4AJNA

Rat ldha in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)-3-oxo-propyl)carbamoylamino)ethyl)phenyl)methyl) propanedioic acid
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
330
structure length
329
Chain Sequence
ALKDQLIVNLLKEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 115
structure length 329
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajnA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajnA02
1YL7A 3C3XA 3RFVA 1I2CA 1ZH8A 2FZEA 1LLCA 3QLJA 1L1FA 4BNJA 3Q6IA 4U0KA 1P3DA 1IHXA 1HF3A 1EQ2A 2DVMA 2CZCA 3DBHA 5TNXA 4NJOA 1QLJA 4B3JA 3TPCA 3WBBA 1PJ2A 3CTMA 2BKAA 1HXHA 3G1UA 3JYOA 3VKUA 3ZCXA 1U28A 3VZQA 1JKFA 2D0IA 4CQLA 4H3VA 3ROQA 2Q99A 4BL5A 5I9LA 4U6QA 4R5MA 1JN0A 2B35A 3GZNB 4I9NA 4HV4A 3HB4X 3KB6A 1YXMA 4LISA 1CERA 3ZI0A 4YXFA 1TVEA 3O4RA 1X7HA 4IPTA 4L75A 3BXXA 4DQXA 3IMFA 1IZ0A 2DPGA 2E37A 1ZVMA 4FDAA 3RKUA 4LW8A 4AJOA 4RVGA 4IDCA 2Y0DA 1HDZA 4FN4A 2Y0CA 4P22A 2VHWA 5THQA 1B8UA 1DC5A 1C0LA 1KY5A 4EEXA 1E7QA 4ALNA 3UAGA 4BKQA 5IZ4A 3O8QA 4FCCA 2W2KB 1ZMOA 5IZCA 4XRRA 3K92A 1Q0QA 4YAEA 5BNFA 1B14A 2JCVA 2NLOA 1MG0A 4CMIA 3DC2A 3AJRA 2UV8A 4EUEA 1NR7A 4ZQGA 1EFLA 3DMTA 3GMDA 4PZDA 3BHIA 3TFQA 3OQ1A 3DZHA 4ZRNA 1KERA 4YDRA 1E5LA 4AICA 5JXWA 4CM7A 1UDCA 1A72A 3GFGA 3P2YA 4B4OA 5IDQA 3RI3A 2XF8A 3QIVA 4PVDA 4YJGA 3EYWA 1MXHA 2UDPA 3DTTA 1VKOA 4HXYA 3WGGA 1JKJA 3OBBA 1PTJA 5L4SA 5A9SA 5TJHA 3ASVA 3G3EA 5CHEA 3FWZA 5DCUA 1I32A 2D1YA 4N5NA 1LU9A 4IDGA 4LSWA 2VUTA 4II3A 4BV8A 4Z3DA 4QECA 4CLDA 3S2IA 4AJEA 1HL3A 2OBNA 3LC7O 5AYVA 5K0ZA 1GQ2A 2CD9A 4R41A 4X54A 2AG5A 3GN1A 1Q2XA 4KTTE 3JTMA 4XYEA 3ZWXA 2GCGA 4N18A 2AEMA 4W6ZA 3DBRA 1IUKA 3RFXA 5BNTA 3GK3A 4MP6A 4EJ0A 1I2BA 3I52A 5H81A 4IJUA 4Q3AA 4RJTA 3R0IA 4D3DA 2I6TA 2LDBA 5TLSA 1CIVA 4OKIA 1QMGA 3LVFO 2GN8A 3C7AA 4O5OA 1WDMA 4KUEA 1JKIA 5LC1A 4A73A 3OJFA 4RZHA 3G79A 4IJVA 4RQUA 1N2SA 4ROSA 5BT9A 1ISIA 3BMNB 1LDNA 3FNEA 3QHAA 4J0FA 4Y8VA 3CMCO 3EK2A 4JBGA 1T2EA 4IM7A 1Z82A 3ABIA 4KP7A 1ISMA 4I5FA 4K6CA 4BNZA 4O6VA 3WFJA 4A10A 3L9XA 2O3TA 4TRMA 1P44A 3I6QA 3F3SA 3HJAA 4DYDA 1B0AA 3DZIA 3GRPA 3SX2A 4OKNA 4CM8B 1XQ6A 2V6FA 1LDYA 1YL6A 1GCUA 1DJNA 2NWQA 3OQBA 4WGGA 3ZNNA 1XDWA 1BXKA 2W8ZA 4RQTA 1YBVA 2YHIB 4XCVA 1CYDA 4EZBA 1E1MA 3TSCA 2OZPA 4J7XA 3INGA 4G81A 4YT5A 2EKQA 2ZIZA 1G1AA 5BNIA 1K5HA 3GDGA 4YBZA 5JMPA 3OIGA 3F6YA 2HO5A 4OOEA 2WYWA 1LQUA 5AXAA 2AEFA 4K6FA 5ES3A 2NVBA 2PZMA 5JCJA 5HRUA 5GMOA 1MC4A 4YAIA 5I7VA 1WZIA 2GSDA 4WCFA 3S2EA 2IZ1A 2J5KA 2GN4A 4W9NA 4CMHA 2FPIA 4II2A 3RC1A 2PZLA 4BO0A 4NBRA 1F12A 3EAGA 3F9IA 4IBOA 1ZJZA 3CPSA 3JD3A 3WSWA 3V8BA 3OSUA 2X0NA 2JD2A 1XSEA 3HHPA 3E5RA 3JQ7A 3KOUA 3Q1LA 1V9LA 2DBZA 2WMDA 4BO1A 4XA8A 1XU7A 1QYDA 5DDIP 2GERA 1BRMA 1H9BA 1M75A 4Y98A 1NX6A 4IDEA 1DB3A 2C54A 1KVRA 1HYHA 4E31A 3DB2A 1MXFA 3GG2A 3M2TA 3GA0A 3ONEA 4NH4A 4L76A 4JP3A 2ZYAA 3NX4A 5GY7A 4E3ZA 1PQWA 4QT0A 5CEFA 2VCYA 5U9CA 1DDOA 4ND5A 1E3IA 3IL2A 1PJ4A 5KJ6A 1B7GO 1ADFA 4JK3A 1B2LA 3D0OA 1OOEA 2X1HA 4DLLA 2YZ7A 4BQRA 3KRTA 2X86A 3DBLB 2JHGA 4J43A 3CIFA 1U3WA 1K3TA 1BVUA 1YE3A 2DFDA 1IY8A 2WJPA 3EZLA 5I7EA 3V2UA 1Y5RA 3E9MA 4ITUA 1H0KA 3NV9A 3CUKA 4O63O 2G1UA 4AJHA 4Q3CA 3HFSA 2ZK7A 3L6OO 3PFFA 3FCOA 1YQXA 3D4OA 3VH2A 3H5RA 2X9GA 1IOLA 5JO9A 4R9RA 4CV0A 4ZQFA 2WSBA 2X4GA 1VI2A 1W6UA 3NT4A 1UUFA 1I3LA 2CDBA 4OXNA 1NYTA 2BGMA 2NNLD 3ICCA 3L6DA 1HDXA 2Q2WA 3ENKA 4BNHA 4P8RA 5JS6A 3AY7A 3ZHBA 5IZCC 1SO8A 3RROA 4ESOA 3ZV3A 1E1NA 3GOHA 1NHWA 3HG7A 4CM3A 1DLJA 5COBA 2I5PO 4YR9A 3DAFA 1NFQA 4PG4A 6ADHA 3BZUA 3P7MA 4PLCA 4FFMA 1A4IA 3VPFA 3WB9A 1C1DB 3W8EA 2B69A 1D8AA 4IQGA 4BNUA 4DREA 5JSFA 5KVCA 3KYCA 5F5LA 4BNLA 2TMGA 5JE8A 3GY0A 3QY9A 1DAOA 1YOVA 4PLZA 4K28A 1P74A 4DPLA 2V7PA 3HE3A 5T64A 3RUIA 3TJRA 4CQMA 1GADO 4A03A 4U7WA 3RWBA 1DRVA 3WNQA 3WSVA 1YB4A 4XYLA 3TF5A 1U7HA 4NBUA 1T24A 1I3NA 4AJPA 2BFOA 3UXYA 2HSDA 2DBQA 3I9NA 4S3MA 5DOZA 2P2SA 3FPLA 2QW8A 4MINA 2E82A 4INAA 3ZDFA 4I1IA 3ZH2A 2A94A 2EV9A 4MVJD 3WMXA 4G5HA 2IEBA 2RHRA 1ZK3A 2QYSA 3H3FA 1U7TA 1UXJA 3GEGA 4ALIA 4KZPA 1PWZA 2GD1O 2AHRA 3MJTA 1EVYA 2ZB8A 2ZYDA 2VN8A 4XGNA 4CMAA 1RYEA 1W0CA 4CLRA 1PL6A 2BELA 2PKRA 3PXXA 3C24A 1M66A 1H6BA 3HDYA 3AK4A 3INTA 3OP4A 5A3JA 5DBIA 3PEFA 2JCXA 4R1NA 4RLSA 5CAEA 1BDMA 1YRLA 4ZVVA 4IUYA 4GWGA 1UAGA 4H16A 2FWMX 4LRTB 4ND3A 4YT8A 2C0CA 1Z7EA 1GFSA 5F5NA 2ZTVA 4DTIA 5A06A 4GKBA 4NIMA 3CXRA 3TZCA 4FBGA 2XPCA 3LDHA 4B7UA 2GNAA 1PL8A 3GPDG 1JLLA 5F1KA 4ALLA 4YQYA 3ITDA 2TMDA 1ENZA 4WUVA 4AJ2A 4EUHA 1NQOA 1SC6A 4IMPA 2EF1A 4HNHA 1DIBA 1LBEA 2X5KO 4EGFA 1C1XB 3GT0A 4KUGA 1YDEA 2BFPA 1TEHA 3GGOA 4ILKA 5L53A 3U4IA 4Z9FA 2WTBA 3ZV5A 4QFCA 3RD5A 1RKXA 3SJUA 3V1TC 1YBMA 3IOYA 4L4XA 3WJAA 4CLEA 1VRWA 2BMAA 1I01A 2AQHA 4Q3EA 5FI5A 3H5NA 4AFNA 1HEUA 2VNSA 3QSGA 2IYPA 2X5OA 2JFHA 3STHA 1EEHA 1NQAO 4PGFA 1P33A 4WCFC 3ZNOA 1EVIA 4RVSA 5U1PA 1Y5MA 1D1TA 3DZKA 3H9QA 3I9OA 1BXGA 2A9FA 1LRKA 4MJLA 4QFDA 4RL6A 4PN3A 5A1TA 4D0RA 4NFYA 5G2OA 5T5QA 3SLKA 4RVHA 4WE3A 2IRWA 2J8ZA 2JAHA 1A5ZA 4MKXA 1WP4A 2FY8A 4NJMA 2Q2VA 4NR0A 3UKOA 1IHYA 3KO8A 3H9EO 4P4NA 4BS9A 1N9GA 1NFRA 3DONA 3ASUA 5G4KB 3K73O 2B36A 4CL3A 4IINA 3EDMA 3PWKA 2IXBA 4WECA 3VZPA 4RDIA 5I9NA 1D3AA 3ROKA 3KXDA 3MJ4A 2WEKA 3L77A 4W7IA 4YT4A 3PHJA 2EG9A 5CPFA 5FF9A 1DFGA 4E2XA 2DFVA 2RBEA 1JW9B 3NYWA 5BSHA 1LNQA 2WWRA 1BW9B 2IYOA 1YB5A 5TIIA 5G0SA 1N1GA 2P4QA 2HK7A 3A28A 5HWSA 4RPGA 2I99A 1QP8A 1GD1O 3HDHA 4S1VA 4GLOA 2PR2A 3AU9A 4WLNA 1LC3A 3JQ8A 5JDIA 1HKUA 1LSOA 2NV6A 1BXZA 3NTQA 5H83A 3ST7A 2VOJA 3OICA 3KV3O 3U3XA 2DU8A 2GGSA 2PNFA 3ZWBA 4BKRA 1ENPA 1S6YA 1DJQA 4CLOA 4DRYA 3K9QO 4YYZA 3VTFA 4J0EA 4EI2A 4TWRA 4YRDA 3L4BC 4PRKA 1GEEA 3DHNA 4BO5A 2O23A 3ONDA 3U0BA 3UCFA 3H65A 2CF5A 3WGHA 4YAKA 1R12A 3H2SA 3MJVA 4KDFA 3DFUA 4GKVA 3E82A 3ONFA 4I9HA 2AG8A 4LK3A 3RC9A 2O3RA 4XR4A 3ENNA 3TWOA 1TT5A 1LA2A 2OORA 1NBOA 1R37A 2PD3A 1RWBA 4RF2A 4NMHA 3PJGA 3RC7A 2FN7A 3C1AA 3W4IA 4WK6A 1UJMA 3VPXA 5L3ZA 4GAEA 1NVTA 3VVBA 5T8KA 4PZEA 1T1RA 4OM8A 2DBRA 4XZ3A 3DTYA 4Z9YA 1R66A 3MZ0A 1X1EA 3VZSA 4BNKA 1NVMB 3PHIA 4LVUA 4DGSA 5CEEA 5JAMA 4BO6A 2WE7A 1NASA 1UP7A 5A5FA 1LXCA 2OUIA 1H6CA 3TL3A 4YJDA 3U4HA 3PI7A 1E6UA 2C2XA 2RH4A 4R5HA 1FDUA 4OYRA 4A7PA 3I83A 3K8ZA 2BLLA 3A06A 3GUCA 1MFPA 3H3JA 3ADOA 4CMBA 4TQGA 4DMLA 1Q7BA 2YQ5A 4EJ6A 3NRCA 4JROA 5JLAA 1WVGA 1PQPA 4FR5A 4TMFA 2FOIA 3DZBA 3UFXA 1QG6A 1QSGA 3L07A 4UEKA 3IS3A 2EW8A 1YJQA 1CQIA 2UUOA 1DIAA 3ADPA 2Z1NA 3BMQB 4KOAA 1KETA 4N7RA 4XGIA 4LCJA 1PZEA 4J6FA 1Z74A 1T25A 3O38A 2O2YA 3GVXA 5JDCA 2B4TO 3K5PA 2CUKA 2P68A 1KEVA 3AWDA 3HN7A 1F06A 4TVOA 4D41A 2O4CA 2QZ9A 1W8DA 4CL8A 4YT2A 1V35A 1XYGA 3EY4A 5K6AA 1TB4A 2B83A 4MIOA 1WMBA 3GN2A 2GF2A 2YV2A 1OBFO 3WIDA 1NR1A 2Q2QA 4OGWA 2YW9A 4E5YA 3ZWOA 1YJ8A 5TX7A 2GZ2A 4CM4B 1PS9A 5L51A 4FOOA 1R6DA 1T2FA 2B5VA 2OHXA 3ZU4A 3Q2IA 1HZZA 3JYPA 5TQVA 3U09A 3WWYA 1ZCJA 5TT1A 2RAFA 3ROPA 4ND4A 4J2HA 4J1QA 1EUCA 3DEYX 3FR7A 4KDEA 2JJYA 1GY8A 3GEMA 4MO2A 4NHEA 4M55A 2VYNA 3CZRA 1E3WA 1EDZA 3PFWO 1H6AA 4DLAA 1L7EA 3ON5A 1R4MA 2VUUA 1C3VA 1RM0A 2GN9A 1YDWA 4CJXA 5ADHA 5ICSA 4FFPA 3UOGA 3L0DA 5JPIA 1GAEO 2V65A 2R00C 1NQ5A 3MJSA 4OH1A 4MP8A 2DUUA 2I3GA 4E2ZA 4NK5A 5L4LA 4HNGA 1UZNA 4EBFA 1E3JA 1GYPA 2EHDA 4DPMA 1U8FO 5AQ1A 3VOSA 3U49A 3GEDA 3ORFA 1NXQA 1YQGA 2Y66A 1MA0A 3BTOA 1VSVA 2X23A 3B20A 4XB2A 2F1KA 5C3MA 4QX6A 1LRJA 2C2YA 1I0ZA 1HE2A 1LSJA 1Y9EA 2D3TA 1B8PA 4PIVA 1QKIA 3JQGA 3U5TA 3ZWCA 1YWGO 2D8AA 4GWKA 4YRAA 2VTEA 4GX1A 5IXSA 4FSHA 4MVJI 1Q0LA 5DF1A 3UICA 2Y1GA 4XJSA 4XQCA 3WFIA 5ITVA 3GZNA 1BDBA 2ZJ1A 3E9NA 4BO2A 4GSKA 4UAGA 3PTZA 4D3FA 3ICPA 1PZFA 3O26A 1XCBA 3F46A 1AUPA 3HQ4O 3JQAD 4IXWA 3WDSA 5TS3A 1J5PA 3FN4A 1MP0A 1O95A 1YH3A 4FFLA 1XELA 3H8VA 3HFGA 3DBHB 3WQQA 4JN6B 5CDTA 4OAQA 1X14A 1EUDA 1RPNA 1AN9A 3VKVA 1K0UA 2NADA 4ALJA 3ZW8A 3QV1A 1E3LA 1Z45A 4BNYA 1I24A 1X1TA 2W2KA 3B1JA 1HLPA 1R16A 4IMRA 3BTUA 2VZ8A 4AJ1A 5JDIC 3LT0A 4QXMA 1NFFA 1B26A 1X15A 1I8TA 5A03A 2O48X 2PFGA 2H6EA 4PFJA 5IDWA 2PZKA 4K26A 2HKIA 4PRLA 1G6KA 4BV9A 3MWDB 1UXGA 3MJCA 1HLDA 4WOKA 3BYZA 5IAAA 4PLTA 4DIBA 1V8BA 3A9WA 2AQ8A 3GVHA 4LMRA 4I08A 2G17A 4EJMA 4RVDA 4XX0A 2HDHA 5BR7A 3GNTA 1KVQA 1I2ZA 2Y93A 1PIWA 5L4NA 2EGGA 2QYTA 1XG5A 2RIRA 4LN1A 4PLVA 4CR7A 3QJ5A 2XXBA 3OFSA 4Y9DA 2OOSA 3VH4A 1OC2A 1J4AA 4FJ2A 3ZHXA 3O03A 4HFJA 4JXKA 3VAZA 3GNQA 1U4SA 4CMKA 2E49A 5F1PA 4AJNA 4R54A 1Q7CA 2W2LD 4B7CA 1T4BA 4J1NA 3RUAA 4L73A 1KVTA 3D7LA 4HADA 3W1VA 3WJ7A 1J49A 2V6GA 1DIGA 3MTJA 2DLDA 1KS9A 3M1AA 3AM5A 5FEUA 4JLWA 2HRZA 4ZRMA 5KKCA 1A7AA 1PEDA 3EZYA 3OJOA 4QO8A 1LDMA 3IUPA 1KC3A 2IDZA 4XIJA 1PZHA 3I9KA 2RCYA 2VYVD 3GH3A 3I3OA 3NJ8A 1UP6A 5FYDA 2YFQA 2YV1A 4EW6A 2D59A 1PJTA 3DO5A 3I5MA 3JYLA 3CSDA 3K30A 3NAQA 1DFHA 1GQYA 3Q0EA 1F17A 4YJFB 1R0KA 1KYQA 3BMNA 3QVSA 2EERA 4FC6A 1GYRA 3LC1O 1T1SA 2I66A 3AI1A 1HSOA 5A9RA 2PLAA 2Y1CA 5DBGA 4ZQBA 1B15A 1DRUA 1MB4A 4R68A 4B4VA 9LDTA 3R1IA 4XIYA 4ZA2A 4CM5A 3D3WA 1UXIA 1TLTA 4CM8A 5IFLA 1ZFNA 3T7EA 3CINA 2JAPA 1KC1A 4R16A 3HDJA 1PU2A 3MJEA 1XIVA 2POQX 3JQFA 2YHIA 3CMMA 5JDCC 5KJFA 4BKPA 4R4JA 2Q1TA 3RCBA 3PP8A 2B37A 1SNYA 4XEHA 4CM9A 5A4DA 4UUMA 4TROA 4JCOA 4WOJA 1DSSG 3DHEA 2G82A 3PYXA 2PGDA 1H2HA 4AJ4A 3G1TA 3VH1A 3LYLA 4YVFA 5MGBA 4FW8A 5I8ZA 3KM0A 4E32A 4F6LA 4UVDA 1GZ6A 1ARZA 1VC2A 1PS0A 1RM3A 2ZYGA 3PIDA 4BVAA 2ZB7A 2NU6A 3LF2A 1MLDA 1IE3A 3WQRA 1E77A 4ALKA 2CMDA 2EIHA 1DXYA 3NDIA 5COAA 1ZK0A 3PYMA 1X7DA 1ISHA 4BNNA 1XEAA 3K2EA 1QV7A 4W82A 1R0LA 3FBGA 2IXAA 5BSFA 3W6ZA 3ZHYA 2OGUA 2Y67A 3NKLA 1LUAA 1SEVA 1XKQA 3PWSA 1ISFA 4IDFA 2FHSA 4E33A 3NUGA 2YFHA 4IZHA 1YVEI 2J3KA 1VSUA 4WCFB 3RUCA 4GX2A 2IZ0A 3A14A 4HP8A 3CH6A 3BHJA 1DBVO 3H7AA 1DC4A 4CR8A 4TZTA 4TZKA 2NVWA 2OP0A 3O9ZA 2VZ0A 2GYYA 2PH5A 1LDEA 2HMSA 3BMOB 3D4PA 3NGLA 4OHUA 1O94A 4FFNA 3WTBA 2QHXA 1U8XX 4BB6A 4E5NA 1YQDA 3JQ7B 4NBVA 1F8FA 4QQRA 3IQDB 3NDJA 3IIEA 2PD6A 4B8ZA 1B8VA 4GI2A 4ZJUA 2EP5A 4XQ9A 3K2BA 4WASA 4DXHA 1WNTA 3X2FA 5HM8A 2HUNA 1ONNA 4J2OA 1EZ4A 1IZ9A 1ENOA 3UVEA 2SCUA 5L9AA 2P9GA 4WPGA 2IEDA 4IDBA 3EC7A 1PJLA 4TSKA 3M6IA 4IDDA 4IIUA 2WYVA 4Z3KA 1WDKA 4KTVE 3G17A 5KIAA 3Q11A 1B3BA 3UCEA 2X0JA 4IGFA 3GDOA 5CDGA 2VOEA 4B4UA 4M8SA 3GVCA 3RIHA 3RUFA 4AJJA 1C0KA 1U2DA 1P1RA 5T67A 1ZIDA 4CLHA 1CETA 5L7TA 4RF5A 1IULA 4ID9A 2DTEA 4FGSA 3V1UA 2FSVA 4YEDA 2GDZA 4PG7A 4ALMA 4C7KA 4MVJH 4FFOA 3VC7A 5G0UA 2BHLA 3H9UA 5AXBA 4Y6PA 1P77A 3DMTC 2GLXA 1C1DA 1KEPA 1ISGA 2AE2A 2D5CA 1QORA 1EVZA 4FOSA 2CVZA 3ZZNA 1HDOA 3WNVA 3U62A 2BFMA 5KOIA 3GGPA 3AFNA 3FI9A 1R15A 1KVUA 1VM6A 1E7WA 3H5AA 4EEZA 1LLUA 3OHSX 3D5QA 3GAFA 5T57A 4FGWA 1C14A 3C7DB 3WGYA 4HKTA 4JX8A 4BOYA 4W99A 1R4NA 3WIEA 2Q49A 3E6AA 1F14A 5DP1A 1D4FA 2QRLA 5JCJD 2Y0EA 2AW5A 1FF9A 3L9WA 4KQWA 2JKVA 1N8KA 3VH3A 2YJZA 4BB5A 5EMHA 1YOVB 3G0OA 2Q1SA 3VDQA 4Z9XA 1WMAA 1V6AA 3WLEA 3ZV4A 4XQEA 4YCAA 3BTSA 1TI7A 1V3UA 1H93A 4UUPA 5BQFA 5TRTA 5EERA 5IDYA 4NBTA 4XYBA 1RM5A 3DDNA 4LGVA 2R2GA 4QO7A 3ZWYA 4BKOA 4HY3A 3GRKA 2VZ9A 3H4VA 4MVJP 5TGDA 1IYZA 1ZSNA 2FMUA 3AI2A 1JDJA 5IF3A 4E4YA 4PLFA 2Q45A 2PKQO 3IJRA 5DP2A 4NBWA 2A92A 3F4LA 3Q9UA 4JP2A 4R9SA 4DA9A 5L7WA 2WDZA 1D1SA 3LLSA 1LX6A 5IN5A 1PGJA 1DAPA 2OFPA 3WICA 2VHVA 4RVFA 3CZMA 4CUKA 5L40A 1M67A 4U5QA 3QW2A 2VHYA 4J1SA 2YQ4A 3GC6A 3HSKA 4GH5A 1GZ4A 4R69A 3N74A 4JQCA 4CLXA 5JYEA 3GG9A 3QWIA 1N1EA 2VRCA 3AOGA 2IODA 4Z0TA 3S2FA 5I8WA 4J49A 4XRGA 2QRKA 4JBIA 1ZEJA 3BTVA 2DQ4A 3RASA 1OMOA 2E4AA 3ROMA 3OJ0A 2ZCUA 1LRLA 4U8GA 3A4VA 3PJEA 4OL9A 4WLEA 2DKNA 1LTHR 3KSZO 4FJ1A 3WX0A 4UUNA 4W9NC 3ZWNA 1L7DA 1PR9A 1VJTA 1QXSA 5C7OO 1OFGA 4PLHA 4GGOA 2B4RO 1XQ1A 2H63A 5TT0A 1H94A 3S55A 1DIHA 5BSGA 2EGHA 1WDLA 2J5RA 2YV3A 5G4KA 4BNTA 1BVRA 1Y1PA 2NVUB 4BQPA 3C8MA 5JAZA 1NAIA 3JQEA 3QRWA 3ETDA 3SC6A 3ZU3A 3JD1A 1X7GA 4J9VA 4PVCA 1PZGA 4JBHA 1ID1A 3AUTA 4CMEA 2BD0A 1CDOA 2F00A 4U0JA 2JL1A 4NFSA 2AQIA 1HE3A 2NTNA 4OOFA 4RV9A 3OMLA 4NJMB 5B12A 3E9QA 4BKUA 1N92A 1DEHA 3PGJA 1Q1NA 4D46A 2NTVA 1CQJA 5JW6A 7MDHA 4XQGA 1U4OA 4FD3A 4CQMD 3S1LA 5EQFA 2OP1A 2CVQA 5JAQA 4O59O 4AL4A 3E03A 4DPKA 4XYMA 3GVPA 3OETA 4RF3A 4F6CA 5JFOA 5ILOA 4GMGA 3ZW9A 1YGYA 4E6PA 1B16A 4TVBA 2HRBA 1MFZA 2X9VA 1GV0A 2PKQP 5EQDA 2ZTLA 2CVOA 4M1QA 4DMMA 3W6UA 1QLHA 3GMSA 5JO0A 5TJ9A 5DT9A 3GHYA 3F5SA 2P9EA 4DIFA 1NTOA 3DOOA 2H9IA 1T4DA 5DNAA 5A3VA 4J4TA 2WD7A 2AE1A 1LQTA 1GYQA 1VL0A 3TZKA 1U3UA 1AXEA 1P1JA 3RBZA 1BHSA 2EWMA 4FPXA 1PSDA 3CEAA 3PHHA 4CUJA 3BAZA 4GBJA 4RGBA 4J7CA 1U9JA 1OI7A 4YWJA 1Y8QA 4OSPA 1X13A 4R3WA 4PG5A 3L4SO 4J9UE 5C7IO 4MIEA 4CM1A 2I76A 4WLVA 2EJWA 1S7CA 2Z1MA 4ZU3A 1DLIA 1M76A 1TA4A 3PIIA 1PGPA 1ZEMA 5HBRA 4YQZA 1OZAA 3U4CA 4D3SA 2HMWA 4D7AA 3WYEA 1Q0HA 1XU9A 3TDKA 4NG5A 3U9LA 4YPOA 1PL7A 4W4TA 3WYCA 3R3JA 4YACA 2BI7A 3MTGA 4YAGA 2DPHA 4E5KA 1P31A 3F1LA 3QVWA 1A9YA 2Y1DA 3FNGA 4ND2A 5B4UA 3HN2A 4QEDA 3ZWAA 3PDJA 1N5DA 1HDCA 1J0XO 4WJZA 5GZ6A 3MCVA 1TT5B 4FJ0A 4XD2A 4K1LA 3FWNA 3BMCA 1QYWA 1I3MA 4ZD6A 3ZN2A 5JMWA 4ZHSA 1ZJYA 3UGKA 3VTZA 3PHGA 1WAMA 4NU6A 3VVCA 1TT7A 2OO5A 3JQ9A 4XB1A 5CPBA 5JAIA 2Q1UA 1IPEA 4YJHB 3QVXA 2P4HX 3FNHA 2EJVA 4DYVA 2EKLA 2I67A 3OEYA 1EFKA 2GZ1A 1LI4A 1P0FA 4Y6RA 1ZXBA 3WLFA 3JQAB 3GNSA 3GQVA 1E1KA 4E21A 4Q39A 5KVQA 3LK7A 3BMQA 4CR6A 1ULUA 1CWUA 2J3IA 3IUSA 3KHUA 1VE9A 1PQUA 1ZNQO 2DTXA 2ZTUA 4IS2A 1PGOA 2I65A 1P1HA 3DAGA 3F5QA 1WLYA 1UZLA 2Z5LA 2X0RA 3N58A 1JVSA 4MKRA 2HJRA 3RVDA 1UDBA 1W4ZA 2O7SA 1P1IA 2V6MA 3JSAA 3DZJA 3T4XA 1YO6A 4J1TA 4BO8A 2V6BA 4DQUA 8ADHA 5A02A 4EDFA 5G0TA 4L0QA 3FBTA 4GL4A 2VWHA 3ANMA 4CM4A 3GFBA 3GUYA 1XWFA 4BNMA 2JD0A 2GPTA 5HA5A 3E18A 3JQBA 4KUHA 1P45A 3RAJA 1EBUA 1NNUA 5T6BA 2Q4BA 5A04A 1UXKA 3P5SA 2EP7A 4HWKA 3KYBA 4WCDA 3ETGA 1GPJA 3M1LA 1XLTA 3HDQA 3JD4A 4A2CA 1SOWA 1YB1A 3PGXA 3B6ZA 5EESA 4E0BA 3BHMA 1NAHA 3EMKA 4R1UA 4EYEA 1WPQA 3TZQA 3KYDB 2UYYA 3GLQA 3OIDA 4YAJA 3IP1A 4XDZA 5F3RA 3INRA 3UHAA 3FF4A 4HFRA 2AMFA 3ITKA 1QR6A 4YTEA 5B4VA 3VPGA 3VPSA 5DN9A 4Q3DA 1UP4A 4P38A 2J5QA 1SZJG 2VT2A 1FMCA 4MVJF 2VRBA 1EE2A 1I3KA 3FRJA 4UULA 3TNLA 4I5EA 5KVSA 2PGLA 1VKNA 1CEQA 1W73A 2BGLA 3JQDA 3AFMA 5CP8A 1H6DA 2P5YA 2GUGA 5LDGA 2Y1FA 1SB9A 3MEQA 1TXGA 3P2OA 1AE1A 2H1SA 1KIFA 4TKLA 1IB6A 3VPHA 1Y9AA 4R3NA 1BGVA 2FR8A 1YS4A 2XOXA 2G0TA 3DZGA 1ZXLA 3FHLA 3MOIA 1GV1A 3AY6A 1R4MB 1LEHA 4I5DA 4DIOA 1D7OA 3KLMX 3R3SA 2VNAA 5CG2A 1V3VA 1HRDA 1I30A 1Y8RB 3W8FA 1NM5A 2HQ1A 3PQDA 1H9AA 4I8XA 5JNLA 1T2AA 2HAEA 1KVSA 1GCOA 1YL5A 2JFFA 2ZQZA 3QWBA 3JD2A 3K96A 1FK8A 3PWZA 1MGOA 1IL0A 4J90A 1ULSA 5BSEA 2X6TA 2EKPA 2QQ5A 4F46A 1K2WA 1ZMTA 4BNVA 4MP3A 2O3SA 1PJQA 2BF7A 1ZSVA 1UR5A 3BIOA 4PLPA 3GPIA 3ANNA 5EN4A 3JQGB 4H15A 3QP9A 3D4NA 3DAPA 5DOVA 4CQLB 3A1NA 4N5LA 1GR0A 2RH8A 3LT1A 3OJLA 3TN7A 1O9BA 5F1OA 4IDAA 4P4GA 3WGQA 4C7JA 2NM0A 4G2NA 4JGBA 1HDYA 3H6KA 5HS4A 5IN4A 2NACA 3LT4A 3OQ6A 5C37A 1M6HA 3QVTA 4M89A 3DWFA 5GZ3A 2W98A 3LT2A 4FQ8A 1ZSYA 1PGQA 4BUCA 4BNGA 1GUZA 4RDHA 1FJHA 3M2PA 3O8QB 1VL8A 3UH1A 4DQVA 3UN1A 5CDSA 4B8WA 2OMEA 1ADGA 4E2YA 1K6XA 1M6WA 2AQKA 3EHEA 4CV1A 1JWBB 1WXDA 4CMIB 4WLOA 3ZU5A 4DBZA 3WBFA 1E7YA 1FXSA 2VWQA 4BGVA 2NQ8A 4B3HA 3NJ4A 5ENDA 2DBVO 4B4WA 2HMUA 1SMKA 3LC2O 2Z95A 4B79A 3C85A 3AM3A 1A7KA 4IXTA 3LU1A 3F4BA 2NU9A 1JAXA 2NU8A 2PTGA 5T8KC 3COSA 1PX0A 2O7QA 3KEQA 4KMSA 4RORA 2VHZA 3OH8A 3WGTA 1SBYA 3ETEA 4E12A 1Z75A 1Z6ZA 3AU8A 4YJGB 3W4KA 4F3YA 5CG1A 4QTZA 1CF2O 4R1TA 3HZZA 1GU7A 4CMGA 1DOHA 5A9SB 3AW9A 2CNBA 3KVOA 5DZSA 4OXKA 2VYND 4AVYA 3JQ9C 1ORRA 4OO3A 1U2GA 3L6EA 4FIZA 4O0LA 4YJFA 5JBIA 4R51A 1AXGA 1E3EA 1HDRA 3KZVA 4A26A 2QX7A 3D3EA 3VHRA 4CUZA 1NHGA 1E92A 1KEUA 1PJSA 1O8CA 4E2WA 2GR9A 3DBRB 2ZQYA 1F8GA 1OC4A 2AXQA 4IY1A 4Z6KA 5EPOA 4O1MA 2PK3A 3RUHA 3WMWA 3MWEB 2P9CA 6LDHA 2VT3A 3IP3A 3RU7A 2C20A 5JC8A 1GEGA 4BMNA 4RPLA 4XGKA 3JQCA 2UAGA 1VLLA 3UF0A 3W8DA 2X9NA 4A0SA 1QYVA 3ANLA 5JY1A 4BNXA 1DC6A 3I6IA 3PQFA 2X7HA 2X8LA 4BGIA 2PH3A 5DULA 3FPCA 1HYGA 1N7GA 1PWXA 3FD8A 4HUJA 5K6AC 4Q3NA 2ZB4A 3OA2A 4ND1A 3TFOA 2CF6A 1GQQA 4ONEA 1NVGA 2Q4EA 3C7CB 3GR6A 2DT5A 7ADHA 1C0PA 4GX0A 4L9RA 3ZWVA 3JQBC 1V3TA 1XR3A 3D3WB 4ZGWA 2C5EA 1DIRA 2O3UA 2X5JO 4BMSA 4OXYA 1E6WA 1RJWA 4PLWA 4GSLA 3DR3A 2UVDA 3V2GA 2Q46A 2HMTA 2DTDA 3NDRA 3WR5A 2HK8A 3TQHA 2EW2A 2RHCA 4GVXA 2ZCVA 1U5CA 4DVJA 2Y99A 4R1SA 4KWHA 3PLNA 4MVJA 2QIOA 2QG4A 5LDHA 2C7GA 2HK9A 5L45A 1E7MA 4PLYA 4LMPA 5TSDA 3PRJA 5KVVA 3PJDA 4OSOA 2OL4A 1ZK2A 2LDXA 3B70A 3OF2A 3PVZA 4GGPA 3JQ6A 4AJIA 3BMOA 3FSRA 4BNIA 2O3JA 1GZ3A 4Y67A 3ZV6A 3AUSA 4J91A 1A71A 1AHIA 4N5MA 4RVUA 4MPDA 2JD1A 1WWKA 2JCYA 4GLLA 1BSVA 3DOCA 3QVOA 3B1KA 4D43A 2DC1A 3JYNA 1FDSA 3DBLA 1P1KA 3PLRA 4WLUA 3N7UA 4IJWA 4L74A 3TZHA 5CDYA 3V2HA 1KY4A 1T2CA 5J23A 4L4RA 1VL6A 1HYEA 3WYBA 1E5QA 3GVIA 4WNCA 1E0DA 1BMDA 4XDYA 5HS6A 4J4HA 1C0IA 3ZWMA 3FTNA 3E5MA 3I9JA 4XWYA 5JYDA 3KEOA 4G65A 4OMUA 4PLGA 1EE9A 2PZJA 4E5PA 3HB5X 4J4BA 3IC5A 1A4UA 3RSHA 1DRWA 1KEWA 1R0SA 2C29D 3RBXA 3GZ4A 2CSUA 3R6DA 3ZWWA 3I4CA 1SB8A 2NQTA 1QYXA 2XAAA 3AM4A 3CKYA 3I1JA 5AOVA 4BMVA 4E5MA 5CFZA 3D64A 3QQPA 4K9DA 4UEJA 4GQAA 3C1OA 1M2WA 4JJIA 1U5AA 4WKGA 1E7RA 3SVTA 1JVBA 5B37A 4XYGA 3PDUA 5LCXA 1Z73A 2P5UA 4D45A 1EUZA 2OBYA 1KBZA 1G0OA 1NPDA 3L4BA 4HFNA 4RCVA 4RLHA 4L4SA 3KETA 3ULKA 4BNFA 3PYLA 2C5AA 3U4DA 1LDBA 1DO8A 3TL2A 5IXYA 3WWZA 3AY3A 4P4LA 2WM3A 1EK6A 2O3QA 2X0IA 2NU7A 2QZZA 2ET6A 2FSSA 5L95A 1CRWG 3Q3CA 3F1KA 2VHXA 1QYCA 2EXXA 4XR9A 3I9LA 1XGKA 5AXCA 4H7PA 1UZMA 1HT0A 2YDYA 3AOEA 1ENYA 1I36A 1ONOA 1JU9A 2FR0A 5ILGA 5KTKA 4ZQHA 5EJ2A 4AG3A 2GRAA 3SEFA 1MV8A 2X58A 3Q2KA 2OXIA 3TOXA 5KCZA 4CM9D 4GX5A 1ZW1A 4J7UA 3NT5A 5G0VA 4D79A 2W4QA 5EL0A 5DCYA 4RPHA 4NNJA 4TKMA 4W7HA 4UREA 2PWZA 2G5CA 2C59A 1O89A 1E7SA 2BGKA 3G49A 1HTBA 1MX3A 3KYCB 1PJCA 4RZIA 3KSUA 4TRJA 5F21A 4EITA 2ILTA 5TC4A 3E48A 1BG6A 1ZK1A 2BI8A 3RFTA 2XXJA 1CJCA 4UVIA 2IZZA 1ADCA 4CQMB 5IG2A 4PG6A 3ZWPA 1X0XA 5IJZA 3SJ7A 1GPDG 3ZGYA 5KNLA 1R4NB 3LF1A 3WG9A 2VTDA 4MKZA 1DPGA 4M87A 1K6IA 3AUAA 5IDXA 4LCEA 4J3FA 2Q1WA 5EINA 3DMYA 2BH9A 3EW7A 1ZUD1 3HADA 3OEWA 3H9GA 2FPPA 4I5GA 4PCVA 4MVJM 2HCTA 9LDBA 2I3AA 3QWHA 4PZCA 1YONA 2Y1EA 5ER9A 3E8XA 2D2IA 5KJ1A 3DFZA 4MDHA 2G76A 4KQXA 4BNWA 3PJFA 1NPYA 1O6ZA 2PGJA 2ZJ0A 4IGEA 3F47A 1EK5A 5FI3A 4JJFA 5MDHA 1BTOA 4RPKA 2B4QA 2O2SA 1UDAA 4CLRB 4URFA 4F45A 4RPJA 1C1XA 2VWPA 1EVJA 3I23A 4D42A 4M54A 1VPDA 2YDXA 3PHLA 3WQSB 2Y68A 3JQFC 4QSMA 4QUKA 1ZBQA 2CDCA 3D1LA 4DLBA 1U3TA 1H2BA 2CFCA 4CM6A 2B0JA 8LDHA 3D5TA 3IKVA 1Q7GA 4DC0A 2WD8A 4NPCA 3DBVO 1NP3A 1SCUA 5I7SA 1FDVA 3DQPA 3P19A 1UAYA 4LSMA 3TOZA 3DXFA 2W90A 4JIGA 2NSDA 4FFRA 1VJ0A 1P9LA 1P0CA 4AJLA 2Y05A 1ONPA 2VUSA 4MVJE 3NT2A 1DC3A 5I7FA 1HWYA 4CV3A 1J6UA 2J6IA 3ZU2A 4UVEA 3EGOA 1GUFA 3LLVA 4KWIA 5DBFA 5L7YA 4Q3BA 1DHTA 1NWHA 1JAYA 4FS3A 3GHHA 2PA3A 2NVUA 4UVGA 2Q3EA 5U4QA 1LSUA 3V5NA 3SBOA 1E6EA 1K89A 5EIOA 4NQZA 1U1IA 1WW8A 2AA3A 5TF4A 1ML3A 3CE6A 5B1YA 2EEZA 5KJEA 2J3HA 1A9ZA 4MVJG 2R00A 4NDNE 4GMFA 4TRRA 3KLPX 4DL9A 4YA6A 2YYYA 1U3VA 5G0WA 4ZN6A 3EVNA 2BRUA 1BXGB 2HMVA 3JV7A 3DL2A 3DHYA 5A05A 3V1YA 5COQA 1UXHA 1BW9A 4I9UA 5I9MA 4ZICA 4IS3A 3PK0A 4OQZA 3SC4A 1QRRA 2HU2A 3K6JA 2C82A 3GAZA 4CMCA 1N9GB 1LC0A 5ITWA 3OECA 3IAHA 1JWAB 4NFHA 3GDFA 3I9MA 1H5QA 4IIVA 4WLFA 1P1FA 3LQFA 5G4LA 4UEOA 3ZNPA 1F0YA 1HE4A 3C1TA 4IZIA 3WOHA 1B3RA 3FNFA 4WNIA 4CPDA 4ZQEA 4DWVA 5C5IA 4GVLA 2WYUA 4HBGA 5THKA 2I9PA 1PJ3A 3GGGA 4NZ9A 3QWAA 4E30A 1GL3A 1NWCA 2PD4A 3KUXA 2B5WA 2ZB3A 3QWFA 4MIYA 1VJ1A 4E13A 3HWRA 1LDGA 5AVOA 1FDWA 3WGOA 5ICMA 3FTPA 3KBOA 4OQYA 3JQ8B 3OIFA 2A35A 3IJPA 5HTOA 1I10A 5K9ZA 4B3IA 2UUPA 1MC5A 3I4FA 1JQBA 3LZ6A 1ISJA 4CLOB 3VDRA 3IKTA 4L8VA 3QA9A 1I33A 3RJ5A 5JC1A 3S2GA 5ER6A 5AXDA 1SAYA 4LRSB 4IQ8A 2HLPA 3RUEA 2WD7B 5C7LO 4XJTA 1LSSA 4NI5A 1HDGO 1NPTO 1A27A 4LVCA 4A27A 1I5RA 4IQ0A 4AJKA 5KWEA 1PJBA 2E6UX 2O4UX 3HUDA 4OJNA 4XKJA 3QE3A 2ZTMA 5KKAA 5B4TA 2IE0A 3DZFA 1Y8QB 3RC2A 5JCXA 2YHUA 4DC1A 2GASA 3AOEC 3H9JA 1SEPA 4DBVO 2DM6A 3S8MA 4CMJA 3BA1A 1BWSA 1YKFA 2D4AA 4M86A 3JCZA 4OIMA 3W4JA 1EBFA 2GO1A 3DOJA 1X0VA 2VWGA 1ADBA 2VRCD 1O5IA 2YY7A 3TRIA 4YJHA 3NEPX 3PZBA 2CDAA 2NUAA 5CEJA 1OAAA 1Y81A 5A9TA 5CDUA 2A4KA 1Y7TA 3EVTA 1RYDA 4JNKA 4B7XA 4HX5A 4M49A 2J3JA 3UCXA 3JQAA 4J16A 1QV6A 1XA0A 1EDOA 1JA9A 2PV7A 1O0SA 1LJ8A 1GDHA 4FC7A 3NTRA 1GTMA 4HFMA 2P91A 3Q9NA 3WXBA 4N54A 3VZRA 4FB5A 4C4OA 1AHHA 2DAPA 3BMCB 2Y1OA 3RKRA 3NTOA 3AUUA 1LLDA 3LSYA 1G0NA 4U6SA 3X2EA 5FFFA 4JJGA 4BO9A 3EUWA 1HSZA 4R01A 4Y6SA 4YB8A 3AI3A 3SXPA 3WGIA 2X22A 4BIIA 2FR1A 4NU5A 4NK4A 5GZ1A 2GN6A 2QRJA 1YBAA 2DUWA 2O50A 2R6JA 3NGXA 3OJEA 3SLGA 1ZO8A 2FRDA 4D0SA 3JD0A 1DFIA 4Z0PA 1HZJA 2D5AA 3HNPA 3T7CA 2PY6A 4PG8A 3MOGA 1PR3A 4RO0A 2JHFA 4WEQA 3K31A 3KTDA 4BGEA 2ZATA 1ZKMA 4BO7A 5H82A 1ZK4A 4EUFA 2FP4A 3B1FA 4TRNA 1KOLA 2NTJA 1PS8A 3PZRA 2CY0A 4Z0HO 3UW3A 3H2ZA 5DCWA 4UUOA 1ZZEA 5ENVA 4BO4A 1DHRA 2GZ3A 2W2LA 3RUDA 5JY6A 3KYDA 2JFGA 3RQSA 3OM9A 1AGNA 3TZ6A 4BHTA 3UUWA 4DUPA 5KJCA 1HETA 1LLQA 2Q50A 2C7VA 3T4EA 1EMDA 4CV2A 1MG5A 3PQEA 1RM4A 1SOVA 2AEJA 4MOWA 4YRBA 3JYQA 2FPGA 2H5LA 3WTCA 1E3SA 3RBVA 1V0JA 5A5EA 2VYVA 1N7HA 1PGNA 1Z7BA 5FWNA 3FR8A 1K6JA 1SPXA 3GF4A 4RF4A 1E1LA 2VQ3A 4UVHA 4IJKA 3ZNQA 1HE5A 1UH5A 1Y6JA 2C07A 3ZHZA 3KSDO 1MUUA 1T2DA 4GPD1 3PPIA 1IPFA 1T26A 2FZWA 4D44A 3RU9A 4WEOA 1GUYA 4BO3A 1E3WB 4A5OA 2ZKLA 1EQUA 2BFAA 1WZEA 2YUTA 3E1KA 2HJSA 1Y8RA 1NQTA 1XHLA 3WS7A 1FDTA 4CMEC 3IDSA 4CODB 1JTVA 2WE8A 4Q9NA 4BGUA 2E48A 3OA0A 3RJ9A 3WGZA
chains in the Genus database with same CATH superfamily
1YL7A 1I2CA 3DE1X 5I9SA 4QRHA 2GWHA 4M60A 2GBLC 3ABSB 1IHXA 3MGBA 2GPAA 4I46A 1RYFA 3C2QA 3RFTA 3CVJA 1QLJA 2BTOA 3FMVA 3G2KA 4UUAA 3WBBA 2GA8A 5TB5A 5LD2B 1PJ2A 3G59A 1GAXA 5FUXA 3VR6D 4C7OB 3FMIA 1T36B 1U28A 3ZCXA 2XKKA 1R00A 3EBOA 4YH1A 1YDFA 3U26A 1Z6YA 3PSHA 4HRAA 5I9LA 2PJRA 2A7XA 4Y0AA 2JIZA 4U6QA 4URXR 2WF6A 1XK6A 2C7RA 2XDYA 3HB4X 3NC0C 1ULAA 1YXMA 3LUDA 4LISA 1NSFA 1PLJA 4L75A 3DD5A 5D5PA 2DPGA 2Q3LA 3LUPA 5FV7A 2E37A 1ZVMA 4I55A 1X42A 1GTG1 4LW8A 3AH8A 1Z0KA 4AJOA 4DILA 2PU5A 3ISJA 5BOSB 3N2KB 4W8OA 3LX8A 4MWBA 5JS7A 3SJCA 2Q7DA 1T9CA 3MGAA 5I4BA 2M9MA 4L8LA 1XXHB 2TMYA 4N12A 4OQNA 1C7FA 3VBEA 2YXEA 5IZ4A 4EH1A 1KZHA 3ZDAA 1FTGA 4L27A 2FH5B 2QMYA 4PC6A 1BD4A 1UT6A 5BNFA 5LUBA 3A58B 1B14A 1WIWA 4I6JA 2JCVA 4KQ6A 1T5BA 2GF0A 3IOBA 4OKSA 4B83A 3EQZA 5JEEA 1NATA 1RJEA 1IZ8A 1H9CA 3U4QB 1VMDA 3LD9A 4EUEA 2AJTA 1XD2B 2WTAA 4BN4A 4F4UA 3MMSA 4FFSA 5EY5B 2XMSA 4JA0A 3GMDA 4RD2A 1DCMA 3PKIA 4ZRNA 2OQIA 1KERA 3IP8A 4DA8A 3L82B 1ZMXA 2AOUB 4W9RA 4DLSA 4CM7A 5JNRA 3QXSA 2OE2A 1RYHA 1UDCA 2OC9A 3LBHA 5J63A 3U40A 1J8YF 4QOHA 2EL7A 1H2YA 4MHOA 3TSWA 3FUVA 3JVIA 3OZAA 4KRFA 5IDQA 4HWTA 4PVDA 2RBGA 4B17A 4S1TA 5DN6D 1FQJA 4YJGA 2AYXA 3EYWA 1MXHA 2UDPA 1CUJA 1VKOA 2ZIAA 3DTTA 3I92A 4PYMA 3J81A 1PT7A 3WGGA 2HW8A 1XTBA 3NH6A 1PTJA 2RAUA 1R6BX 1OFVA 1UKCA 4TUYB 4KAAA 5TJHA 3CF4A 2IV3A 4KNVA 4DKJA 2NP6A 5CHEA 5IJ9B 4I2NA 3V8VA 4AZ3A 1RVV1 2ZVQX 4I81A 1R4ZA 3FE2A 5LNK1 2V7BA 2VUTA 2WIKA 4PHGA 5EPEA 4Z3DA 5LFAA 2QE7A 2V0NA 1IN8A 2XCOA 2GN2A 2YMPA 3BC1A 5CB4A 5AYVA 1ZIPA 4X54A 1P2DA 4KTTE 3ZWXA 5TMEA 1QIJA 2GCGA 1F9EA 2AEMA 4N18A 3DDHA 4W6ZA 4JJEA 3LUKA 1T0IA 4IV5A 4YRPA 3V7UA 5BNTA 1M8FA 2C2HA 1LGYA 3CT4A 3I52A 4JB3A 5H81A 1L8QA 4JLPA 4EJ0A 16PKA 4KE6A 4RJTA 1YS7A 2ZYTX 1H5UA 3AEYA 2TMKA 3MWYW 3RYHB 2ZIEA 1CUUA 4U7GA 1CIVA 5JTUA 1VPWA 1QMGA 3HEMA 3KIPA 1DWUA 1WUJS 2QQ0A 1J8VA 3QE2A 2I71A 2IF2A 1DEKA 3NB0A 4KUEA 3USCS 2QM7A 1L4MA 1C41A 4HYYA 2F17A 4RZHA 4DJTA 5KQPA 4ZVUA 2FDXA 3PV0A 3RTBA 4EYGA 4C0AC 3T1TA 3FMOB 4RK7A 4RC9A 5BT9A 1G3QA 4BZPA 4PSVA 4UOEA 4BFYA 2H0AA 3U7QB 3GLHB 4J0FA 1P5HA 4CTKA 2FRDC 3CMCO 3EK2A 1I0IA 3FDXA 2QI9C 4LA4A 3VX4A 1BWQA 3QK7A 4X1IA 2BL4A 1UK8A 1L7RA 4K6CA 3EDQA 2AOXA 2B1GA 4PHCA 4EL0A 4A10A 4CKBA 4HVCA 1Y89A 3NW9A 2HRCA 3I6QA 1MT3A 3NCHA 4MWDA 1B0AA 1FP1D 1C9JA 3HV0A 4TTJA 4BJHB 3S2ZA 4P7JA 1PJZA 1WCV1 1XQ6A 1LDYA 2V6FA 1GCUA 2NWQA 3Q8WA 1UPAA 3CWZA 3IRVA 4WGGA 2BEWB 5EXPA 4JI6B 5JVDF 3WKEA 3IBTA 3RK0A 5FUYA 3HO1A 1CYDA 3NEJA 3NFRA 4JP8A 3TSCA 5IYZA 4QPDA 3NORA 3PXBA 2X9QA 1DAEA 1FL9A 3NV7A 3MILA 1N5IA 2Z09A 1UT5A 3AJAA 5F52A 2PRIA 3F6YA 1SCJA 3M3PA 3AHGA 4QEZA 3LKBA 5ECGC 5FHRA 3SF8A 2AEFA 4K6FA 3ESZA 2NVBA 1ZI6A 4IJQA 4TL8A 5JCJA 5HRUA 2WQ6A 1MC4A 3CT6A 1TVKA 4W9MC 3NIBA 1FP7A 4GDMA 1TAHA 4WCFA 4UUQA 2Q07A 2XWQA 2J5KA 3IP9A 4MUGA 5SV2A 5CYFA 2FMTA 4TVKA 3R7BA 2FPIA 5LVAA 1OT5A 3A1CA 5CM8B 2J6BA 2Z2KA 2OAEA 3CPSA 3JD3A 5JROA 3OSUA 1Y3DE 2OG1A 3EIUA 1FNMA 1KSFX 4J3JA 2F55A 1SQSA 2B98A 3FB4A 3G2LA 3JQ7A 3UT6A 2C61A 1LFAA 4ZHQB 1JXAA 2G4VA 1PSZA 2OZKA 1XCPA 1NW5A 1S4MA 1XU7A 2AGVA 2Z5GA 3LZCA 1BRMA 1E5XA 1H9BA 5MF6A 1NJ1A 2H17A 4Y98A 4JT8A 1I4LD 3NVKI 3ZDQA 5GQSA 4GXQA 1HYHA 2R8XA 4IWYA 4GQBA 4E31A 3DB2A 2FJ0A 5AVWA 1DNPA 2KPOA 4OHXA 3HKDB 3M2TA 3AIIA 3ZBPA 2FF7A 1BA2A 2V98A 2XWJI 3NX4A 3PGVA 4JP3A 3KK0A 4DL9A 3A6LA 1T8UA 2G77B 2GXQA 4QT0A 4WKBA 4G56A 1KFBB 5CEFA 5CVVA 5E7JA 1DDOA 1B6GA 4FFBA 4XM0A 4KNWA 1UXOA 3W3AA 1H1LB 5EJ5A 5TMBA 1XRMA 1OLSB 1YZFA 1P7VA 1M2OA 2JLSA 3KFVA 1PG5A 3T3MB 4KHZA 1H1DA 1LK5A 1TMOA 3KRTA 3SHTA 4PNHA 5AW2A 3HCWA 2ID7A 2JFZA 3ELWA 2JHGA 4FM9A 1WPGA 3CIFA 4LYHA 3Q12A 4NLLA 2ZRHA 4RD0A 5GM1A 1K3TA 2ZPAA 1YE3A 2DFDA 3PENA 1ZPDA 2YX1A 2ZQ5A 4MLDA 4B75A 3I2YX 2BFFB 4ITUA 3VNRA 5K3SA 3RG8A 1IEWA 3D7MA 4UCWA 2FK8A 4O63O 3A70A 2VHCA 3HYCA 2G1UA 2NO6A 3PBKA 4MV9A 4AJHA 5AJTA 2ZK7A 3L6OO 1GJRA 3PFFA 1YQXA 3GEBA 3OBIA 3PUWA 1M1NA 1E99A 3QLEA 3SHOA 5JO9A 3OT1B 4H1VA 2VHUA 1LV7A 1X2EA 1ML4A 2J0VA 5JU6A 3ZDBA 1K8XB 1XTKA 4RVCA 3T7KA 3NM5A 3MERA 1UUFA 4X3OA 1I3LA 3TTYA 5REQB 1NYTA 3TCKA 1BROA 2BGMA 1KPGA 2YWGA 3L6DA 1J5EB 1UBFA 4D8YA 2Q2WA 3C0KA 1E8NA 3V33A 3AY7A 4MW6A 4FMDB 3I8OA 1SO8A 3CS3A 2B30A 3I2JA 4LDRA 4D5EA 1RPAA 5L3QB 2VYFA 1F6WA 1Z3CA 4XFDA 5JZ9A 2JGDB 1PYOA 2J32A 5COBA 2O1WA 3I9V6 1LBQA 3MWFA 4MR9B 5BN4B 1NFQA 4PG4A 1ZUWA 2ZBEA 1JH8A 2GEVA 3AP1A 3P7MA 4FFMA 3AERB 2EX0A 4GI5A 4MV4A 4PLCA 4X1OA 4X45A 5JXHA 3A6GA 4RFSB 4ZT2A 4BAUA 5KVCA 2ECPA 3OWOA 3KYCA 1GZHB 3L6RA 4M36A 5JE8A 4KWCA 3QY9A 3FMFA 5K3OA 1ZOOA 5AI9A 5EMKA 2V7PA 1VLMA 3RUIA 3TJRA 3IB3A 1YZLA 4QGAA 2HRQA 2Y4OA 7AT1A 2QZ4A 1DRVA 3ILSA 3WNQA 4BY9E 1YB4A 2NNWB 4XYLA 4NBUA 1T24A 2XBMA 2Y6UA 1I3NA 2WIJA 4N7MA 5HFJA 4KO4S 1SVNA 2WJYA 4LRWA 3V32A 2DBQA 2VP0A 3CUEF 5MN4A 3JX9A 2P2SA 4MINA 5DOZA 5FO0A 3FG9A 4INAA 1PFKA 1DBWA 4I1IA 3ZDFA 4MV8A 5HKLA 1TD1A 3GGDA 2A94A 3T5CA 1TNDA 4O8CA 2OFXA 2L17A 1JU4A 3LNTA 4OYHA 3OEHA 2IEBA 5HK9A 2RHRA 1R0CA 3OKAA 2QYSA 3RSFA 2Z6UA 1KHHA 3FVVA 1UKAA 4LMAA 5H4GA 3W1WA 3KUUA 3JVEA 3I6BA 4BWGA 3L04A 4D2IA 2B25A 5M29A 1GQSA 1PWZA 2AHRA 3MJTA 3NVMB 3UJDA 3U7HB 4N3GA 4HB3A 4KKXB 2II6A 1MO4A 1Z2AA 4G97A 1ZOPA 4CMAA 2MSNA 5IT0A 1JJBA 2EZTA 2BELA 2HC9A 2PKRA 1WZCA 4HQOA 1X7ZB 2IPLA 4UAJA 4ZYVA 3IE1A 3JASA 2G63A 1SG6A 4ZEMA 2C4WA 3W2FA 3FZYA 4RLSA 4R1NA 3PC3A 1BDMA 1ISRA 1YRLA 5JWOA 3A6HA 1UAGA 1KJNA 1TQ2A 4YT8A 5DO9A 4AWAA 5BWNA 4FB4A 5AW1A 1GFSA 2VDQB 2ZU6A 2XDAA 1PYGA 4GKBA 4EG3A 4PINA 2DYKA 4R1PA 4OBEA 3NATA 2ZYWX 1QIIA 4PF1A 2QMHA 2WA1A 4DR5B 2QN7A 2X8JA 1E1QD 1JLLA 3CB4A 4JLUA 1A9SA 2HIMA 4KSBA 6AT1A 2OQRA 2XZDA 3NNSA 1YUBA 3QLVC 3CLSC 3A9RA 3GPBA 1HGXA 1NQOA 4W7SA 4J3NA 3VPCA 1SC6A 3OZTA 4KUGA 1T1IA 5AMXA 2H00A 2QTRA 4DCVA 3O83A 1VB3A 4DUZB 2WTBA 4QFCA 5DLPA 3V9PA 2ZT7A 5PNTA 3SC3A 5EXEA 1V3QE 4L4XA 5KAPA 3WJAA 4CLEA 1VRWA 2FZCA 2IP2A 4AFNA 2WHQA 4O2BF 1N0HA 1YE5A 2ZG6A 2IYPA 2DP4E 1KYWA 5DTMA 2ZJ3A 2K7ZA 2NPOA 5J4KA 4WV3A 2AFHB 3UXHA 2PWPA 1U6JA 1VP9A 1JFFB 3A4LA 4H7JA 3OU6A 1GG2A 3L8YA 5FTMA 5JQGA 3ZNOA 5ALMA 5TMDA 1W8IA 3ECAA 2RHOA 3T5TA 4M98A 5ELXA 4C4SA 1F1JA 2I7DA 1KP2A 2PZ8A 3B3FA 4BLTA 1BXGA 4PN3A 4DDUA 1DEXA 4NJEB 1J1ZA 4KXFB 1L5KA 4EWLA 5A1TA 1ZC4A 3QJYA 4KDRA 4MR8B 5GINE 3NHFA 1QIGA 3ENWA 1I94B 1RLUA 1FXWF 2IRWA 2J8ZA 2JAHA 4MKXA 2WYHA 4XSGA 2IZ6A 5DM2A 5H3HA 1OLUA 3N75A 1FNDA 3M83A 3QOWA 3UKOA 2PL9A 2W0MA 2WF9A 3H9EO 3JYHA 3KO8A 2QT1A 4NBNA 1U3DA 1KK1A 1QIDA 1NFRA 4V0QA 3UXMA 3X1YA 3KQSA 4LBWA 2AN5A 5L3SA 3FGZA 3IQFA 4MMZB 4CL3A 3EDMA 5BWLA 3OHMA 3OHPA 2CLOB 3IAS6 1C81A 4QBFA 8ATCA 2AFIA 2OHGA 3PR3A 4L5BA 4DBLE 4ARCA 2UXCB 3MXOA 1NBMD 3KXDA 1TLFA 4YT4A 3MINB 1VI5A 3PHJA 2EG9A 1V25A 5CPFA 3G8BA 2C8JA 2QN6A 3T3PB 4E2XA 3O1IC 4TV9B 1XDBA 1GGEA 3NYWA 4PR3A 5I4IA 3RVMA 3PTLA 3VR4A 3P0HA 1UMBA 3MK31 3GLIB 3HB1A 3SX0A 3ZGLA 1PYDA 5G0SA 1UBHS 1BQ3A 3R4CA 3U31A 1NRJB 3IPAA 4JBXA 5SYAA 4I36A 5HWSA 2FPSA 2RHMA 1EFHA 2Z2IA 3E9DA 2VJAA 4GEKA 4P98A 2CCGA 3TM5A 2DSNA 2TYSB 3ZIAD 1NZFA 3D0RA 5ALDA 3FLBA 4S1VA 5FL7A 3AIOA 3DE4X 3Q3HA 4NZYA 2ZKIA 5BYKA 2CLMB 1D6SA 2ZSHA 9GPBA 3OCVA 5JDIA 5A6VA 5FXMA 4JI5B 3UQZA 4I50F 4EPYA 1QH1B 1TQ8A 1FTYA 1I1OA 3TIFA 5K8CA 2DU8A 2GGSA 1LK0A 3BXHA 4K6KA 3UZUA 1ADYA 1U7PA 3C3MA 2H9YA 3OJWA 4CLOA 1LW6E 2AKYA 1I2DA 3CF2A 1QIMA 4TMYA 4UATA 1C3OB 5DB4A 4BP9A 5CDHA 1EJ6A 1M6VB 3DSRA 3OEHD 4KXLA 5PGMA 3V8MA 4IUBS 3VTFA 4EI2A 1N6HA 1E4EB 1W5TA 3NNDA 3Q7TA 1GEEA 1N7JA 2PBZA 1FOEB 4PRKA 4P86A 4WERA 1JR2A 5DU2A 4AXBA 3ONDA 3U0BA 3MB5A 3THXB 2V96A 4WL0A 4GR5A 2ZRAA 3EC2A 4O4HF 2CL0X 1QUFA 4EDHA 2DERA 1R12A 2R1ZA 2V54A 3ELDA 5EC8A 3NHBA 3AEXA 4OK3A 1SOMA 4QGFA 5DGTA 3UWSA 1LNZA 3IEPA 4GKVA 2BPOA 1D0SA 4JLOA 4I9HA 4LK3A 2AG8A 2FDCA 2WPDA 1VRVA 4LXGA 5L3RA 4XR4A 3GL9A 4NMXB 3A6PC 3D4BA 2EDCA 3D81A 3CC8A 4POOA 3A3NA 4HTFA 3OZGA 1OSNA 4RF2A 4BX9A 4C0KA 4NMHA 1K8QA 3PJGA 1GPLA 4I7EA 4ZEOA 1OZ0A 1U0EA 3OCZA 1U0GA 3CBQA 3STYA 2ERYA 4F96A 4UTXA 2AX4A 2J31A 4GM1A 3WYDA 2XB2A 4DLRA 1KJYA 2G0NA 4S35A 1I6KA 9MHTA 1SHTX 2R1TA 4HI0E 2SICE 3VVBA 2HB6A 2R87A 4EO9A 4MLPA 3A37A 4MUNA 2G9NA 2EX1A 4U4AA 2IS1A 1E9RA 1ODFA 3VZSA 1R66A 1X1EA 1DMSA 1I80A 1M0WA 2A5JA 3D8SA 4DGSA 2EIXA 2JK1A 1X1AA 3G9ZA 5CH3A 5A0TA 3HCPA 5LQCA 3NDBB 1NASA 2V7QD 3UHOA 1UP7A 4UNNA 4B40A 2J6CA 3GXBA 5IASA 5SICE 2PIDA 2RCNA 2J09A 3EUEA 3IBSA 5DTJA 4IF6A 4R5HA 1FDUA 4LDJA 4OYRA 4A7PA 5JYBA 1G6OA 2XMQA 1YBHA 1JU3A 1QPZA 1IMJA 1KI6B 3RE1A 3SIRA 4CMBA 4DMLA 4DM4A 2WZBA 2YQ5A 3CG4A 4F56A 2VQ6A 3NRCA 4JROA 2B1JA 1IB0A 1Z5WA 4RS4A 3TTXA 3WQBA 3T1HB 1J39A 1M74A 4ZDIA 2IH2A 1MW9X 3KC2A 3HWWA 1W0JD 2CHFA 3KTAB 4KLRA 4WKPA 3ZZTA 5TVKA 4Y3UA 5K6TA 5KHOC 4DJ5X 1UL1X 1QG6A 1QSGA 1CIJA 1CRLA 4YP7A 5LLDA 5AKHA 1G3RA 2IBSA 1RBQA 4CQNA 1G3MA 1E9AA 1W9MA 1LPSA 2OBBA 3KOYA 3BMQB 1PUIA 1YJBA 1JIUA 2D54A 2QSZA 3DEIA 5EHNA 3GPLA 3EF0A 4BZQA 4N7RA 2R6FA 4XGIA 1EJ0A 1GAJA 1EU1A 5EXTA 1JILA 2GHQA 4B6PA 2JGRA 2YOFA 3OZSA 1T25A 4NF2A 4W5QA 3UJ6A 2OK7A 4FFVA 1VA4A 4BFUA 3R9IA 2CUKA 1SIWA 2QV0A 3Q7QA 3HN7A 1E98A 2RGYA 4RVNA 5H80A 1WV0A 4YUZA 1UZUA 4DV4B 1I1QB 1V35A 4G01B 1MVNA 3G5AA 1ODIA 4B6EA 1MO2A 3K0CA 1G5IA 4XM2A 3VNSA 3KVRA 4MIOA 5E2BA 3IBCA 1X9IA 3GN2A 2LR0A 2OO3A 2EFEB 2GF2A 4YMWA 3AHEA 2YW9A 2PGOA 3ZHTA 3NRBA 3I73A 2O8NA 5CJPA 4HXFB 3CVOA 2JEOA 1RAGA 2XVAA 4PYQA 1NKTA 2I4LA 4YCMA 3VO9A 5ADUS 1LPAB 5CT8A 4BFCA 3FY4A 2G9RA 4QYTA 3TUJC 2IY9A 4EMSA 2GZHA 3U09A 4GPIB 4TM8A 2LGJA 1IQUA 2DFTA 3C4QA 3ROPA 3IULA 4EG5A 2NO1A 4J2HA 3FTDA 3FYDA 3E1GA 3DEYX 3FR7A 4EQZA 3GLGE 1M0TA 4H4EA 1NUAA 3VR6H 3W1EA 4P3YA 4M55A 4RKRA 3UHJA 5D3MA 5HIMA 2EQAA 1EA7A 4CQMA 2OYCA 1N6OA 5FWXB 3O8CA 4UDYX 1E3WA 1EDZA 1N25A 3CNHA 3H87A 1H6AA 4DLAA 3MMPA 4G8JA 3EGXB 3DMFA 4M9XA 1UIMA 3L84A 3FYHA 3NAZA 4FFPA 3V3KA 3ZC3A 1KWKA 1B1AA 4KN6A 1JG4A 3JARB 2ZUCA 2YN0A 3KJGA 1I14A 4HMQA 4HVTA 3H4MA 3WB0A 4MP8A 1OY1A 4AK9A 5EJ9A 1W47A 1TJPB 1KKLA 3QKTA 3ZGOA 3VNBA 1I6MA 1UZNA 4HNGA 3I2KA 2PYIA 1IN1A 4PQRA 3TK1A 3GLFA 4GI1A 3NIDB 2ES4A 4LJKA 4OAPA 3ZHVA 1EDDA 1GSOA 1OX6A 2W6JA 3FDIA 4EI8A 4Z5XA 1G16A 3TIIA 3WWDA 4R8VA 1HLFA 5JFGA 1K1EA 2RHJA 2X23A 1NLMA 5FPKA 1IWPB 4FDLA 5GVSA 1KY2A 4JS0A 2G4CA 1LRJA 3C5CA 4QX6A 3ZHOA 2QVYX 3NBYC 1B8PA 4PIVA 4QBHA 2E0IA 5EOVA 3ZWCA 2XKJE 5AKJA 5CA1A 1JHXA 4NRDA 2C0PA 4GX1A 1OHHA 3EDYA 4Q3LA 4FSHA 3RTEA 3WYNA 4MS1B 4F06A 1WSBA 3GZNA 3K0KA 2IXEA 2ZJ1A 3PEEA 2XRMA 4D3FA 4E08A 10MHA 3UGQA 1V7PC 1NIJA 3ICPA 2JAUA 2JG3A 1PZFA 3JZAA 4N4AA 1YR1A 1Z26A 4IXWA 1EK1A 2CNLA 4R98A 5DM1A 5K4GA 2OAQ1 1XTUA 2RMKA 1VMAA 2YJ4A 4DCSA 1O95A 2TS1A 2A14A 3I37X 5C8DA 3HFGA 1TW2A 2BLNA 4JN6B 4KZKA 1BU8A 1XQWA 4F9TA 1USGA 1E3LA 3Q3GE 1EGAA 1X1TA 3H9BA 4H0NA 4XOIA 4R2MA 2NOAA 1YACA 3BTUA 4AJ1A 5LZ4A 2ZBVA 3LT0A 1I2AA 1NBAA 1A88A 1I8TA 1NLFA 1VZ2A 2CXUA 4ZJPA 5BR1A 2QJTA 7ABPA 1M33A 5DW0A 1T2UA 1OVMA 3WBKA 2F3PA 4NCBA 2O48X 3DL0A 4PXAA 1FS4A 5IDWA 1FQWA 2GEKA 4K26A 2ZRDA 3PPXA 1JXQA 2W6OA 4WOKA 2HIHA 3Q10A 1TUBB 1CEEA 3GVHA 1GZVA 4IMJB 4I08A 3O8RA 1BCSA 1UANA 4EJMA 4HAYA 5LOVF 5JZOA 5FLXA 3IVAA 3W5CA 4PHHA 5T41A 3GQBA 1ES9A 2Y93A 3KVYA 1E6KA 1PIWA 2Z43A 3QU4A 2AF3C 2YWCA 2NXCA 4LN1A 2HPVA 4UU7A 2JGEA 3I3SR 5DHSA 3AVQA 1COWA 4CR7A 4A15A 3VKFA 1OC2A 4JMPA 1J4AA 2YNMC 3ZHXA 2HY7A 3HUUA 4UQPA 3AVXA 4HFJA 4JXKA 1VL1A 2C88A 3DCJA 3WL5A 4YCNA 3FI0A 1VCOA 4AJNA 3DFKA 5FFMA 1CUSA 2UZAA 2ZUDA 1Q7CA 2XRYA 1L5YA 1TGVA 3MB8A 1A9TA 2EFHB 4HADA 2FN3A 1J49A 1ULZA 2V6GA 3QPAA 1O9HA 3TOSA 1MJGM 1GQOA 1KS9A 3ADKA 4FGLA 3UGJA 3CEMA 3H11B 1Z25A 2HRZA 4JLWA 5KKCA 1A7AA 4LOAA 3HP1A 3EZYA 2JIRA 4HLNA 2C4UA 4N8DA 5EJAA 4QO8A 1I4DD 4KYVA 4MUFA 4EHKA 3KJFA 2R8BA 4AG6A 1QGZA 2JW5A 2RCYA 3GH3A 2GHTA 1UIRA 3I3OA 3NI2A 4RDCA 2ZYRA 2YFQA 2ZS8A 3DOFA 2JIMA 1TJYA 1MU0A 4EW6A 2PVSA 4RK6A 1VCNA 1RCTE 3JYLA 4MQ5A 3BWXA 4EK9A 1OA1A 2NO9A 2H48A 1G8HA 4N0MA 4HO1X 1FPMA 1Q7RA 3QYPA 5AI8A 4OI0A 3UK0A 1ZL2A 5JCOA 2Q3BA 2PXXA 1Z7YA 4XDHA 3WK6A 2I66A 2NPIA 4GOJA 3HY4A 4ER6A 1DRUA 2NXWA 1TUIA 2ZVPX 2WMNB 3AR9A 4DC9A 5JO0A 4ZAGA 2QUHA 1BA3A 1O97C 1IZZA 4IFTA 3MC1A 4QVGA 4BC0A 1UXIA 1NI4B 3ZKWB 3L92A 4F4CA 4C88A 3KKEA 1D2CA 1PVOA 2IX9A 1ESZA 5A5DA 4JBYA 4LHZA 1VTKA 2PWYA 5DEOA 3IXQA 1OWPA 2H2IA 4XH9B 1D6NA 3F6PA 5E9QA 2MSKA 4PAMA 3LCVB 5JDCC 3IILA 4BKPA 3RCBA 4E5UA 1TVMA 3THOA 1SNYA 1YQQA 3AUYA 2I3DA 1II8A 2R6AA 1F8UA 4XCQA 2XUPA 4XEHA 4G5SA 2YUIA 4CM9A 3OD5A 1K9VF 1SZCA 4AJ4A 2V8OA 3G1TA 5MGBA 3U7JA 1JJFA 5I8ZA 2QTAA 3LM8A 2PAFA 4RELA 3KM0A 1I7NA 2Y92A 3KEFA 5F3DA 4E32A 2EBUA 1ARZA 1Z4QA 3A1EA 2XTZA 4BVAA 3HU1A 1SXJA 3RSCA 1FSZA 3WQRA 4MAMA 4U63A 4YRMA 7REQB 3I1IA 4X20A 3TECE 3WK8A 1Y1RA 1DXYA 3MT7A 3NDIA 4YFVA 3QOXA 3DCIA 3PYMA 1X7DA 5AW3A 1G38A 4AKIA 1ISHA 1UJNA 3LY7A 3OZVA 1XEAA 4P4UA 1NYLA 5MN5A 4QNMA 3R5JA 3G89A 3L8EA 4W82A 1E1YA 3LUJA 1F2UB 4OQLA 3TIVA 3WYGA 1GKKA 3UC5A 2R5NA 4HC4A 3VI3B 2IXAA 5B1IA 1KH3A 2B8JA 1I7QB 4MUMA 2CLDX 2Y67A 2RGNA 3GJ4A 1XKQA 2XUZA 4Q4JB 1YFJA 3PWSA 3PE3A 3S7ZA 4IDFA 2CZGA 4L50A 4MKGA 2XTJA 3UMCA 3JWEA 3NIWA 4IZHA 2HA0A 4AZWA 2ZJ2A 3RUCA 4XVRA 5CA0A 2H4WA 5LQJA 1YR6A 3CH6A 3COWA 1ZN7A 4QSHA 1AKYA 3D0QA 3HS3A 4IOJA 1NZDA 1S0UA 4TZTA 1YB7A 4JKYA 4JEIA 1SVWA 3L46A 1HQKA 2B7LA 2HGSA 2OP0A 2XTAA 3O9ZA 2CZQA 4PC2A 4PAOA 3EPJA 3WTBA 3WFZA 4BB6A 4FFNA 2VJBA 3C74A 2QHXA 1U8XX 4E5NA 1YQDA 4IH1A 1NJFA 3WV4A 4D74A 3KELA 4HH0A 2RC5A 3QKSA 3GGCA 3WIVA 3B12A 1AN0A 1W36C 4RS3A 3W5HA 4AMZA 3DDZX 2ZIXB 4ZJUA 5CIQA 1ZGGA 4XQ9A 3D7NA 5ECWA 5KKNB 3E22A 4DXHA 5HM8A 4AF7A 3IBYA 2YHBA 3RADC 2HX1A 2C58A 2GEJA 1EZ4A 4HGRA 2FUKA 3DDWA 1GA4A 1ENOA 5ALSA 5KDOA 1J20A 1R0BA 1GPUA 1WD7A 2BJWA 2VZLA 2YBDA 2ZROA 3PXDA 1T5SA 2JHPA 2E1PA 1Y5LA 3ZEAA 3UJ7A 3PUHA 2WOOA 3N28A 4YCLA 3EC7A 1PJLA 5H02A 4IIUA 2SKEA 3LHKA 1ECPA 2PSJA 3WO1A 5A1JA 5GPBA 3ZGZA 1R7RA 4G8DA 1J8MF 4Z3KA 4C2TA 2QN1A 3RV3A 4N8EA 4DQDA 4IGFA 2HREA 1JHVA 4DMGA 5IT5A 4JKIA 2HDWA 1BWRA 3B52X 3UENA 4EATA 4B4UA 4M8SA 4EGJA 4MCIA 5BSVA 2IE8A 1KH1A 2GXUA 3GEHA 1RXUA 3SICE 3VQTA 4B4DA 4AJJA 2PUFA 1C0KA 2IYWA 3K1TA 2BM0A 5T67A 4BJ6A 1QU2A 1RTKA 1XTJA 2XT0A 4JL6A 13PKA 4GU5A 4H6WA 3QLUA 4PTYA 5JCPA 4RF5A 1IULA 4AMGA 2FSVA 3SFTA 1G8KA 1SHLA 2GDZA 2QKYA 3R44A 4NG4A 4RZ2A 2O8FA 4PG7A 4C7KA 4FFOA 1IEQA 5E3JA 3CF6R 5G0UA 1YE8A 3T6KA 3VC7A 2XMZA 1VCIA 3DJYA 4XX1A 2QMQA 4IIDA 1P77A 4YCBA 3LXUX 4EY3A 3CZ5A 4R2JA 2XE6A 2AE2A 3K0AA 3U7RA 4BTVA 3QE9Y 4HUQB 3VU9B 4RFVA 2V1UA 4B82A 3ZZNA 1P7CA 3BUSA 2H07A 3SCZA 4Q37A 3N0RA 1HK7A 1AKTA 2IUTA 4S2UA 2NZJA 3W34A 1VM6A 4YJ3A 2DKOA 2X3YA 4PO9A 2WD9A 4KW7A 4YN3A 3TH5A 3OHSX 4BU0A 3G68A 5T57A 1EG7A 1W85B 4HGYA 5A6SA 2CUZA 3VPDA 3PDCA 1O6BA 1T13A 4ITVA 4WZBE 1OQAA 1XZBA 4O4JA 1E62A 2OILA 4ZDWA 1EVLA 4RZ3A 1SWVA 2QORA 2IHKA 3H2JA 3O9MA 5CDFE 1NSYA 4NE7A 1F14A 4WA8A 4C3VA 1YCHA 3P2EA 1PFVA 4TXNA 2OWDA 4U7TB 3Q8KA 2YH2A 3IIJA 3D6JA 4M99A 1XVTA 3H1PA 5DHRA 1FF9A 2QVGA 1UBMS 3ZHCA 1E58A 1HUQA 1IWBB 1V43A 3GJ7A 3HJHA 3QNMA 3UMFA 4DDVA 4JV5B 2JKVA 1QX4A 3QELA 5ITZB 3NIGB 2YJZA 1TZJA 3PNYA 1YOVB 3G0OA 3W0LB 4FGKA 2Q1SA 3G2QA 1DWQA 2BEUB 3DHVA 1WMAA 1C9YA 2A57A 3MS4A 5DFAA 1YA4A 2ZWAA 5BN3A 4M7OA 2AOTA 1X80B 1LY1A 3BTSA 3IB6A 1G5FA 3DVAB 4GE3A 4PQGA 5B2FA 2I87A 3G7UA 5BQFA 1C29B 4RD6A 2QW0X 1FA9A 1QG4A 3PDIB 5EERA 3UQYS 1G8FA 3LOUA 4HZUA 2F64A 1S1MA 2VUHB 3IX7A 3DDNA 4OI2A 2D74A 3W6OA 1ZG3A 2R2GA 1MPTA 2W9XA 4QO7A 4R2KA 1AKMA 4BKOA 1CY4A 2VZ9A 2PT6A 4MVJP 5TGDA 3QNUA 1ZSNA 2IU4A 3AI2A 1MAVA 5CH8A 3V1KA 4CETA 4HDAA 4E03A 1CV2A 2PKQO 2Q45A 2OC4A 4E4YA 4DTCA 4LWOA 2M6LA 1TRHA 2A92A 2PKYX 3Q9UA 1FP4A 3D2LA 1T9ZA 4GPTA 3R5KA 4PRZA 1D1SA 5AK5A 4E15A 4ZZ2A 2EZUA 1JMVA 3W06A 4DVGA 4O0MA 2X7JA 1YZTA 5AVRA 5EZYA 2FWAA 3UAVA 5FI1B 2OV1A 3ROEA 3ZQJA 4BB0A 3CZMA 5BQ3A 4FYIA 5L40A 2VJQA 4I4TF 2ZJ7A 1H2RS 3BHNA 5FPTA 1EWQA 3DCNA 1DRKA 1Y9JA 4H7IA 4J1SA 4MUBA 3VM6A 3GC6A 4GH5A 1Z8NA 4H0FA 5I7WA 2ZJ4A 4MRNA 1DG3A 5JYEA 1TLLA 2VSFA 3LVRE 3BRSA 3LHDA 3QWIA 1N1EA 4Z0TA 3F90A 2J9RA 4JB0A 2F8LA 2H3EA 4XRGA 5A62A 1QFMA 1ZEJA 1RC1A 1WPRA 3S5JA 1KDPA 5KOJB 5FBZA 3BIXA 1HT3A 3BRWA 3HR8A 1F2TA 5AW6A 3RASA 3A04A 2E4AA 4ZJYA 3BQ9A 4MGKR 2GKGA 3N07A 5H0IA 2RG1A 4FJ1A 5EE9A 1C3XA 1JG6A 2O0MA 5B58C 3KZOA 4UUNA 1PR9A 4DJEC 1XAJA 3RTAA 4GGOA 3TDMA 4INJA 3LHSA 2I4TA 4ENUA 4ML3A 1XQ1A 4KK4A 3SYRA 1H94A 3B6JA 4MSUA 1MQ8B 2RGUA 1P5ZB 1DS6A 1H22A 1O6CA 1DIHA 1WUHS 3NQ41 4G1BA 5EHGA 4ZAFA 1WDLA 2YV3A 1L5GB 1SQ6A 1OB5A 3EXEB 3MWJA 2RHWA 1ZH4A 3IH5A 4QPZA 1MZVA 2GBIA 2JFOA 5EQTA 1JLRA 2TRSB 4RHCA 1RMTA 2WJVA 1XTRA 1IHOA 4BCDA 3TLGA 5FB3A 5G1PA 4GDFA 2Y0PA 4LJ4A 4JBHA 3UM9A 4AW9A 2CXQA 6YASA 2CXNA 4CF5A 1JTEA 1KAGA 2QWXA 4RHUA 4FX5A 2D7CA 4JYBA 2O5CA 2X1VA 2V45A 4MX8A 1AKEA 1HE3A 2ONJA 3P1JA 3RTCA 4C6SA 4JP5A 4ZP1A 2B5OA 3OMLA 4ODIA 3SE7A 1XDUA 5MHTA 2W6IA 3Q5EA 3OOWA 4O25A 2NTVA 1CQJA 1TCUA 3WLAA 3HB7A 4DBLC 2YFYA 2CJWB 1U4OA 3FVTA 1XZIA 1NC3A 3GFOA 4FIDA 3UWDA 4G2TA 3KQUA 1A1VA 2HJWA 1NSTA 4CW7A 5K2OA 1UC4B 1D2GA 3HFRA 2GILA 2BDEA 5HYVA 1HE8B 4RF3A 5F76A 3JR3A 3GW8A 3AHJA 1M8PA 1GZSA 4E6PA 1YGYA 4QUHA 3KQVA 3G2NA 3T1YB 3Q72A 5KYUA 2PKQP 5K2MA 2ZTLA 4NHOA 3B5EA 2PMFA 3K09C 4DMMA 1QLHA 1SZDA 2EKBA 2XZOA 3BL5A 3RH0A 3LFUA 4EJSA 3F5SA 3EIFA 5F98A 1I7PA 4D3YA 1NTOA 3C5HA 2H9IA 1RWKA 2O14A 2JASA 3RS3A 1TJ4A 2H1VA 2I3BA 4ZOLF 2AE1A 2ZXEA 4FUTA 1T5TA 3TZKA 4FVTA 2FPKA 4ZO4A 3K1YA 4B6SA 2C78A 3SE0A 4FPXA 1PSDA 1EVEA 1A7JA 2AG6A 3CEAA 3EIXA 4HDSB 2CVHA 4RGBA 4J7CA 1K7XB 1S02A 2OGTA 1QONA 1G2OA 1AZWA 4YWJA 4CHTA 4R3WA 2KBEA 3PGKA 2ENWA 4MV0A 3GGSA 4KO8A 1S2MA 4CM1A 1WX1A 2I76A 3FPHA 3H3XA 3IHKA 3DB1A 1ABFA 5KSPA 2HBYA 2Y3IA 5BSKA 1BDJA 2IUFA 2ZRIA 1CUYA 3MD0A 3PCTA 4KU4A 3F74A 5AK0A 1PGPA 3NYRA 4EG8A 4HDOB 1LVGA 1MRZA 3DOEA 5KOHA 3KJXA 4NG5A 1KS2A 2GYUA 4U3JB 4X6UA 4YPOA 5JH7B 3R0JA 2I1WA 3C41J 2AB0A 5A4IS 2FW6A 2R1VA 3M70A 1ZN9A 3MTGA 4YAGA 1DQNA 3ZXXA 1A9YA 3FNGA 4HD8A 3HN2A 2NZWA 4NTZA 4YJ2B 1MB2A 5IS2A 2G5TA 1REQA 1NE7A 1XEXA 1G2IA 4OIFA 1N5DA 4KQEA 3DTNA 1NIPA 4YV1A 3BWEA 3EOBI 1PWEA 1Y1KE 3A1FA 4U2BA 1TT5B 2R751 4FJ0A 4MMXB 4XD2A 3VR0A 1RKUA 1I3MA 5EWLB 4MLCA 2OXRA 4HDKA 1GPMA 1M5UA 3PC4A 3B5IA 1G18A 2ZDGA 1WAMA 3PHGA 5CFRA 5DIFA 2QXUA 3UMSA 3JQ9A 3QXCA 1HNZB 4FMPA 1N1MA 2Q1UA 5AVSA 1WNFA 4YJHB 4DT1A 5ICEA 2NUAB 4ER0A 3FNHA 3MTAA 3L7CA 2MR6A 1H2FA 2P6NA 1MOZA 1JNXX 3BJZA 3DOUA 1R5OA 2WT8A 3OEYA 2YXPX 1ZINA 4QU8A 4HNTA 1QHSA 1IVSA 4DQKA 1P0FA 2QP4A 4Y2YA 2I34A 1Q74A 3GMTA 2XD4A 2CLFB 2ZWOA 3WDMA 4E21A 1WDWB 3TJMA 2XUJA 4Q39A 2DR2A 2B7CA 1TKAA 4OB7A 4CR6A 2PKEA 2AT1A 3MWLA 4O4LF 3OPYB 3ZVRA 3DEZA 5BUZA 3DC7A 4IDHA 1AMUA 1JDPA 2DTXA 2ZTUA 4IS2A 4Q19A 1P1HA 3N39C 3DAGA 3SDBA 3USZA 4BB9A 4XEUA 1WLSA 2X0RA 4MKRA 1C0EA 2H7YA 4I14A 5K0EA 1P1IA 1EJ2A 2E4WA 4KPUA 4ZIRB 4RSHA 4FNOA 2OUKA 2BR5A 2AWOA 5GVRA 5JG7A 1CZLA 4WXRA 1SCBA 3VU0A 4DQUA 3KQTA 4UAUA 5EWJA 1YQEA 3S2YA 2W6CX 3M6FA 2F67A 4F3KA 2W0SA 1R50A 2VWHA 2X0EA 3DLPX 1CC1S 3AC0A 5LXTB 1XWFA 1Q84A 2JD0A 4RGVA 3LSTA 4BNMA 1KMCA 3JQBA 4XWAA 1GL9B 2PL1A 4Z7NB 3PEVA 1NNUA 1O96A 3W5IA 1GG9A 3GLGA 4KLZA 3S0JA 1KU0A 3BGOS 3P5SA 4JYCA 4RJ2A 4BU1A 1SHUX 4JUFA 4C9BA 1YCFA 3RREA 4DR7B 2W4MA 1DKPA 4K9PA 2XA9A 5LBIA 3J81k 3S2SA 2WV9A 1F0NA 1ORVA 1E4OA 1P60A 1EE1A 1S8AA 1Y5IA 5EESA 3GUHA 3I72A 5TQ0B 1ZLYA 2YZNA 3N1UA 2CXSA 3KYDB 2UYYA 4N01A 3OIDA 1SOAA 5CD1A 1JKXA 4XDZA 1YRYE 1R10A 2OAGA