVA 1JTVA 1P77A 3OETA 3QWAA 1LLDA 2C2YA 3CIFA 5GMOA 3OHSX 4NU5A 4CM4B 3WYCA 2IODA 2X5JO 1VLLA 3HSKA 3IDSA 4RPJA 1D4FA 3EK2A 2YQ4A 5B4UA 5HM8A 2DUWA 1SB9A 4YEDA 5EQDA 4ZRMA 4CQMB 1D3AA 1A72A 4FJ0A 5TLSA 2HMUA 1DXYA 4YJGA 4O63O 3TJRA 1PR9A 4KZPA 4MP6A 3KSUA 2QYSA 3PQDA 3OJEA 3BHMA 5JW6A 1N7GA 5FWNA 1X0VA 4B3IA 2QW8A 3BA1A 4JP3A 4B7XA 4ALIA 2BLLA 3AM5A 2C2XA 4YT2A 4BNFA 4FGWA 3KYCB 5C7IO 1V0JA 1E92A 3WIEA 4BNUA 1HZJA 5COBA 5JXWA 4QXMA 1B2LA 2OORA 1ZO8A 3AI2A 4WJZA 2W2LA 4D42A 3GLQA 2OZPA 5LCXA 2BFAA 2GCGA 1TI7A 1PSDA 1V8BA 1PZHA 1DC5A 3DMTC 3Q0EA 3QP9A 1BXGB 3I9NA 4PN3A 5EMHA 5L4SA 4CQLA 2DTDA 2NVBA 1GL3A 1SPXA 1LSJA 3LT1A 4R41A 4CMKA 3WS7A 4CLRB 1XHLA 3U62A 1Y1PA 5AVOA 1LLQA 5A9TA 2Q45A 3HDQA 2NU7A 4S3MA 5GZ6A 4IXWA 2JJYA 3H9GA 1J49A 4HUJA 3PFWO 3FR7A 1R4MA 3I9JA 2ZTLA 4Q3EA 4ALNA 4FR5A 2GSDA 3ZNQA 1JKFA 4CMEA 1IPFA 2W2LD 3DZIA 1WVGA 1M76A 3ZN2A 4RVUA 5DBIA 3OECA 4I9NA 2VZ9A 3UW3A 3HJAA 1YJ8A 1IB6A 3JD4A 3MZ0A 3PK0A 3LC2O 4DPLA 4WLOA 1W73A 4R1SA 5GY7A 1E3WB 2PKQP 4BO5A 3FTNA 3MTJA 3VPGA 4GKBA 2IEBA 3VH1A 5ENVA 3DAPA 3ZV4A 3DONA 4EJMA 2FR1A 5FYDA 5COAA 2XXJA 3CZRA 4G81A 1PGQA 2NUAA 1PS9A 3TF5A 4TWRA 4GLLA 5DP1A 1SBYA 3LT0A 4MKZA 5EPOA 4CV2A 2WM3A 4YJDA 4M49A 3LDHA 3EW7A 2PKRA 4WNCA 1SC6A 4Z9YA 1YB5A 1AHHA 2P9CA 2YUTA 4YRBA 1GADO 3A4VA 4O5OA 1ZBQA 3ZH2A 4P4GA 4NQZA 4CMBA 2ZKLA 2D4AA 3ETGA 3UVEA 1EFKA 3FBTA 1VL0A 4MP3A 1E7MA 3GRKA 3HN2A 3ZWMA 1Q7CA 3KYCA 3PWSA 2DQ4A 3CMCO 1I3MA 4UEKA 3M1LA 1FDTA 1T2FA 1GFSA 4NZ9A 1NBOA 1PZFA 2D5AA 5K0ZA 4OO3A 4B79A 4NG5A 3S1LA 1QYCA 2DBRA 4PRLA 5TJ9A 1VL6A 3RFXA 3AOEA 2BF7A 2Q1WA 1HDGO 1R16A 1BXGA 1NQTA 1L7EA 3COSA 2Q4EA 4B4UA 4CQMD 2B4TO 2J5KA 1G6KA 2GN9A 1JW9B 1LDNA 5I7EA 5F5NA 1O0SA 1NFRA 2I3AA 1Z75A 1ZXBA 3KB6A 2YDYA 5C7OO 2J8ZA 2Y99A 2GPTA 3PGXA 5G0WA 3V2UA 2G82A 3H6KA 3OSUA 3QQPA 2Q4BA 1HF3A 3KLPX 5C5IA 4N54A 4P4NA 4ALLA 2B0JA 1RM4A 4NU6A 5A3JA 3L4BA 2GNAA 2PD4A 2Y68A 1P31A 3W6UA 3ZDFA 1G0NA 2VRCA 1ISHA 1YBMA 3CMMA 5CHEA 4H15A 1H9AA 4PZCA 1FDWA 1OAAA 2H5LA 1CRWG 3L0DA 2DLDA 2XF8A 3JQ8B 1ZK3A 1RWBA 5A3VA 5LDHA 1DLJA 2BMAA 5KOIA 4BOYA 1E3WA 4IDAA 4BIIA 4OOEA 1NVGA 2FRDA 2ET6A 4BGVA 3JD0A 2JCVA 3DHEA 4CUJA 2GF2A 4RV9A 1CEQA 5T5QA 4RZIA 3ICPA 1UUFA 1DFGA 3AWDA 1ISJA 4YTEA 3E03A 3U49A 2VQ3A 4MVJD 5A02A 4IGFA 1MFPA 2GDZA 1GYRA 1EE9A 3Q2IA 4QX6A 1KERA 5H81A 1P1FA 3JQAB 2BFPA 4H16A 4AL4A 3VZQA 4BNGA 4HWKA 4CL3A 5U1PA 2OL4A 4PLHA 5G0UA 1DC4A 1JDJA 1JQBA 3F6YA 2O2SA 1ONPA 1U28A 3CINA 4J1NA 1H0KA 3IJRA 5KNLA 5CP8A 2HUNA 1YS4A 3RU7A 3T7EA 1ID1A 1NM5A 4YT8A 3HDYA 2GN8A 3CZMA 4U0JA 3OJLA 4ND3A 1HKUA 3RC2A 4R68A 2HJSA 3GUCA 4FC6A 2V6MA 1LC3A 5BNFA 3UAGA 3WWYA 7ADHA 3ZWAA 2FSSA 3RBXA 1X7HA 4BO6A 1F8GA 1XCBA 4XQ9A 3WJ7A 3UUWA 1OOEA 1D7OA 3UCFA 3UKOA 2D3TA 1VI2A 2J3IA 4JP2A 1AXEA 1CETA 1W0CA 2GZ3A 3WNVA 1RM3A 3ABIA 2EIHA 2FR0A 4FJ2A 5JNLA 1A7AA 3KSDO 4D45A 1PGPA 1V3TA 4J4TA 3F4BA 3WQRA 3OA0A 4B4WA 3TRIA 2Y1CA 3I9LA 3R1IA 3SC4A 1F8FA 2EGHA 3PVZA 2DKNA 2O48X 1V9LA 5A5EA 4LVCA 4OGWA 5DBGA 1W6UA 2ZYDA 4BNTA 3GC6A 4HX5A 1GR0A 2AQKA 1GQQA 3RBZA 4EBFA 2X9VA 1NP3A 4J16A 5ILOA 1B15A 2CFCA 2I9PA 3F47A 3MJ4A 4KMSA 4DLBA 1GQYA 1BMDA 4I1IA 3MJEA 2ZQYA 3FD8A 5ES3A 3VH3A 4DLLA 4XYLA 4XIYA 4RVDA 2W2KB 2E82A 3OIGA 5ER6A 4FDAA 3DXFA 2Q2VA 4NHEA 4Q9NA 4Q3BA 1HE4A 3L9XA 4RORA 3ZNNA 5TC4A 1ADBA 3LC1O 2YV3A 4CM7A 4D44A 1UDAA 1LDBA 3WFIA 3V2GA 4YT4A 5C3MA 1HRDA 2PY6A 3FWZA 3UH1A 2WD8A 4IPTA 3PYLA 1JA9A 1JVSA 5KVCA 3WYEA 1H5QA 4OKNA 3NTOA 1LBEA 3JQAA 3QVOA 5DCWA 1JLLA 1V3VA 1O9BA 2POQX 3QLJA 5BQFA 3T4XA 4ZRNA 2Q1SA 3UN1A 3FBGA 4Y67A 2XPCA 4HFNA 4WCFB 3VZSA 1O89A 3WGHA 4L0QA 2IDZA 1M75A 2D59A 5I7SA 4E2XA 3PYMA 3H5AA 4XJTA 2CUKA 3EC7A 1U3TA 3GEMA 1NYTA 1PWZA 2OBYA 5JDIA 1SNYA 1NPDA 2RCYA 4G2NA 1HDZA 3W8FA 2BH9A 4EZBA 2B4RO 3DO5A 1CDOA 4WECA 5EESA 4FGSA 4LVUA 3RJ9A 1I10A 4XB1A 1KIFA 3UHAA 2CD9A 1RYEA 1TA4A 2BHLA 3DMYA 1B16A 1YL5A 2BGKA 4JK3A 1UR5A 1ENZA 1E7WA 2QQ5A 4L8VA 2ILTA 1HXHA 4OYRA 3GPDG 3UCXA 5JYEA 5CFZA 4LN1A 3PHJA 4PZEA 3F1LA 2BGMA 2OBNA 1BHSA 4IJUA 3CTMA 4CM9A 4TRMA 4Q39A 4NFHA 4TRRA 1Y8RA 3VKUA 5IZCC 2X5OA 5JY1A 1R0LA 5JPIA 2X0JA 3JYPA 4L9RA 4R54A 1SZJG 1NFFA 3TNLA 3GAFA 4YRDA 4Z9XA 3GZ4A 2X0IA 3DZJA 4CUZA 1X1TA 2VN8A 3DHNA 3N74A 3H65A 4PLPA 3P7MA 4OJNA 2QRLA 1DO8A 1YJQA 4RPHA 4ND5A 4Y9DA 1R12A 1YBVA 2X1HA 3H4VA 1YL6A 3H2ZA 2JFHA 2I6TA 2RH4A 4GQAA 4QTZA 3ITKA 3UOGA 2GZ1A 3ZZNA 1VRWA 3TPCA 4UVIA 5DT9A 1BVUA 4RVFA 3D3EA 4AICA 2P5YA 2PH5A 3PRJA 4AJLA 2IXAA 3NJ4A 4R5HA 4DIBA 3E18A 2Q1UA 1WW8A 4BO2A 4OXNA 1DBVO 1HYEA 2ZJ0A 2ZB4A 2O4CA 3ROQA 4CODB 3Q1LA 3MTGA 4K6CA 4RJTA 4PFJA 1H6CA 4YVFA 1TB4A 2Q50A 1EVIA 1LRKA 3WJAA 1UAYA 2ZCUA 3E9MA 2OUIA 4R01A 2ZB7A 2VTEA 3OQ6A 4GVLA 1O95A 3M1AA 3IL2A 2NU9A 2A35A 2VHWA 2YYYA 4R9RA 2EKPA 4XIJA 3WQSB 4DA9A 1QYWA 1Y9EA 1QG6A 3JYLA 1I2ZA 2UV8A 1EUCA 2DTEA 3ENNA 2WSBA 3FHLA 5ADHA 5MGBA 2XAAA 3QJ5A 4PLVA 1DAPA 4ONEA 5L4NA 3G49A 4CMEC 1DHRA 1E7SA 3CKYA 4A73A 5CDSA 3OBBA 1U3WA 3I4FA 1PJSA 4Z0HO 3WDSA 4N18A 4OAQA 2IRWA 5MDHA 1I8TA 2PWZA 4EI2A 1U2DA 4YXFA 1T2DA 1LRJA 4WLFA 2G5CA 2CNBA 3P2YA 1MG5A 1RKXA 2G1UA 3IKTA 3G1TA 2O3JA 3DOOA 2BD0A 3GDOA 4JLWA 1R0SA 1PIWA 4EITA 4CPDA 2NQTA 3HADA 4XCVA 2FPIA 2ZYAA 2Z95A 3KBOA 3Q2KA 2DBZA 3HG7A 2PZLA 2W8ZA 2B37A 2BKAA 4AJ2A 3GN2A 4R5MA 1FMCA 1N9GB 1DB3A 3VTZA 2YHIB 4J2OA 4NIMA 4ZD6A 3OH8A 4MVJP 2CDAA 5BR7A 4NJOA 1PX0A 4R1UA 4YDRA 1YE3A 2Y0DA 5A06A 4CLXA 3G3EA 4RVSA 1YGYA 3ZWCA 2HK8A 3RIHA 3WICA 4WEQA 3DTTA 2PKQO 5CEJA 1UH5A 1Z7EA 4NJMB 3UXYA 4RGBA 5A9RA 3SC6A 1JWBB 4W82A 3DHYA 3AOEC 4B7CA 1ISIA 1I36A 3L9WA 1NAIA 4IS3A 4MVJE 4WCDA 4IINA 4K28A 3ZWYA 3GEDA 1JU9A 4L4SA 3GVPA 3INGA 2B36A 1YVEI 1SAYA 1A9ZA 3FNGA 3ZCXA 4OXYA 3C7CB 4LRSB 4M54A 4M86A 1CIVA 1ULSA 4J4BA 2PNFA 3BMOA 1QORA 1SOWA 4ZHSA 3D4PA 4M89A 4DMLA 5TT1A 3F5QA 4H7PA 1DIAA 3L4BC 1P45A 5JFOA 1UZMA 3D4OA 2IYOA 4YJGB 4A27A 5DZSA 1HSZA 1MUUA 4XD2A 4PIVA 3DTYA 1EK6A 3L6EA
chains in the Genus database with same CATH superfamily
1IU9A 2YICA 1RLUA 3D2BA 3GLKA 4NESA 4NS4A 4O6VA 2HYDA 4BNKA 2XGJA 4EGAA 3ULKA 3G2HA 4RO0A 1XFDA 1DCTA 2WYUA 3NKVA 1L7DA 1EA7A 1EQAA 2DP4E 5EQJB 3SBOA 5F35A 3X0DA 5C80A 4MUXA 3TZKA 5E1MA 4DC0A 2AZMA 1E6EA 1EQ2A 1MXFA 3HRHA 1MQ9A 4F2WA 3R77A 2O7NA 3MBIA 2VWHA 5ILGA 2WSIA 5IFLA 2PXCA 2QLLA 2RG7A 3EFOB 1DIGA 1V11A 3AYXB 2HU5A 4GICA 4HBGA 4OMCA 2QTLA 3IOCA 3KEQA 5DFAA 2BTQB 3OT5A 3S99A 4TKVA 1JMYA 4ARZA 4U7PB 3RYFA 4EFMA 2C0QA 2WZDA 3DKIA 3PHGA 5F23A 4AF8A 2YRFA 2FPPA 2Z08A 3MXTA 4RKQA 2JRCA 3CE9A 1B6GA 5KC8A 1XEWY 4NFSA 4R8MA 5EP4A 2COEA 3NT4A 3O8LA 2OA0A 3B6IA 1NBEA 1E1RA 3PCTA 2W5UA 4HP8A 1TX4B 3BL6A 5SY6A 3B20A 1LUAA 1YZNA 4IFBA 4MTLA 3T41A 1NNI1 3OQJA 5A4AA 4ZYYA 2B61A 2CVHA 1XCLA 2C2KA 2FEOA 2PK3A 3I5AA 4LQLA 4OD0A 4TYQA 4CU5A 1DL5A 1ZSVA 2YINC 1LPSA 1Q3HA 2ZUVA 5AXBA 1SVWA 1PGOA 4LHSA 4N40A 3C7KA 1PTJA 3BGVA 3HBAA 2RKOA 3HUDA 4EW3A 2HJRA 5DHUA 1CJCA 1G55A 1QR2A 1WJGA 1SIWA 2BDUA 4TS9A 4A2WA 2CF6A 4GX5A 4K9MA 3VPXA 2CWWA 1W85B 3L6DA 4F4DA 3CISA 3OTIA 5LQDA 1AQNA 3EXEB 1T1RA 4KLCA 2A0FA 2J9XB 1E3SA 1R6DA 3FFAA 1O96B 2DFPA 1Q7TA 2BIFA 4CHTA 1ZSYA 4D3XA 4LOHA 2CBZA 1YA4A 4G5OA 4FGUA 4LZWA 2UZIR 2ZRNA 3DKRA 3NONA 2BAGA 4GWGA 3T12A 1Z07A 4B8YA 2GYYA 2MHCA 4WPGA 5BSFA 3IDZA 5J2UF 4L8GA 2JGRA 1QXSA 1XZGA 3SBXA 5KNBH 1P2DA 4JJEA 2ZROA 1UMKA 1KZ1A 4V02A 1A9RA 1WZIA 2BFNA 2D1FA 2WE7A 1I6MA 1DFHA 1V41E 2HPZA 1CJTC 3LF2A 2KW5A 3TW0A 3I01M 1R8SA 1L6IA 3QOWA 3T4UA 3R3YA 5BN5A 3FMOB 1YIOA 5U4QA 2OBFA 1YT5A 3E35A 2D8AA 3O9VA 4PCLA 4IJWA 2PJRA 4P81A 5ALXA 3GT0A 2RHMA 5FBLB 3KDAA 5H59A 4A15A 4DQVA 1JAZA 2Y1GA 1R37A 1TW3A 3QI7A 1FYFA 4Z0TA 4LBWA 5CX4A 2CMGA 1JPUA 3BSYA 1SVLA 4IJVA 1EHIA 2O3TA 1AQIA 3IPXA 1VG1A 1J56A 4BDTA 4IRUB 3W2EA 3OOJA 2AUMA 4IEIA 3K9LA 2J09A 1Q20A 1U0OC 4TM7A 3K71B 4LTMA 3IOBA 3DC2A 1O57A 1KFEB 2GZHA 2H1SA 2ZJZA 2GD2A 5EFOA 1XV5A 3Q5GA 4GGPA 3AUTA 3PFCA 4MGKR 3TOZA 4B6GA 5TARA 1WEKA 1U8YA 2E4AA 2WAXA 3JAWB 1XDDA 4TTPA 1KE2A 4DUPA 1G41A 2R6ZA 4LW8A 4BLPA 1QIJA 4BCCA 4QARA 4AJ4A 3AFIA 3S7TA 3IESA 4HKTA 5C7LO 2VXBA 4OQZA 1YS6A 5LLTA 3KZ1E 3I92A 3WTBA 1ENOA 1K8XB 1PD1A 3WNCA 5B7QA 5AJXA 1HURA 5ITWA 2JGLA 4QPCA 2NM0A 1GCIA 1GKUB 3BD8A 3PUWA 2ZBQA 3RSOA 2C4NA 3CWQA 3EUAA 2FUG6 3EWIA 1O58A 1UBCA 2CJWA 2XTAA 3ECAA 3H05A 1ODLA 2P11A 3OQ1A 4AY4A 4QYIA 1U7XA 2MMCA 5TGZA 3CW2A 1LPBB 3TTSA 2WMYA 1W75A 5E4YA 3RU2A 2JGMA 4L51A 1KEKA 5IWCA 1KJYA 2P6MA 4DOMA 4ENUA 4EGJA 5KSZA 4RXMA 2VP2A 2GD1O 5C46F 3FNHA 4R1OA 2RI1A 3Q8KA 4M0EA 2NADA 2X4GA 3CLSD 4PCAA 4KWCA 3AY7A 5KYVA 3N75A 1ZMOA 4ZVOA 2QTCA 1GVHA 1QO0D 3AEKA 5C2JB 4B81A 2OM6A 1EVZA 1DKMA 4OI0A 2XKJE 1JG7A 3ITNA 4M0DA 5CLFA 1ZZEA 4Q1VA 4E14A 2XUQA 3KHTA 3C43A 3OQIA 4G5FA 4JC8A 4TXHA 4EDFA 3KE9A 3OX3A 3OOYA 4D79A 3W5AA 3RUDA 4EENA 2P6OA 2Z58A 3RU3A 2AV6A 3MWEB 4U6QA 1E3TA 2CHQA 2D2XA 1EHCA 1R8XA 4M7RA 4QNRA 5IYZF 3FNFA 5C1IA 2QS9A 4R8RA 2YMPA 9LDTA 5JO9A 3DO6A 2NP7A 2C4KA 3LLSA 2O59A 2IXEA 3PXXA 5K8TA 1K8QA 1LS1A 1TLTA 4GI1A 4IHJF 1N3IA 1O6ZA 4ZT6A 4ZI7A 4H6VA 5K9ZA 4ZC1A 2K5UA 5TY0A 5IARA 1CWUA 1RYDA 1H4QA 1TECE 4EPVA 5AICA 2CCKA 4PRZA 3LZ6A 5F76A 1OROA 1RI3A 2EJVA 3RV4A 1UMDA 2VHTA 5B12A 1IEWA 3FE2A 1RXSA 2ZI5A 3GL9A 1EDBA 5B30A 2JFZA 2XSZA 2XUGA 3DLIA 4G0PA 3JATA 4BJ6A 2YC4C 3H8VA 2J85A 2QMEA 2E6UX 4BFYA 4PIMA 1L4YA 1VPDA 4F9FA 4M0MA 3Q3HA 4CIVA 4MW7A 2F3TA 5KVAA 3S4YA 1OBFO 3PWKA 2YFHA 1KK0A 2H8GA 4H4EA 1BS1A 2YFYA 4FYJA 3VX4A 4JLBA 2X9QA 1RCUA 5H3CA 5MN5A 2Y4NA 4HRAA 1AVTA 1A5BB 2WT4A 2GAIA 4DCNA 2FR8A 4ETNA 2J5RA 4D3ZA 1M1XB 1RPJA 4QFMA 5HIAA 4EABA 3W8NA 2DLCX 1DTWA 3QI2A 3H3FA 3EC1A 3WL5A 4G9BA 1AZSC 4PNPA 2CFRA 1WXXA 4EATA 2AVDA 4Y6PA 2VJMA 1V35A 2V1UA 1X7ZB 4HMQA 4RM3A 3WP1B 1J23A 4UFPA 2FVYA 3KIPA 1IM2A 1LSOA 1VRVA 4YFVA 4D41A 4TKLA 3FSEA 4DQKA 1R6BX 2OFXA 2D54A 4OQNA 2FI1A 1KQFA 3UAOA 1MRNA 1AUPA 2V8BA 1BDMA 1QC5A 1HETA 3HKCB 4RK5A 4MW2A 3GARA 1MN6A 3B36A 3E5MA 1JJ7A 1ZK0A 4AO7A 1EZ1A 1GTL1 1VBFA 3ROKA 2Q6VA 1TM2A 4AMUA 2XNCA 2JZNA 2R66A 4EFLA 3LU1A 2EEPA 4DHWA 2O1XA 4S2EA 3EEBA 1XX6A 1YC5A 1HM5A 2ZU6A 3HBLA 4IG4A 3T54A 5CDYA 4G3XA 2W70A 1IH8A 4X7PA 4X60A 4YAUA 1U31A 2BDTA 1EK5A 1B26A 2WTXA 3FNBA 4FNAA 3ASUA 3COJA 3QXSA 4HUQA 2JFQA 1TUBA 1CZUA 3VHXB 3EZNA 1RQLA 1HOTA 2A30A 3NLLA 4OLJA 2QR3A 5E6RA 1YF3A 4CEHA 3GLTA 4MV8A 2F48A 2XWBF 1DC7A 4P3YA 3KWLA 3NORA 4BFLA 4TXLA 5CDFE 4ZYZA 2CLMB 2VF2A 1OZGA 4FX2A 2F64A 3GAZA 1DIOB 3IUYA 4AMZA 1T6ZA 1IPEA 1VIAA 4M1YA 3RUAA 1QQ7A 4RLSA 4E4TA 2HWUA 2P1ZA 4HH3C 4ADSG 1L6RA 4BNZA 4LYHA 3WLEA 4Z8XA 2CLCX 4RYLA 1KMMA 3QHQA 3V9PA 5FTLA 1N5KA 3ZVRA 4GDMA 3VR1A 5L45A 2REQA 2G28A 3DMRA 1J0XO 1QB7A 1VMEA 4JY7A 5LQNA 5B7GA 5LKAA 5ALMA 5C34B 4EPXA 3FPGA 1CIPA 4XE5A 1HQCA 3NUZA 2IE8A 4L4ZA 3TX6A 2HR1A 4WBSA 1IQ0A 3PHLA 1G6Q1 2X5NA 3GMSA 4GLOA 3RVPA 4EH1A 3TR6A 4ZKDA 5LUAA 3NTRA 5HP4A 1T9CA 4MR7B 4E5MA 1G20A 3BF7A 4A2PA 1PR5A 5HFNA 1E1KA 1KBZA 4KODA 5DVZA 4FBMA 3FF1A 2W9XA 3TBHA 1WPGA 2ORWA 3GUYA 3RQSA 1V3UA 4KO4S 5JSQA 3ZG6A 1S8AA 1Z4MA 1A76A 1XTPA 4QJ3A 4GNKA 1NBAA 4I50F 4RFSB 5KO2A 2UVPB 3DEYX 3A70A 3FKQA 4FZRA 1E7YA 3D6AA 4KUEA 3S70A 4YCLA 1E5XA 5DOZA 5L40A 1G8FA 4YMGA 4KPFC 1NVMB 4PGGA 1P1IA 1WP9A 4MUBA 4DWVA 4KFRA 4GSLA 5ALIA 4IIHA 4DR1B 2FSGA 3LC0A 3PA6A 4I5IA 4EY8A 4E1VA 1N3LA 4GIBA 3B89A 4B6QA 3GP3A 2PMWB 3ZZMA 2PGLA 2WNSA 1ZIPA 1FQJA 3RAJA 4L16A 3IV7A 4BMOB 5C52B 2PA0A 4JCCA 4EHDA 4XQ0A 3T7CA 4H27A 4B45A 3A05A 1HA3A 3KOMA 3M82A 3D8NA 4YRKA 1V6AA 3AFMA 2JA2A 4ZVLA 1KKUA 1QGZA 1NOKA 1C1HA 2OHJA 3H9EO 3SYTA 3TE6A 2YY5A 1IXYA 3U19A 4QGFA 1TGVA 1UT8A 3NH9A 5AKXA 3GGCA 2AOUB 3TNJA 3SEAA 2ONKA 3GWGA 4LVNA 3WBBA 3HL4A 5JAOA 1DLIA 2WUEA 1KWGA 1I5EA 3U7EB 2IF0A 5LXTA 4DMMA 2GB4A 3JQEA 5IC5A 3IRVA 1FDRA 4NBNA 4G4IA 4XTRA 2W0MA 4NOKA 1W36D 1MO2A 1RRFA 2N9UA 5CH3A 1R5NA 1YJ5A 2JATA 3O4GA 1MGOA 5K4GA 4JYCA 1CY4A 1CJSA 4IW3B 3CR3C 3BHIA 4P5DA 5EZSA 3JQ6A 2NVWA 5F52A 2X6QA 4G56A 2QIPA 2ZJFA 2OV1A 2QDKA 1SD1A 2XCIA 3GFOA 3QVWA 4MAMA 4F9GA 3EIUA 3AHCA 4PSCA 1SVKA 5G3ZA 1L3IA 3N28A 2JI6A 2E0IA 4IH4A 1GGNA 4L9AA 3PQFA 1XPUA 2FZVA 4KGDA 1SUSA 4LDZA 5FWXA 1E18A 1EM6A 5BWOA 3COPA 1GRNA 4JI3B 4C0KA 4X44A 2ZWPA 1E2PA 1XN1A 2GRUA 1JEOA 3QBJA 4HEA6 4GHWA 1P2FA 1ILEA 2V7VA 3A6FA 1NPYA 1PD0A 1XNJA 1KK3A 2KBFA 2C88A 1J8YF 3KK0A 4Y6SA 1GUDA 1DDGA 4MOWA 1UT6A 4OAPA 1LQTA 4XIFA 3HZZA 3CXRA 1ZC4A 1G21A 5HF8A 1NW6A 1AM4D 3V1KA 3QKSA 2Z5GA 5JYDA 3M2TA 3ELBA 2COKA 3L04A 4Q4HA 2H0RA 1FNBA 4DJFC 4EMTA 4ETWA 4NBUA 3ROZA 3HLTA 4RZHA 3MOSA 4BLVA 3JQAD 3BRQA 3AF1A 2L82A 4R0VA 4V0ME 3O21A 3WWEA 4BMNA 3P52A 4F85A 2SECE 1YKFA 1KJZA 2X86A 1TCBA 3DDHA 1P73A 3KQOA 3M4XA 4AY3A 2WU4A 3WMXA 5T3YA 2V03A 3EX7C 2CFIA 1OZAA 2PT7A 5B6PA 2CXUA 5EY5B 2DMRA 1PJ3A 2VDVE 3TEJA 1GPH1 5LYJA 2D5CA 2ORVA 1TRHA 4BDSA 3QE9Y 3KYBA 4M37A 5ERGB 4XD2A 5SZIA 4Z4EA 1FFHA 2H1LA 4WK0B 5EE1A 3EW9A 1G5IA 4HB0A 4EMUA 3EVEA 2Y66A 2ZWMA 3F46A 1E0SA 3KCNA 1I7PA 1T3GA 2PBZA 3PITA 2PCJA 1Z6YA 1SKQA 3JQ7A 4RJJA 4UNNA 3ODGA 3PEVA 4G8JA 2VOEA 4J1TC 5JWHA 2G09A 2ZIVB 3CM0A 3M4ZA 3QIAA 5DNYB 2CN1A 1XVTA 2FHSA 4M88A 2DHDA 3FTDA 1G8JA 2VTKA 1KHTA 1PVVA 4R2IA 1CC1S 3P2JA 3CXUA 4HH0A 5H82A 3GMIA 2Q99A 3MINB 4G8DA 3REQA 3TSOA 3GLIB 4F4CA 2OHVA 5IDVA 1GGFA 3B5IA 4YV2A 1N7JA 3JWEA 2PGJA 4X7MA 1YQEA 2AK3A 1VC2A 2IOFA 2OAEA 1DTSA 1XZNA 4IWXA 2GBIA 4PPGA 2E48A 2OCBA 3IEKA 3FLMA 1Z7YA 3FNIA 5KQPA 4BE9A 2C94A 1U7WA 3LFUA 2OV8A 4BBAA 5FWYA 1F0YA 1ARZA 4MIEA 2JVIA 1XR3A 2J3LA 4EGFA 4TMZA 1TKBA 1L5HB 1P4RA 3HFJA 4LK3A 1RXCA 1UXIA 5HGJA 2PQMA 3W05A 4TSRA 4UJ5A 5JQGB 1M5UA 4BKRA 4LA4A 2EFYA 2ZIWB 3P8ZA 5C5CA 1ZJ5A 4BKQA 4A36A 2XOKA 3PFFA 4PG6A 2GCOB 2O23A 5F4ZA 1GDDA 2ZRBA 3G5MA 2BCJQ 3URMA 4B34A 1U63A 1RADA 4QC2A 2RG1A 3MLEA 3TCXB 5KOJB 2IHUA 4K1XA 3C85A 4CFYA 2ZS9A 4JQOA 3VZCA 3WAKA 3A1WA 2YWXA 1AKVA 4TV9A 4V39A 4B33A 4GM1A 1IEVA 3K53A 2G9NA 2GN1A 3MAGA 3GVCA 3L7IA 2XUKA 3DEIA 1XAIA 3FKSA 2RGNC 2H3HA 3OLQA 4K6FA 3ON5A 3AEQA 3BULA 4P1ZA 1RWMA 4UDNA 2NVUA 4YCCA 3FWPA 4LJ9A 4W5TA 3ZVKA 4JT4A 3EPPA 1GZ4A 2HT6A 4DA0A 1QGUB 1MC8A 1XTIA 2CDRA 3V6MA 7GPBA 1C0LA 1CTQA 4GBJA 3ZX5A 4L72A 1QMPA 4KFSA 5CK5A 2JIPA 1WA5A 3ESBA 1CUEA 5D6OA 3V8QA 1KQ3A 4KVGA 1C7JA 4FEEA 1MAWA 3OF5A 1UXHA 2XOKD 2OC9A 3OM9A 3QWFA 4FHZA 4RVHA 4XIIA 2QBYB 1CJBA 3X44A 3R8FA 5BQ3A 3JD2A 4IXNA 2HIMA 3L7BA 1FRVA 4AZ0A 1NBWB 4LF8B 1YR1A 3DXYA 5A4IS 3FPCA 5TPWB 4MDEA 2FSPA 3QVTA 4IFEA 1OXXK 1VMDA 4D4HA 4FINA 4OM7A 1M66A 2WD9A 1VKNA 1Z4IA 1DO2A 4LJ5A 4ZYUA 5DHSA 4ZKEA 4D0LB 4HWOA 1KH3A 1L4BA 3BB3A 5FWDA 5JFGA 4TKVB 4V0SA 4ARZB 3RYFB 3HRIA 2ARKA 1I3CA 2IU6A 5KPJA 2FPPB 3YASA 5C9ZA 2UUOA 2IEAA 5KJEA 2AJTA 2O3UA 1T0UA 3CPJB 4E4YA 5CFRA 3H99A 4TL7A 1NZJA 3VFDA 5KUTA 2PSDA 3C39A 4URZR 2PWBA 3HDVA 4UREA 4YQEA 3KUCA 2YZ7A 1NUPA 3FWKA 4ILEA 2LIPA 3PNOA 1JHOA 2OCGA 3E5NA 3WWZA 6YASA 2VHZA 4A7PA 1PT6A 4CKYA 4O2BB 3B12A 2C54A 2VYVA 2PZ8A 3LXMA 2BW0A 4GI2A 2EDAA 5A5FA 1GUFA 5CB0A 4RHUA 3ZW8A 4LKRA 3W9YA 3B48A 3TJMA 1N8NA 2GFHA 5HM6A 4PO3X 4AY6A 2DECA 4ACAA 4NBRA 2P27A 4PG7A 1SCIA 4DA6A 1B6SA 1PWEA 2MINA 1OZFA 1WMAA 1C4OA 1Y3AA 1NVTA 2VDPB 5G41A 2WF7A 1W2WB 3U3MA 2VTBA 4EJ6A 2HWKA 2Q2NA 1R00A 4H7JA 5CBKA 3ICOA 3GVHA 1JQEA 1JG2A 1N0UA 5CH8A 3TZBA 1CLUA 2CEAA 2NQ2C 4B6RA 4BHTA 4DT1A 1CXZA 1XYGA 1S2OA 4F3NA 1P44A 3UWMA 1DBQA 3QG5A 1LBIA 3S8EA 4XI9A 1SZCA 2VHCA 1YCFA 2O0MA 3MXOA 5FTWA 3DWEX 4GO1A 4LISA 1CQXA 1KOJA 2OWEA 4YT4A 5IJZA 5JBNA 2BMFA 2PT9A 1TTTA 1XMJA 2ODAA 3DDSA 3ZY5A 1H0RA 3HB7A 4GR9A 1B73A 2DOKA 3AY6A 4CRWB 2OFPA 1VBNA 3O73A 5IT5A 5FPSA 1OLSA 1TTHA 3L6OO 1CP2A 1Y5IA 1Z4KA 1DRVA 2CNOA 1XIVA 4P86A 4QRDA 4JUBA 2O8FA 2IELA 3DLTA 3PLNA 4LYAA 4CIYA 2Z30A 4NCBA 1NNEA 4TZTA 2C8KA 3KHUA 2VRNA 3I1YA 1MXHA 3KOUA 3HJCA 2F6RA 3AK4A 3D3WB 1LX7A 2AC2A 2P9HA 5IVHA 4I8DA 3CZAA 3O2SB 2FE4A 3DWGA 3MELA 2VWQA 3TSWA 3ITEA 1TOAA 3D0RA 4UBJA 4W9RA 1NW9B 1EGQA 1T2EA 3G6WA 1SWVA 1V6CA 5KHOC 1BXKA 1IZ8A 2A1TR 3PGLA 1DQRA 1X1AA 4YV7A 3PEFA 4ZO9A 4EJ0A 3BH7A 2F4VB 4US0R 1E99A 1H2RS 3QKIA 3CW9A 1TC2A 4KMMA 1YE8A 3NHAA 3U80A 5CJJA 2ON6A 1OREA 4GR4A 2VYNA 1MC4A 4QIHA 3KR0A 3E27A 3R4VA 4BUJA 5K0EA 4FYPA 5THQA 2IEDA 3HKEA 4FCTA 4U7WA 1V5IA 3BBLA 1Y7IA 4C4ZA 1Q21A 1LFDB 1BU8A 2I6QA 3CB2A 5BT9A 8ADHA 2DM6A 2MR6A 1T4BA 1LA2A 3GRPA 4U4AA 3LHKA 3Q1KA 1R9MA 2DPXA 4WZ6A 3WL6A 6ADHA 1UK7A 3GDFA 3UWDA 2CUNA 2IS6A 2CJWB 3FYSA 4IDCA 1XJWA 1O7JA 4M60A 5KC9A 3RS8A 1ECJA 1Y1QA 3OVMA 1HK7A 4P3XA 2V3WA 3K0FA 1YOVA 1W8DA 2OOSA 2VNSA 3A2NA 2HREA 1GKYA 1K3TA 4K0RA 5K3FB 3WK8A 1IRXA 2P79A 3QKUA 4L08A 3X1KA 5EHNA 5ITVA 4X6LA 1SIUA 3GQVA 4WKGA 1Q14A 521PA 1YQ9A 4FYVA 4RVGA 1CY1A 4WJKB 3PGJA 4PLYA 2VJOA 2H1CA 4ALKA 3H5TA 2V1XA 3M3DA 5A9SB 3H9UA 4RMNA 2C2OA 5JJCA 1TQ8A 3AEKB 3WLPA 4DY4A 2JAUA 4RQAA 3I5XA 1ACMA 2REXB 2GRAA 4G65A 3IMKA 2DY1A 3RPEA 4DRZA 1NHWA 4CVNA 2QTFA 4KV7A 3HJGA 4R1PA 3MWLA 2C4MA 3LX6A 3O8DA 3ETDA 2VHEA 4GPD1 4TKUB 1MQ8B 4KDRA 4S0XA 4DM7A 4EHHA 2Y1WA 3BE5A 1E9SA 3K2BA 3KZVA 3LGAA 3PXAA 3QEKA 2ZRAA 1NVEA 5IXSA 1QRSA 1BN7A 4TTSA 2G40A 1GR1A 5CNJA 4DLNA 4PBSA 3OPMA 1GYPA 3KR1A 2QM8A 5JMOA 1YJAA 3TTTA 3JWIA 4L50A 4DZRA 2IYRA 3DB1A 1SU8A 4ZQGA 3T5MA 1VTKA 1B14A 2VBCA 4IWNA 5K3OA 2NXCA 5C8XA 3TKYA 3MB5A 3NHUA 4P3NA 3V8EA 1II0A 1GD1O 3PJDA 4MEAA 4ZJYA 1E6UA 2NU6A 3B8HA 2X0KA 3OLYA 1J1UA 3T5DA 1BOOA 3QE0A 3KAJA 1TUEA 4BBJA 4YHHB 1UMDB 3E1GA 3DMPA 2Z0MA 1N9KA 1C5KA 4BGIA 4EM6A 1RI5A 5JAZA 1T24A 2FN3A 5DCUA 4DQXA 4EECA 1EIWA 1Q3KA 1L1QA 2HO4A 4UD6A 1DVRA 2VDNB 4R05A 1U6JA 2A3RA 2LDXA 4MEBA 4V3BA 1MKYA 3OIYA 2BBWA 4HZGA 3ZVMA 4RH1A 3Q5DA 1RR6A 1XXHE 1CJVC 4MROA 5JCZA 3R6DA 4W9NA 1FP1D 2ZRGA 5DGDA 2O2ZA 4D98A 3ZU6A 2JAWA 4H6WA 4XDGA 3MJVA 1HL7A 3VBEA 1ZSNA 4XDYA 3SQNA 1SOUA 3N8IA 1W88B 1X1CA 3RSCA 5EMNA 2W43A 1LCIA 5B37A 4XWKA 2P5UA 2IBMA 2WSSA 3G79A 1KYVA 2W98A 1M6WA 3GRUA 3SJZA 2DFDA 2B7LA 1LB1B 5AIBA 5A6SA 4DVGA 4AJOA 1H66A 1QF9A 1G21E 4IGEA 1KVUA 1WW3A 1NN3A 2OGTA 2I65A 2RDMA 3STYA 4HDRA 4YCAA 3ZZ1A 5FAKA 3AKYA 1LDMA 3L77A 5TEVA 3BMQA 3EGWA 4P53A 4Y2SA 1XTRA 5IH3A 1VMIA 3ABQB 4CL2A 2QJOA 2MTBA 1BW9A 2Z09A 2VCYA 4ZDWA 3SQMA 1CF9A 1UK6A 4EK9A 1XALA 1RI1A 3P0RA 5GWXA 3ZHCA 1Z0SA 2J3QA 2XV1A 1QC5B 1T8WA 2CEKA 4XR9A 4DILA 4E09A 4ZDKA 2G76A 1LPOA 1T1SA 3P2MA 4EY5A 1ZCAA 2HM7A 3R0ZA 3EPLA 1FDOA 3RB8A 3SDSA 3CRW1 3IT0A 1Z4OA 2FX3A 4X61A 4YJKA 1WW2A 1K4KA 5CT5A 1BRMA 1SUEA 2NXEA 1YI1A 3R8XA 3JD3A 3RFVA 3S2IA 3HV2A 4ZICA 3PIIA 5BXQC 2FEKA 4EPTA 5JZMA 1JKMA 4RKEA 4E3WA 4U63A 5EJ6A 4R40A 3ZHYA 3DTVA 3GELA 4NU0A 2P6PA 1PT5A 3CNNA 4GSKA 3WLIA 3T4PA 4AWXA 2OQRA 3ANXA 1QV6A 3VQTA 4MIYA 4HUQB 1N5DA 1TUBB 2W00A 1R0KA 1A8IA 3ZUPA 2GZSA 4EKYA 4CEHB 3C1AA 4RIHA 3L2OB 1FTNA 4MUJA 1NUAA 1Y42X 2JPDA 2OK7A 3ET5A 2LD4A 3F97A 1NWHA 3I34X 3CUWA 4LRTB 4OHPA 4XDHA 4ZQEA 7MDHA 1Z5NA 2HEGA 3NC1C 4MKGA 1SD2A 2FUNB 2BCEA 3BQMB 4XWOA 3UJ7A 1DQSA 4FW9A 4M98A 4J6FA 1ZQ1A 1DRJA 1H3NA 4C04A 3F9IA 2MYTA 5ARCA 4JGIA 3T3HA 1QG0A 3RBAA 3KT3A 4GYJA 2H51A 1H6BA 2Z6QA 2EBHX 1SXIA 3O4IA 1E8MA 3C3XA 3P9KA 4QGBA 3UATA 2W2NA 4C08A 1BQ4A 1CDEA 1YIDA 5IVIA 3S1AB 1YQQA 4HYEA 3QFHA 4CM4A 2ZS7A 4JI7B 3DDWA 3WGOA 2B4QA 2J59A 4XJSA 1JMVA 4YROA 2HSDA 4MV9A 3V7NA 3R5KA 5JANA 2B35A 5JNTA 1GL7A 1VCNA 1XZFA 3NIDB 3S2UA 3CUYA 3ZDDA 3U44A 3ZE8A 2JIQA 2ZSKA 2IYSA 2W6NA 3TAXA 3G88A 2C5GA 4H1VA 4R0NA 3EVAA 1GPLA 1G20B 4O2LA 4K81B 3F4LA 1NASA 4GLFA 4NEGA 1QIMA 2FMKA 3G1WA 4YAIA 2H5JA 2X8AA 1Q22A 3E9NA 4OBXA 2OHIA 3SJ7A 2KX7A 4E11A 2BHTA 3LY5A 2HF2A 4D82A 4LX8A 1LVHA 3DE2X 1NR7A 1OI7A 2BHRA 2LDBA 1VPTA 4URWR 3WMRA 3NWEA 1JQJC 1XPRA 2NTEA 2HI0A 5CMLA 3GFVA 1WBJB 2V65A 3KYIB 4DUZB 1I33A 1OFVA 1RAHA 4LWOA 4AY5A 4XH9B 3DQZA 4I9FA 1OX4A 3QEAZ 2Z8ZA 5I5EA 2HHHB 4Q4JA 2YN0A 1NP7A 1P7VA 1RWXA 4U7GA 4JZKA 1ZIYA 2ZPAA 1A9TA 4OQQA 3NASA 3DM9B 2FN7A 3ANLA 3B85A 4HTFA 2OHFA 3MPUA 5L7WA 2WJAA 4H0FA 1XBTA 4KWIA 3FDFA 3SK0A 2AMVA 3ESYA 4G1CA 3O26A 4FOOA 3QW4B 3ZCPA 5BV8A 4RUKA 3DBVO 3L46A 3UV7A 1BHQ1 3OEWA 4A6DA 3PE3A 3MUFA 1F3LA 1X9IA 4AULA 5FI3A 4U8HA 5FUYA 4JBIA 4EB8A 4UHCA 4H1HA 5FORA 2Z1NA 4MO9A 1EBBA 3T1NA 4WFKA 5J2UA 3BIOA 1E3JA 2R8RA 4HGNA 3QUCA 1MX9A 2NMVA 1N3BA 1BU5A 3DYIA 3FTFA 1EWTA 1P17A 4W5QA 1ZUIA 4BVBA 1T5HX 2I67A 2UYQA 2DPHA 4ZOLB 1NNLA 1NU8A 5DBHX 4B6EA 1PR3A 4Y7DA 3LDGA 5HKKD 4WI1A 4DA8A 1A88A 5JI2E 2VAXA 4E2YA 3K9QO 5LU9A 2CLLB 5EJMA 2PNJA 3LSYA 4JSYA 3RTCA 5EIOA 3E9DA 1IXZA 5ERXA 2H2HA 1SN7A 3KL4A 1CQWA 3NVKI 3AUAA 1N25A 4HB2A 4E03A 1KXZA 3TRDA 1JAXA 3WMGA 3UMSA 1M3SA 1QH0A 1BKSB 4OQEA 1T5DX 2CL7X 2F4NA 2FOXA 4FE4A 3CZQA 3ESDA 5CNIA 2ONYA 4NBTA 2EXXA 4ARSA 2HV9A 4PQYA 4QHTA 1JWLA 2LE0A 4DJAA 5BWMA 2PZKA 1DGQA 1I3LA 2W0SA 2YDXA 4RTOA 1Q7BA 3R6LA 4LXHA 3RFFA 2C2WA 4PZDA 1HKHA 4RIEA 2NZYA 1EX7A 5ALTA 2AD1A 3WK7A 1ECLA 1G2QA 2NO5A 3G02A 3QKSB 1H85A 3VKVA 4E22A 3U4QA 3BSSA 4RV5A 5IZ4A 2C8JA 4JUCA 4J1QA 2C31A 3RQIA 1FUYB 4MYDA 4MW6A 3SJBA 1R3DA 1YRLA 2NNWB 3T5AA 4DPMA 4MWZA 1AKQA 4KSBA 2DWOA 1A7KA 2NZVG 2ZUTA 1MA3A 2NWQA 4KVFA 3GEEA 5D01A 1WR8A 2H4HA 4MXDA 1KKLA 1ZITA 4D8XA 2GYVA 2R9VA 4QSMA 4RD6A 5C8ZA 4MA0A 4A03A 2ZATA 2Q21A 3EDCA 4QOFA 4BZQA 5LYJB 2XBUA 1XZCA 2DQZA 2GBLA 4KFTA 1J2EA 4L0CA 3UOAB 2RSLA 2PX2A 3O1HB 2VTDA 4D9JA 2I78A 2RHDA 4G67A 4RANA 3M2PA 1QK4A 4B6JA 4CR7A 5C8YB 5DN9A 3A9RA 4QXRA 1K8YB 1Q92A 1E9FA 4FYWA 2IXBA 1SUCA 3JQ7B 4N5IX 2B0CA 2II6A 3P2EA 1ORVA 4IIBA 4E32A 2AA3A 2B4AA 2UYOA 1I1OA 3E9QA 2K7ZA 1X14A 3D4NA 3HWRA 5K8UA 2VWPA 3OESA 3NV9A 5K99A 3I2HA 1Y6QA 4PR3A 2O8EB 1SVOA 2Q46A 3D81A 4EB6A 1M6VB 3GA5A 3FSGD 1R2QA 4WBXC 3RC9A 5HTOA 3D7SA 3L3BA 4TMKA 1KMCA 1YZYA 3KV1A 3N39C 3HE3A 3O4JA 3OKCA 3KQSA 1GL9B 1OXKB 2BGNA 2QUZA 3B7PA 5DTJA 2F1IA 5D1HA 1U0TA 5J1TB 1GOTA 1KYZA 2P6UA 3U3ZA 3DT6A 3W5JA 3IJPA 3O74A 3PFKA 1DBRA 4DXHA 2C5AA 3IP1A 5CYGA 4H17A 4IUBS 2YHUA 4Z4FA 2QAJA 3WGVA 1W0KD 3WVNA 4JLDA 3U48A 3FCAA 3GNSA 3ZD6A 1L1FA 1CS4C 1CYDA 4YP7A 2HL6A 3VYSB 1VOTA 1N8SA 4XVQA 4QNMA 2HX1A 1Y34E 4COKA 4EG0A 5JCOC 5KMGA 4HGOA 4XGKA 3BMCB 1ZUNA 3KUXA 3QA3E 4O3MA 1TYBE 1VJTA 3FDJA 1GZUA 4I8IA 5PGMA 3FHOA 1XU9A 2KB0A 1Z22A 4EHLA 4TV9B 5EMMA 1K6EA 3OX1A 1RYNA 1GKIA 3A1NA 3H4MA 1DNPA 2DFLA 2JDID 2GARA 2ZYUX 3CSSA 1H3FA 1T0HB 3FZEA 4BAUA 1H0SA 1NLFA 3DMTA 3FCEA 1J1ZA 3MMNA 4H7DA 4N8EA 3T7RA 5HZMA 3WTCA 1Y5LA 3AEQB 1IE3A 4C5AA 1HR0B 2Z2IA 5AJWA 1CDDA 1SM4A 3VKHA 4AIIA 1F4LA 4RM2A 5JDCC 3UWPA 4LV8B 2VUHB 4DWJA 3ECSA 3ZU2A 4HDOB 2RGCA 3NDIA 4JI0B 1J5PA 1FDIA 3DXZA 2EVWX 2OKCA 4G5YA 2PMKA 3GVIA 4BVKA 1BKDR 1M2GA 2ETXA 1JQKA 3CPEA 1GZ7A 2R2GA 3IQZA 3O4VA 1SRRA 4OQYA 1J24A 5G53C 5B1HA 4BC0A 4PAQA 5CLQA 1RMYA 5JJBA 2R68A 2I66A 3TTYA 2CE7A 3ROPA 2WYIA 1P7WA 3O82A 4IG9A 4J3NA 1Z3CA 2FFHA 1N2CA 1LTQA 2QENA 2VAVA 3R9KA 1A2BA 1MX3A 2BLNA 4ND1A 3UUEA 1TIKA 2MYPA 2ZUBA 1KZ6A 2PX4A 3IIEA 1P8AA 4V3CA 1PLKA 1FE8A 5J4YA 1S2GA 4JA2A 2JGNA 3RS5A 4H1UA 5A6SB 1D4OA 3FF4A 5JIBA 1JKJA 3RC1A 3HCAA 1G8MA 4MVJM 3UFXA 1QRDA 5JLAA 4UM9B 4PYLA 5KU7A 5M2QA 1UCFA 3IQEA 4LCEA 5FLEX 3MMSA 3ZWPA 2FPMA 1YQDA 3F71A 3I4LA 2Y6VA 3P0IA 4M53A 3TXYA 4ER0A 1ZMXA 2MDTA 2QRVA 3ABZA 5JTTA 1MORA 1YVUA 3LT4A 3CUTA 4ZODA 3JALA 2WF9A 3QUAA 1RLTA 3AO0B 2AFVA 3AY0A 2XT6A 4G4JA 4O08A 4S35A 5SY9A 5T4EA 3A9VA 3WIUA 2GK3A 1EU1A 5J9FA 3EJ6A 1G17A 1GV0A 1Z4NA 4AJEA 2PMBA 3GQBA 1HQYE 4FNOA 4GKAA 4YMTA 1T9GS 2PXHA 3DEKA 1M8JA 3BUSA 4GYYA 2I3BA 2VA9A 3TLCA 1JQDA 3L0OA 1GCOA 3ZU5A 1PKXA 2F9MA 3I9V1 4TSKA 2O6LA 5E3HA 2FW7A 3PGVA 4V24A 5K3SA 5HQTA 1EEHA 2AMJA 2FQQA 3Q7SA 4LOJA 1ST2A 4QEKA 4BMVA 5DKFA 1UDBA 3QOXA 4M7OA 1I9CA 1THZA 3FLEA 1DC6A 3PEEA 4FEAA 4QQFA 1WD5A 5JRDS 1JFSA 1UOPA 2XXBA 3EYAA 1PTKA 5L53A 1I7SB 1IHXA 2Y67A 2ODTX 4I5GA 3VMMA 4GOLD 1P33A 2VTBB 1JS1X 2GXQA 2VDJA 1PFWA 3DE0X 2QOEA 1KKMA 4JVSB 3F5DA 2VUUA 3AKZA 1M5TA 5J4KA 1E32A 2MR5A 1GYQA 1P75A 3VGPA 3DHVA 3GNQA 3T5CA 3RGGA 1FRNA 3BXFA 1OT3A 4GZ5A 1PCXA 2SKEA 4E12A 5G0SA 2G7MC 3BCUA 4ASUD 4AJKA 3QUTA 1QZTA 4B09A 2AG6A 1O94C 1CW2B 3DHWC 3ND5A 3TL6A 3UKJA 1Y3DE 3SIWA 1DJMA 3VYTB 1G3RA 2C7VA 1INLA 3KQYA 3TTXA 3SYKA 3PF8A 4U9IS 3QH4A 1OLSB 4OU5A 1EFRD 4N5NA 2I80A 4I8XA 2EZUA 4F6LA 1BJKA 1KP3A 1NRIA 3TG2A 5HZGA 3DP9A 3FJ1A 4TL6A 4DLKA 1U0BB 4MKXA 4PZYA 1Z45A 3PG5A 1Z8HA 2XUOA 2FW8A 4QUHA 3IXMA 3R9IA 4BN5A 3OTQA 2GPSA 4QLOA 4OSPA 3P97A 4WNAA 4KQHA 1EEXB 2MOKA 3AVOA 4JMLA 4MLCA 4PF1A 4QPNA 2P2SA 2VO1A 4I50A 4TOIA 3ONFA 1QLJA 3WB9A 4F46A 2R8YA 5L6MB 1J0CA 4CFSA 1W7AA 1J7KA 4OY3A 3C3KA 4OQXA 4YQZA 2COUA 3T7IA 1NMEA 3F0TA 1HT2E 3PQCA 1HDOA 2QNBA 4MV5A 2VJPA 1PHRA 2JAQA 5C1OA 2ZYRA 4ZIRB 1YR2A 1T6YA 1D0VA 5A1TA 3HVIA 1P8JA 1G4UR 3UK1A 4GL4A 3DE3X 1J2RA 3QLUC 4KXXA 1BXRB 5I4KA 3OMWA 4IDOA 2Q5LA 2V7UA 4L07A 4EIWA 3IUQA 1TE2A 3LRPA 4LHYA 3S44A 2R7MA 4FYKA 4V0RA 2G0TA 2GNOA 4BO3A 2JIMA 2HPAA 1ORRA 2DLNA 1J09A 2AI2A 1DE0A 2EAUA 3H2YA 4ND4A 2PH3A 1P1RA 8MHTA 2I33A 1R4NA 5DSXA 3CQ9A 3SGLA 5A6VA 1XD2A 1E1NA 4Q3DA 2YMQA 4YIHA 2ZDQA 5DNAA 3QVJA 4X63A 2QF7A 1EGMB 1JZTA 1YOVB 2BI7A 3TB4A 1R15A 3C6MA 1PJZA 2H54A 3NOOA 1T0IA 3DBOB 3IO5A 3ETEA 3UA4A 4ZXFA 1MB2A 2QU7A 2Z9BA 3COZA 2QYTA 4C4AA 2V97A 4LDJA 5BORA 1C1YA 2BI8A 3WBFA 3AOGA 4ESOA 1TO1E 1BX3A 2JFFA 4WKBA 3A58B 1GRCA 1E2FA 1ZW6A 3ZDRA 3U3DA 3QFTA 1ZRHA 5JE8A 4B0OA 3B1FA 2PL1A 4BZZA 1DAKA 2I8AA 1WAMA 5DI3B 3DVLA 2GPBA 4GMFA 3U60B 5IYZA 1A8UA 4RTJA 4H0NA 1Z2NX 5IANA 4U1RA 4ALJA 2J0SA 1UP7A 4DJEC 3ZWBA 5FR2A 2A0WA 3I6QA 2QSUA 3P0HA 4E3ZA 3CF4A 2J9GA 2O3SA 3N5CA 3LKZA 4B3GA 1Y3HA