4AJOA

Rat ldha in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol-6yl) amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
330
structure length
330
Chain Sequence
ALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 116
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajoA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajoA02
4GX2A 3T4XA 1PGOA 5I8WA 4BKOA 1GUYA 4YT5A 3QWIA 4N18A 1P1RA 9LDBA 4Q9NA 2YHIB 4QXMA 1X13A 2GD1O 2EW2A 3JYPA 4J90A 4LMPA 1I2CA 5JO0A 1E7WA 3K2EA 4RGBA 1XIVA 1IE3A 3BTVA 4D3DA 1X1TA 4S3MA 4R1SA 5TGDA 5TQVA 3E18A 1GPJA 4BGEA 1VM6A 2WJPA 3CE6A 4WASA 4ZQHA 4CL3A 3A9WA 1W8DA 3KUXA 3NYWA 1H0KA 3CH6A 3IKTA 3GNQA 5K0ZA 3K2BA 3V1YA 2I76A 1DRWA 5KKAA 3ENNA 3GA0A 4Z9YA 4EI2A 1A5ZA 2CY0A 4OKIA 1A27A 1YJ8A 1LC3A 2P9CA 4CLHA 3PQFA 4PG5A 5TSDA 2DTXA 2ZYAA 2EF1A 5TIIA 2P91A 5T8KA 3M1LA 4YBZA 2VZ8A 4D0RA 1Q1NA 2LDBA 1OAAA 1QV6A 1YO6A 3DTTA 3I9NA 4AJEA 3TZ6A 3AK4A 1LDEA 2OXIA 5L45A 4XGKA 3O4RA 4H16A 3Q1LA 1A7AA 2O3RA 1G6KA 4F45A 4G65A 4CM4A 2OOSA 5IZCA 2O2YA 3X2FA 2EGGA 5IXSA 4D3SA 4RLHA 4E2XA 4W7HA 3GGOA 3I9LA 4A0SA 4KWIA 2ZTLA 2Y66A 5IF3A 1KVSA 3BTUA 1B26A 3OM9A 4GKBA 2EXXA 1PTJA 4U6QA 2ZB8A 5CHEA 2OHXA 3I83A 3DHEA 4OH1A 4ZRMA 1Q0HA 4CLDA 4OSOA 4XA8A 3WIEA 4CR6A 4N5LA 1YWGO 2DVMA 2EP5A 3HHPA 3DOCA 4MVJA 3T7CA 5HWSA 3QSGA 1PWZA 3WTCA 3OQ6A 2G76A 3JQ8B 2RHRA 1N9GB 1EMDA 1TT5B 1ZMOA 2PGDA 5CEEA 4E5KA 1VL6A 1DFGA 1Z7BA 3DMTA 3E03A 4HADA 4WCFA 1E0DA 3RKUA 3ZDFA 2YDYA 1HYEA 1PZGA 3ONEA 3O9ZA 4YJGB 3JD1A 4BOYA 4J0EA 3VPXA 2O7SA 1LQTA 1V6AA 1Q0QA 2TMDA 5EJ2A 1GV0A 3LC1O 1YBMA 2ZK7A 4FOOA 4P4LA 3MTGA 2Q3EA 3G17A 1HE2A 3DMYA 1YKFA 4FJ0A 3WFIA 5KJCA 3NT5A 2X9GA 4CQLA 3WGHA 1XWFA 3ITKA 1UDCA 1JWAB 2NTVA 3AY6A 4HKTA 2GO1A 3FNHA 3FRJA 4OM8A 2YHUA 5U4QA 3GG9A 1WZIA 3CZRA 4LK3A 3K5PA 2GF2A 3I9JA 5COQA 4BO7A 2BH9A 1E7YA 4WOJA 1ZZEA 4CQMA 1E6EA 3LDHA 1V0JA 4ZRNA 4M87A 2OZPA 3FPCA 3A1NA 4P4NA 4XIJA 1DO8A 3V2HA 1ML3A 2YV3A 2DLDA 4GWKA 2A35A 1BWSA 4A5OA 1JU9A 3AI1A 5G0UA 1UAYA 3VTZA 1BDBA 1WPQA 3UH1A 1NR7A 3RFTA 5TNXA 1KVQA 3ZI0A 2QRLA 1DBVO 3PZBA 4RORA 1A9ZA 3RJ5A 4BO0A 1U8FO 2NU6A 3LU1A 1XA0A 2J3KA 2Z5LA 2P2SA 4I5DA 4U6SA 8LDHA 3DZGA 1HDYA 4YCAA 5KNLA 4NPCA 1Y8QB 3LSYA 2EWMA 2P4HX 1V3VA 3H9UA 1PS0A 4GX0A 1GEGA 3FHLA 1JTVA 4YRDA 4CMBA 2C07A 1J5PA 3ABIA 1SMKA 1UP6A 4FGSA 4YEDA 3AM5A 3W4KA 1J0XO 1PQWA 1DIAA 3HDJA 5B4UA 2E49A 5EESA 4W9NC 3UKOA 4PLWA 4RF4A 4X54A 2TMGA 1GAEO 1LSUA 2IDZA 1NR1A 2O23A 4ND5A 5JAMA 4JBIA 3INRA 3S2GA 3BMNB 3JQ6A 1T2DA 1QORA 2ZCVA 3WXBA 2O3SA 4CLRA 1GTMA 2GGSA 3OECA 4ONEA 2E4AA 4CMIA 5I8ZA 3L77A 3PWKA 5JMPA 3HUDA 5LC1A 5COBA 3DHYA 4EUFA 2RBEA 4JROA 3OP4A 3KO8A 4RF2A 2NACA 4PLYA 4XEHA 3TSCA 5BSEA 3A14A 4D7AA 4AJ4A 2PZMA 2DQ4A 2Q45A 3OMLA 4AVYA 1PR9A 4MP3A 5BSGA 4H7PA 4BIIA 4C7JA 4KQWA 3R3JA 4EJ6A 1K89A 5A3JA 3FBGA 4FCCA 1EDOA 4KQXA 5IG2A 2ZYGA 4PG8A 1DSSG 2WTBA 1YH3A 4PLZA 4ZGWA 4XQGA 3VH3A 3KYDB 3ZWOA 4TRRA 4IJKA 5F5LA 1Y6JA 1GFSA 5ITWA 3WG9A 3KEQA 3TN7A 1BG6A 2ZTVA 1KETA 1PX0A 2G5CA 3LLSA 1WNTA 1KEWA 1CIVA 3JYQA 4A73A 4CV0A 4BNWA 4G2NA 3SBOA 3NGXA 3IC5A 2BKAA 1MGOA 4NK4A 4Z0PA 4DRYA 3H9GA 1DB3A 4CLOA 2IODA 1LDMA 1RPNA 4CR8A 4JIGA 4HP8A 3ZWNA 3U0BA 1Y9EA 4E31A 4K6CA 3TNLA 4WOKA 2VHWA 3DZHA 3I6QA 4LCJA 2VWPA 3JQ9C 2VZ9A 5HM8A 2AQIA 1RYDA 4FS3A 1I2BA 1DIGA 3ZHBA 4LVUA 3WB9A 1TVEA 2B5VA 2P4QA 2Y1CA 3L9WA 3ROMA 2PKRA 3VZRA 4XYMA 5A3VA 4CMKA 2FSSA 1EE9A 3DAGA 2B0JA 1HF3A 4BGIA 3GRKA 1WVGA 4BV9A 1GEEA 2DUUA 1T1RA 2ZKLA 3KZVA 3JQGA 1UZMA 3SEFA 1EVJA 3IJRA 1U5CA 3ETEA 2NVUB 3UGKA 4WLUA 1I3MA 1RWBA 2JHFA 3ICPA 4R54A 3ADOA 3BMCA 2BGKA 4XGIA 4FPXA 3GN2A 3OIDA 1PJ4A 2VN8A 2CSUA 1U2DA 3DTYA 4B4VA 3RFXA 1U3UA 2B37A 3IJPA 3LT1A 3LC2O 2CDBA 1ZXLA 1T4DA 4CV2A 3FBTA 1JLLA 3ZV3A 1E77A 2YJZA 5DP2A 4AJHA 3HE3A 4UVGA 4EW6A 2X0RA 1U4OA 1NPYA 4Z6KA 4R5MA 3V8BA 1NXQA 1ADBA 4BNUA 3BYZA 3D5TA 1XR3A 3JQBC 4AJ1A 5C7LO 3PYXA 4E21A 4WGGA 1LRLA 3EYWA 3IDSA 3MJEA 2YV1A 3B1JA 4PVCA 1YOVB 5KJEA 4DC0A 4E5MA 4UEKA 1KC1A 1PJQA 1UXJA 5A03A 5ADHA 3GC6A 5C3MA 3M2PA 3C7AA 4J3FA 5FI3A 2EKQA 3WBFA 4P4GA 3QVTA 1OC4A 1DRUA 3K92A 3PZRA 4IIVA 4UUPA 4YPOA 3DBVO 3TWOA 3KSZO 3EGOA 4PRLA 3S2EA 4DTIA 4ND1A 4GSKA 3ITDA 3BTSA 2HJSA 2VOJA 2VHZA 2ZB7A 4OKNA 3JQFC 3GRPA 1WDKA 4GMFA 2B4TO 3DBHA 4TVBA 1BTOA 5CAEA 4BNJA 1U1IA 4J1TA 3U09A 1ZEMA 1LRJA 5G4KA 1ZK4A 2FSVA 2WYVA 4NJMB 5AXAA 1PL7A 2QRKA 1OZAA 4OIMA 5EQDA 4BNMA 5A9SA 1QYVA 3WMWA 1CETA 2Y1FA 3PJEA 2D0IA 4BUCA 3CIFA 4NFHA 1VKOA 1KS9A 2E48A 3GVHA 3LF2A 2DC1A 1WW8A 3QP9A 4WNCA 3NJ8A 1K6JA 1NHWA 1PJSA 5DULA 3S8MA 5CFZA 3IUSA 2CD9A 3O8QA 3K31A 1DC5A 5L7WA 4OHUA 3D7LA 3WWYA 1HWYA 4IUYA 2EKPA 1SZJG 3VPFA 1K3TA 1LA2A 1Q7CA 1E6WA 4LGVA 1EFKA 1TA4A 2DPHA 3BA1A 2CVOA 4RDHA 4IGEA 3V5NA 3EZYA 3D3WA 5A06A 3AOEA 1EQ2A 3PHJA 1Y7TA 2BFOA 2C54A 5DT9A 3WLEA 4TKMA 1EVZA 1I8TA 2AE1A 1PQUA 2P5UA 2FR1A 3E6AA 4O6VA 4ZQBA 1GR0A 3GDGA 4II3A 5EN4A 5KIAA 2D4AA 1CF2O 3VKVA 5COAA 1L7EA 2GCGA 5JO9A 2CDCA 4KWHA 2FMUA 3IKVA 2NQTA 2ZIZA 1I5RA 2ZJ1A 2J5RA 4ALLA 4NU6A 1Z82A 5BR7A 2X1HA 4L9RA 1HRDA 2SCUA 3GUCA 1DJNA 2PR2A 3VPSA 3NEPX 4MVJP 3G79A 3RD5A 4Y9DA 1Z45A 1F06A 2HLPA 3RUEA 3DC2A 3R6DA 1GV1A 1CWUA 4BO8A 1Z6ZA 3T7EA 1WWKA 1LJ8A 1SEVA 4FC7A 4YXFA 4ALJA 3UAGA 1J49A 3QY9A 2HO5A 2B4QA 3LQFA 3VDQA 1PJBA 4CV3A 1JQBA 3D5QA 4XIYA 2F00A 5C7OO 5T5QA 1ENZA 2GR9A 3ZW8A 4A03A 2RAFA 2AEJA 2WE8A 3U49A 3N7UA 5F21A 1GYRA 1E1NA 4JGBA 2X4GA 4I8XA 4DWVA 4LMRA 5GY7A 1PL6A 2V7PA 5EERA 5IDXA 3N74A 2AEMA 3OJLA 5KVQA 2I9PA 4R3WA 3PFFA 1BXGA 4IXTA 1E3JA 4HNHA 5IDWA 3W6UA 2AEFA 3CMMA 1UP4A 1UH5A 4B4WA 4YT2A 2Y68A 2VWHA 2H5LA 3HWRA 5GZ1A 4L73A 3W4IA 2UAGA 4GKVA 5ENVA 3VC7A 2J3HA 4FQ8A 3CSDA 3UVEA 4RF3A 4YT8A 3H2ZA 1DEHA 4PGFA 3FPLA 4P8RA 2DBRA 1UXGA 3GVCA 3KOUA 2G1UA 4EUEA 1EVIA 4IINA 5L9AA 3ZU4A 1JKJA 1PSDA 2W2KA 1K0UA 2GYYA 3MEQA 3EVNA 5JCJA 3G0OA 3QVWA 5IDQA 2JKVA 3QJ5A 2PV7A 1BGVA 5JY6A 2BGLA 1QKIA 1WMAA 2EGHA 2QYSA 2Q1SA 4LRSB 1C0KA 1XELA 1U4SA 2Q1TA 3TFOA 1X15A 2XF8A 3PLNA 3B70A 2ZQYA 2ZATA 4WLNA 1LXCA 2C2XA 5I9NA 4ID9A 3MZ0A 4DXHA 4IDGA 1L1FA 3I4CA 4IM7A 2R00A 5TX7A 4I08A 3S2IA 5A05A 4IMRA 3JQGB 4XYBA 3WS7A 5EPOA 3GK3A 1YB5A 4J2OA 4I5EA 4BVAA 1JKIA 3PVZA 1XLTA 3PHLA 2EJWA 5JAQA 4DLLA 5L4NA 4BMNA 3VHRA 3NRCA 2Q2QA 4UVHA 4OGWA 3FNGA 1ZSVA 1NBOA 1TEHA 3WR5A 3RI3A 5KJ6A 3KLMX 4YACA 2EP7A 2C5EA 3PK0A 1ISMA 2NU7A 5HS4A 1QG6A 3SC6A 4IQ0A 1HYGA 2H1SA 4MOWA 2VWGA 4J2HA 1YL5A 2HMSA 3WJAA 1C0LA 3Q0EA 1NQTA 4GVLA 4HNGA 2W2LA 4WK6A 1UUFA 1PGPA 1T2EA 1GYPA 2UYYA 3GT0A 3RUDA 3SX2A 1FDVA 1R16A 4DIOA 5B1YA 4J7XA 1QLJA 1JAXA 1XQ1A 3H6KA 1YL6A 3ZNOA 1E3SA 1H2HA 2B36A 2C2YA 4AG3A 3IAHA 1LDYA 1XYGA 1NX6A 1HLDA 4GAEA 3K30A 4YVFA 2EV9A 1EZ4A 2CF6A 1SEPA 3VH1A 3CEAA 3DFZA 3LK7A 5IN4A 3G1UA 4PVDA 1JDJA 3VDRA 1G1AA 2C82A 2B83A 1BVUA 1GZ3A 4NBVA 1FXSA 3JD4A 5TLSA 3ZNNA 4QEDA 2FN7A 3DAPA 4XYEA 4E4YA 4LCEA 2QRJA 3KYBA 4EZBA 2B5WA 4JJIA 2WYUA 1JA9A 2DKNA 4NQZA 2DM6A 4XB1A 3GUYA 4XQ9A 1MB4A 4CV1A 1BXZA 3PP8A 3WFJA 5A9SB 5DP1A 2ZB4A 4XR4A 5G0VA 1H6CA 4EITA 3QW2A 1YE3A 4P22A 1P9LA 1PJ3A 4NFYA 3RUFA 3GR6A 2PKQO 1PGNA 4E2WA 3O38A 1LNQA 5F1KA 1D4FA 3D4PA 3WGOA 4RPKA 3NUGA 2X58A 4WECA 4L8VA 2BFAA 3LVFO 4PLGA 4R41A 3O8QB 2EHDA 1RM3A 4XKJA 3NTQA 4LSWA 1BW9A 2O3JA 4NU5A 2YUTA 3BHIA 3HZZA 4MVJG 2NQ8A 4GH5A 4G5HA 4ALMA 3HQ4O 1PWXA 2G82A 3PLRA 1EFLA 4HX5A 3F4LA 3GEDA 1C1XA 1FJHA 3WIDA 2X0JA 3OQBA 3TDKA 1F12A 3WLFA 5C5IA 4BNYA 1NQ5A 2CFCA 4KUGA 3U4DA 4P38A 2WD8A 4CJXA 4BNZA 4CMEA 5T67A 4AICA 3QLJA 4Y8VA 2PA3A 3HDYA 4XCVA 1DIHA 4WEQA 3L07A 4GGPA 3DO5A 3F9IA 3ZWXA 1Y81A 4F6CA 5JDCA 4XB2A 4BNNA 4DC1A 4RCVA 4EYEA 3GN1A 1E3LA 2QQ5A 1WP4A 4BO5A 4N7RA 3DWFA 3EUWA 4R9RA 2XOXA 5A5FA 2Y93A 3JQDA 1EK5A 4DYVA 4Q3DA 1F14A 4Z9XA 4ALIA 3KSUA 5KTKA 1KEPA 4QECA 1SC6A 5L4LA 2DBQA 5ES3A 2IEBA 4ZVVA 4ZQEA 4ZICA 2JD2A 3H9QA 5F1PA 2XXBA 3HB5X 1GD1O 3ZU3A 2GN9A 4QFDA 3P19A 1I3LA 2HJRA 4KP7A 4YB8A 5A04A 4PLCA 3TZKA 4FD3A 3GDFA 3FCOA 3PJDA 4C7KA 3TF5A 2I3GA 1EUZA 2PNFA 1HSOA 3H9JA 3OJOA 2HRZA 4MVJD 4RPGA 2NUAA 1FK8A 1I33A 4PCVA 4RVFA 4YQYA 1O89A 1YB4A 2Q49A 3WYBA 2WD7A 1C14A 5AQ1A 2AG5A 1GDHA 4I5FA 1E7RA 3ZU5A 4DBZA 5CDTA 4FOSA 4RPLA 4N5NA 4Q3CA 3I1JA 5HRUA 2I66A 1YQXA 1R4NA 1C0PA 1C3VA 3GVIA 1E5QA 5A5EA 2UUOA 4QO8A 1KVUA 2ZTMA 1ZJYA 4A27A 3QA9A 5EQFA 5JNLA 1UAGA 1YXMA 2BMAA 5JDIC 3H3FA 5DCWA 1ZIDA 4OQYA 1XU9A 1PJTA 3DHNA 2AMFA 4TVOA 3C3XA 3GDOA 5BSFA 4HFJA 1BRMA 1DLIA 2X9VA 3UW3A 1LLCA 1P31A 2E82A 3P2YA 1HT0A 2CVQA 2ZJ0A 4YAJA 3ROPA 1ZUD1 2BI7A 2VNAA 2EW8A 1NAIA 4WKGA 2HAEA 4EJ0A 4PFJA 1SAYA 5A9TA 4QFCA 3RIHA 3G1TA 5CPBA 1W73A 5DF1A 1HDCA 4DVJA 2Y0EA 1ZK2A 3PRJA 4BQPA 3WWZA 1HTBA 3ANLA 4M89A 2QIOA 3OA2A 2HK8A 1ZK0A 1BSVA 2NM0A 4BGVA 4DLBA 1HL3A 1PIWA 3AFMA 1T26A 2JCXA 4L4XA 4DMLA 4RVDA 4Q3AA 3LF1A 2YY7A 1KOLA 5ILOA 1A9YA 2Q4EA 3LZ6A 3WICA 3K96A 4GQAA 1PEDA 4BB6A 4OO3A 3OEWA 3L9XA 2ET6A 5KKCA 5JAIA 3HDQA 2Y1EA 4TZKA 2VRCA 1E3WA 3L4BC 2AHRA 1EBUA 1AUPA 5JBIA 1OOEA 3DL2A 3RAJA 3WJ7A 2AXQA 4I5GA 3SVTA 4URFA 4QQRA 2H63A 3NKLA 4QO7A 4IJVA 4D46A 1GL3A 3P2OA 3EY4A 1E7MA 2DFVA 2Q1WA 3KV3O 1VRWA 4R3NA 1XHLA 3E5RA 4GX5A 1QYXA 1R4MA 3P5SA 4WE3A 1B16A 4R9SA 3RROA 1ZEJA 2JD0A 2H9IA 4R69A 3ZV6A 4M8SA 3ZGYA 5TJ9A 1NQOA 5CG1A 2HU2A 4XYGA 5JSFA 4MVJI 1KERA 1XEAA 4LSMA 1RM0A 2FOIA 1PQPA 2YW9A 4BKQA 4EBFA 3IS3A 1GU7A 1U9JA 1NFRA 3IP1A 2X5JO 1YB1A 4CUKA 1LC0A 3WGZA 4EUHA 4G81A 4W7IA 2RCYA 1E3EA 4GWGA 3ZZNA 3ZW9A 4ZQGA 3B6ZA 3INGA 8ADHA 3GF4A 1Y1PA 4K1LA 2WMDA 3SLKA 5CG2A 1P1FA 2B4RO 2FPPA 3NJ4A 5DOVA 1T2FA 3E82A 3KVOA 3MTJA 1Q2XA 2DPGA 5AXBA 1R12A 3ETDA 1B15A 3G49A 3GHYA 1DHRA 1DHTA 4O0LA 5G4LA 2X5OA 1O6ZA 4RQUA 3SC4A 3S2FA 2D59A 3AUAA 4DIBA 2DFDA 4S1VA 3WQSB 4WLEA 4XWYA 3VVBA 3TZQA 3WMXA 3DFUA 1Y8RA 4R1TA 4FIZA 3BHJA 4WLVA 4CL8A 3JYOA 4XGNA 4E30A 2EEZA 1UR5A 4I9HA 5FFFA 4HFMA 1LDBA 1XQ6A 4F6LA 2ZCUA 3PHIA 1O95A 1C0IA 3PQEA 5BNFA 2QZZA 4HFRA 1XU7A 2Q46A 2F1KA 3VVCA 3R1IA 1PR3A 3WNVA 1P1IA 4QT0A 3K6JA 4E12A 3NDJA 2IRWA 3A28A 3PPIA 3X2EA 1I0ZA 2VQ3A 3ON5A 5CDUA 4WCDA 4NFSA 4ALKA 3JQEA 1A4UA 2BD0A 4J7CA 4BQRA 2CDAA 3JV7A 4AJ2A 2GN4A 4IDBA 1S6YA 4OSPA 3BTOA 4FJ1A 4BGUA 1YGYA 3H5AA 1LQUA 2B69A 3AUSA 4J7UA 3AM4A 4MIOA 3H9EO 2GASA 1NAHA 4IPTA 3RUCA 1V3UA 1N7GA 4Y6RA 1BW9B 1E1MA 4RPHA 5J23A 3F1KA 5T57A 2HKIA 4ZU3A 2J3IA 5L7YA 3TZCA 4IIUA 4IJUA 1HLPA 4NBWA 1SPXA 2XXJA 2JFGA 1V3TA 2FHSA 3WQQA 2C29D 3E8XA 3CINA 4MP6A 3BMQA 4PZEA 4DPKA 5FF9A 1V35A 2VHXA 4Y6PA 4OAQA 3EC7A 4H15A 2AE2A 3AM3A 5THKA 1ZXBA 2C0CA 1BDMA 3TZHA 3H5RA 4B7UA 2CZCA 2A9FA 1ENYA 4IJWA 3KB6A 4NBUA 4XJTA 4W9NA 3IMFA 2A4KA 1DAOA 3K9QO 4PLPA 5F1OA 3A06A 3WYCA 1CJCA 1K2WA 4DPLA 4FR5A 1GADO 1ADFA 1E1LA 2C5AA 4UREA 4W99A 3D1LA 1B8UA 1RKXA 2V65A 3IP3A 1ISHA 2X0NA 4IDEA 2VHYA 1MUUA 1ORRA 5TT1A 3E1KA 4CM4B 1JVSA 4IGFA 5JC8A 1YBAA 2R6JA 3C1TA 2RH4A 1CYDA 1H6BA 4TWRA 5I7SA 3EZLA 5THQA 5DDIP 3E9MA 4LISA 1F8GA 4OJNA 4FFPA 3OSUA 1AXGA 2JL1A 1O9BA 4F3YA 1NVMB 4RL6A 1XDWA 3JQAA 1E5LA 2ZB3A 2WD7B 3LT0A 3DBLA 3NTOA 4J6FA 4WLOA 2DTEA 4CLXA 2Y1DA 4E2YA 4IQ8A 5A9RA 1PGQA 3ROKA 4XX0A 2YZ7A 3I9KA 3D3EA 1VE9A 2WSBA 4OXYA 1QYCA 2PY6A 3TJRA 3LT2A 3U4CA 3COSA 1UZNA 4WCFB 1HE4A 1ZH8A 3AUTA 4U8GA 1NWCA 3GG2A 3GLQA 4GBJA 2Q50A 4PZCA 3V2GA 3VZSA 5L95A 2GNAA 2PD4A 4CM3A 4NNJA 3WBBA 4TSKA 4NHEA 4CQLB 1P33A 3KYCA 5BNIA 1M76A 4IZIA 2HK7A 3LC7O 3RVDA 5FWNA 2PZJA 3MWEB 4YJFA 2WE7A 1CDOA 3GFGA 3CTMA 3RC1A 3JQ9A 5JCXA 5TF4A 5DBFA 4CQMB 4E5YA 3F47A 3JYNA 2O3UA 3QWFA 1Q7GA 5EMHA 3ZWAA 3ZWCA 2JAHA 4GSLA 3RC7A 3OETA 2X22A 3GGGA 1N1EA 4WPGA 2QHXA 4CM9A 1GUFA 4GGOA 3RQSA 4D44A 4JCOA 4HV4A 2LDXA 3RBVA 3ZWPA 1MFZA 1VJTA 3KM0A 3OIFA 4UVDA 3ADPA 4R68A 5L3ZA 4YYZA 4J4TA 5K6AC 1T1SA 1ZCJA 4FSHA 1V9LA 4UVIA 1U5AA 4MKXA 1NASA 2VYNA 4J1SA 2AQHA 4R51A 2BRUA 3W6ZA 4J43A 1MFPA 3ORFA 3FF4A 1VKNA 1W0CA 4YQZA 1EBFA 2GDZA 4Z3KA 3EAGA 3BZUA 3ONDA 1KYQA 5BT9A 2YHIA 2Q1UA 2JAPA 5I9MA 3A4VA 3PIIA 1IHXA 5CDGA 1DOHA 2J3JA 5DOZA 1R4MB 1SOWA 3RKRA 1EQUA 1QRRA 2PH5A 3MCVA 2FZEA 4N5MA 4DQXA 5JE8A 4FW8A 4MO2A 3EDMA 1LRKA 3LT4A 1XCBA 3UN1A 1PS8A 4O63O 2HMVA 1OBFO 4CMAA 3EHEA 3HDHA 3QIVA 4J9VA 2I65A 2PD6A 3V2UA 3PYMA 3JQBA 4IS3A 1JKFA 4R1NA 3JQ7A 4JN6B 4YJDA 2JFFA 4CPDA 5KCZA 4CLRB 3QVSA 5DCUA 4QTZA 4FC6A 2DU8A 5HA5A 4K28A 1OFGA 1EE2A 4OMUA 2PGLA 4LVCA 4B3JA 4CMIB 2V6GA 2VYVA 5LCXA 3T4EA 2V6MA 1LSSA 1GQQA 3OA0A 3F5SA 3MJTA 3DXFA 2GZ2A 1P74A 4JXKA 3RU9A 2AW5A 4HUJA 1JAYA 4AJPA 3OBBA 4KDFA 3SJ7A 4B7XA 1P45A 3GFBA 4EDFA 1MG0A 3EMKA 3JQFA 2HMUA 1IY8A 3JSAA 3MJ4A 1AXEA 1LUAA 1B14A 3H7AA 1BVRA 3IL2A 4L74A 3WX0A 3B20A 1LLDA 2QX7A 2VTEA 3JTMA 1YQDA 4XRRA 2EG9A 5A02A 5DBGA 4XJSA 2J5KA 2X5KO 3L6OO 1ZSYA 3DDNA 3VH4A 2X0IA 3TQHA 2Y0CA 3M6IA 4CLOB 4DYDA 3PWZA 1O94A 1X7DA 2PK3A 4NMHA 2G0TA 1G0NA 3AFNA 4MJLA 3JQ8A 4TZTA 1N9GA 4Y98A 5JAZA 1J6UA 2I5PO 3V1UA 3FWZA 3FTPA 1J4AA 3L0DA 3CPSA 4BMSA 4YJGA 1ZK1A 1O8CA 1MC5A 4ZN6A 1XSEA 1I36A 5TJHA 4J9UE 1KBZA 2BFMA 4R01A 1MC4A 4OQZA 2Z95A 3IOYA 3AOGA 1B7GO 3QWAA 4E2ZA 4UAGA 3WDSA 5JC1A 4H3VA 4UEOA 4MVJH 3H65A 2X7HA 1P77A 3Q9NA 3UFXA 4M49A 4RPJA 3JD3A 3UCFA 2OMEA 2UDPA 1AN9A 1HZZA 3HFSA 4CM5A 4RVUA 1P1KA 1PL8A 4XZ3A 2I67A 2X23A 2NNLD 2POQX 4BNKA 4JQCA 3AW9A 3BMCB 2AG8A 1P44A 2BHLA 1IL0A 2W2LD 4J1NA 1KEUA 2NLOA 4PRKA 3I52A 3VTFA 4AJJA 2OL4A 4MDHA 1MLDA 1WXDA 2VCYA 2Y0DA 4IDAA 4A26A 1GCOA 2VZ0A 4CMJA 1UXHA 4HFNA 1DIBA 3JD2A 1M75A 1YL7A 3OJFA 2VUSA 1Y8QA 1YRLA 1ARZA 4JP3A 3NT2A 4RF5A 2NVBA 1MA0A 2QYTA 4RJTA 2FR8A 2JCYA 3EW7A 4NJOA 4YR9A 1ID1A 1ZMTA 2IYOA 4J4HA 1P1JA 4DBVO 4J0FA 4DQVA 5U9CA 3NX4A 2Z1MA 2OP1A 3JQAB 5AYVA 1HSZA 5I7VA 5ITVA 2VT3A 2D8AA 2D5AA 1HE3A 5T8KC 4TRNA 1VPDA 1X0XA 2BELA 4YRAA 2C7VA 3Q2IA 5CPFA 4EEXA 1B8PA 3QV1A 5F3RA 3ST7A 4RZHA 1PGJA 4Z9FA 3EK2A 1A7KA 3BMNA 4OYRA 4W82A 1LSJA 4BO2A 4XR9A 2VRBA 1HXHA 2O7QA 5IZCC 2NADA 1WLYA 7ADHA 1F8FA 3MWDB 3ETGA 1T2AA 2WEKA 3U4IA 3DBHB 2P5YA 3NAQA 5JPIA 2O50A 1PU2A 1I32A 4R1UA 4BNGA 3ZWBA 3H5NA 4B7CA 3KYCB 3F3SA 5G4KB 2GLXA 2CVZA 2C7GA 4TKLA 1ULSA 1D1TA 3CMCO 3UUWA 3KRTA 4R16A 3UF0A 1H9AA 2X6TA 1Q0LA 2NU9A 4NK5A 4GI2A 4BKUA 1H9BA 3GEMA 1N8KA 2D1YA 1Z74A 2DT5A 4ND3A 4II2A 4MP8A 1FDUA 3DZBA 3DONA 4HWKA 3UCXA 3KYDA 3VOSA 3TOXA 5AOVA 1AHHA 3DMTC 4WCFC 3U5TA 5L4SA 2QZ9A 4CODB 3WGQA 5G2OA 5GMOA 3SJUA 1RJWA 4FN4A 4FJ2A 5JMWA 1GZ4A 3FR7A 5GZ6A 1S7CA 3E5MA 3D3WB 5T6BA 2A92A 3BXXA 5F5NA 5JLAA 2I99A 4AJLA 5JW6A 2DBZA 1CERA 4BB5A 5A1TA 1NFFA 4NBRA 1U7TA 3MJSA 3GVXA 4LRTB 2AQ8A 3W4JA 4A7PA 5JYDA 4YRBA 3HN2A 3C7CB 4ZQFA 4DPMA 1IPEA 4MIYA 1LDNA 4DREA 3KLPX 4R5HA 3PGXA 5L53A 2Y05A 4ND2A 5EL0A 1KY4A 4IZHA 3RJ9A 2PD3A 3F5QA 4EJMA 2NWQA 1U7HA 3TL2A 3JCZA 3FWNA 5JY1A 2PLAA 3ZWWA 2C59A 1U28A 1ZFNA 2EJVA 3WOHA 2PZKA 1I10A 5GZ3A 1I01A 1WZEA 2OBYA 3NDRA 5ICSA 1QMGA 4YAEA 3JQ7B 1ISFA 2WWRA 2J5QA 5G0SA 3ZWVA 5EIOA 2BI8A 4O59O 1DC3A 2NVUA 4B79A 1M67A 4O1MA 5BQFA 3B1KA 3WNQA 4YA6A 1GQ2A 3ASVA 3ZWMA 4ZHSA 2XPCA 2YQ4A 1F0YA 4D0SA 1H2BA 3PQDA 1NPTO 1SO8A 2GUGA 2YFHA 5B37A 5BNTA 1M66A 1Z75A 4UEJA 2OFPA 4PZDA 3CXRA 3INTA 1LLQA 3GPDG 4CUZA 4ALNA 4Q3BA 3I9OA 2GRAA 3Q2KA 1BXGB 1DDOA 1KIFA 2Q4BA 4NR0A 4KDEA 3RU7A 1VSVA 3ZHXA 2ZYDA 1MG5A 4OL9A 1YOVA 4E5NA 3OJ0A 5DZSA 3U3XA 3TL3A 3QQPA 1XKQA 3WTBA 2ZQZA 4D45A 2EIHA 5LDHA 3OJEA 4CQMD 1NNUA 3E9QA 1N1GA 4FBGA 3RUAA 4AJOA 1IZ9A 1TB4A 1UXIA 4YAIA 1HDXA 1FDTA 5DCYA 2W2KB 3AJRA 5IXYA 1TLTA 3C1OA 3Q11A 3CKYA 3V1TC 4RQTA 3K73O 4BO9A 1I3KA 1E92A 1P3DA 1K5HA 4D41A 5JYEA 5KVVA 3HJAA 3RBZA 1CQIA 3F4BA 3GHHA 3HADA 4L4RA 3W8FA 1JN0A 1T24A 1Y5MA 2G17A 3O03A 3I23A 5K9ZA 2GPTA 3PFWO 5DN9A 2GSDA 4DL9A 3Q9UA 4D3FA 1GZ6A 1HE5A 2VRCD 4BL5A 5CDSA 3MOGA 3QVXA 1VC2A 1WDMA 1FF9A 3W1VA 4AL4A 4UUOA 2FWMX 1R37A 3PGJA 3PEFA 3PWSA 2VUTA 1N92A 4NJMA 3PI7A 2D2IA 3AY7A 3PXXA 4WJZA 3ZV4A 4DA9A 4RDIA 1IOLA 2Z1NA 1ADCA 1TXGA 1U3WA 2O4CA 3U4HA 4JBHA 3S1LA 3GZ4A 5HTOA 3DOOA 2VUUA 1NM5A 2HRBA 5KJFA 2HMTA 1R6DA 3U9LA 4BNIA 2X8LA 1VLLA 1Q7BA 3UCEA 4J49A 4YJHA 4ITUA 3DZFA 3AI3A 3EVTA 5L51A 1IZ0A 2ZTUA 4AJNA 1HDOA 5H82A 3F6YA 2OUIA 3OH8A 4GLLA 3CZMA 5H81A 4ZD6A 4BO6A 2BGMA 4DGSA 1ZVMA 3GH3A 3GMSA 3NGLA 1L7DA 4W4TA 3UICA 1ZKMA 2D5CA 3H8VA 4WLFA 1I24A 4B8WA 3C85A 1NYTA 2P9GA 1HETA 3PDJA 4TRJA 4PN3A 4BKRA 3AU9A 3HSKA 4U0KA 4MKZA 1XGKA 4B4UA 3R0IA 5TC4A 2O48X 5KVCA 4E32A 1VSUA 1ONNA 3RWBA 3JQCA 5KJ1A 3KXDA 2W90A 2CNBA 3L6DA 3ENKA 4C4OA 4E3ZA 2E6UX 1D3AA 3D0OA 2HDHA 4IXWA 3LYLA 2AA3A 1NQAO 2RHCA 2J8ZA 3ZNQA 2FZWA 3GNSA 3LLVA 1UXKA 3PHGA 2RH8A 4M1QA 4NH4A 4ND4A 5HS6A 3GAFA 5JS6A 5JXWA 3GNTA 5TRTA 1ONPA 4B4OA 4RO0A 1WMBA 4UVEA 2I3AA 5IN5A 1JVBA 5TT0A 1X14A 3FI9A 5JDIA 4F46A 2OBNA 3UHAA 5T64A 4BNHA 1B3RA 1M2WA 2OORA 3VKUA 1HKUA 3Q6IA 3DR3A 4XD2A 4MKRA 3GEGA 4TRMA 3DZKA 1YDEA 4AJIA 1DPGA 4L4SA 3CUKA 1HDRA 3GPIA 4TQGA 1DLJA 1DAPA 1DC4A 5MDHA 3L6EA 5JFOA 1Y5RA 4K9DA 1BXKA 1HEUA 1ZW1A 3FSRA 3RASA 4GLOA 1VL0A 3TOZA 3VAZA 6ADHA 2O3TA 1R66A 4FB5A 4RVGA 3STHA 4Z0TA 5L7TA 2VTDA 3DAFA 2WM3A 4I9NA 2IEDA 2OGUA 4Q3NA 2O2SA 1ENPA 4PG6A 1N5DA 4K26A 2VOEA 4B3IA 4BNTA 2PKQP 1UDBA 3PYLA 1LLUA 1GPDG 1P0FA 1Z73A 1ZJZA 2Q2WA 4CR7A 4GL4A 5CEFA 3L4BA 4INAA 3K8ZA 1IUKA 4NI5A 1C1XB 4YWJA 5ILGA 4J91A 1ZK3A 2AQKA 1XG5A 2Y1GA 4I9UA 3WSWA 3GQVA 1AE1A 2ILTA 2DBVO 1MV8A 1DFIA 1YVEI 1DRVA 4DQUA 4E6PA 3GZNA 4B3HA 1IYZA 4L76A 5H83A 2NTJA 4U0JA 3IIEA 3JD0A 3OHSX 5IJZA 2YYYA 4NIMA 4PLFA 3UXYA 3KEOA 3GGPA 3ONFA 3NDIA 2VHVA 1QYDA 5BSHA 3TRIA 1NVGA 3GVPA 1A72A 2JFHA 1H94A 3RCBA 4J4BA 3OF2A 2HSDA 1EVYA 2Q99A 3G3EA 3QHAA 3OEYA 3DBRA 1OC2A 2IXAA 3AOEC 3HB4X 1B0AA 3JQAD 4DUPA 1I30A 4Z3DA 2UV8A 3I6IA 3IUPA 4A10A 3ZU2A 2NU8A 4B8ZA 5IFLA 5ENDA 1RYEA 4JLWA 1I3NA 1QLHA 4L0QA 4CM1A 4FFRA 2GZ1A 3C7DB 1C1DA 1DJQA 3FNEA 5C37A 1UDAA 2GZ3A 1E3IA 1R0LA 3I9MA 3WYEA 1FMCA 2V6BA 4MPDA 4RVHA 4NDNE 4QUKA 4BS9A 1W4ZA 2QG4A 3C1AA 4MVJE 3ZHYA 1O5IA 3ANNA 4NBTA 4MVJM 4PLVA 3ZNPA 4D43A 1A4IA 1NWHA 4GMGA 5DBIA 3DOJA 1AHIA 4CM8A 1KC3A 3SLGA 2Q2VA 5KWEA 1R4NB 2GERA 4WNIA 1VJ0A 1JW9B 1K6IA 5FYDA 3VPGA 4U5QA 1UJMA 1A71A 3ANMA 4NZ9A 3JYLA 3P7MA 2PGJA 4HY3A 1IPFA 4Y6SA 2JCVA 1H6AA 4J16A 4OOFA 1MP0A 2NTNA 1E1KA 3I3OA 4BKPA 2A94A 2PH3A 4KMSA 3C24A 3KSDO 4JX8A 3GMDA 1WAMA 1YDWA 3FR8A 3HNPA 3D64A 2GN6A 1EUDA 4TMFA 4IDDA 3FTNA 1IULA 1NPDA 3RFVA 4CM9D 4KUEA 1X7HA 4WUVA 1PS9A 1LDGA 4RV9A 3WGYA 2EERA 4PLHA 1NFQA 2I6TA 1M6HA 5KVSA 4LW8A 1SB8A 2HMWA 2PWZA 5C7IO 4M86A 2BF7A 3AY3A 2VYND 3O26A 3KHUA 4JBGA 1LTHR 4BNVA 3C8MA 2X86A 1SCUA 2OP0A 3BMOA 4UUMA 4XRGA 5I7EA 3HFGA 4OXNA 2W98A 3HN7A 4CM7A 3GOHA 4NG5A 2RIRA 3M2TA 1LBEA 1E3WB 1R0SA 1R0KA 1DFHA 1G0OA 4AFNA 2YQ5A 1QSGA 1GUZA 4IS2A 2IYPA 4BO1A 4YJHB 4XDZA 3F46A 1LEHA 1X1EA 3NTRA 1IB6A 4JJGA 4RVSA 4E33A 1U8XX 2P68A 4PG4A 3BIOA 3NV9A 3W8DA 1PJLA 4K6FA 2CMDA 2GN8A 4CMCA 1RM4A 1BHSA 2NV6A 5G0WA 2FPGA 2OO5A 3MOIA 5FEUA 1B3BA 1PJCA 3RBXA 1PJ2A 1V8BA 4BNLA 1T25A 2VNSA 2NVWA 1NVTA 2VYVD 3NT4A 4OOEA 1N2SA 3Q3CA 4MIEA 2R00C 1EEHA 4IQGA 1X7GA 3ASUA 1ZNQO 3UOGA 4DLAA 3FNFA 1ZSNA 2DAPA 1CQJA 1IHYA 4XQCA 2O3QA 3WQRA 1ISJA 1ULUA 2DTDA 3OFSA 1T4BA 1ZO8A 2QW8A 4DMMA 2PFGA 1AGNA 4MINA 4YT4A 5I9LA 1UP7A 1N7HA 4D42A 1YQGA 4IY1A 5EINA 2FP4A 4FDAA 3DEYX 3DQPA 2JJYA 3F1LA 4D79A 1U2GA 1P0CA 4E13A 1DC6A 1QXSA 1I2ZA 2HCTA 3VZQA 1Y8RB 2BFPA 5ER9A 3ULKA 3ZHZA 4DIFA 1ONOA 1GYQA 1QR6A 3QWHA 3GAZA 3ROQA 2R2GA 4KOAA 4UUNA 3IQDB 1MXFA 3AI2A 5ER6A 3QE3A 2FY8A 1T2CA 2Y1OA 1M6WA 3D4NA 4WEOA 1KVRA 4FFNA 4O5OA 1DIRA 4LN1A 4N54A 1ISIA 1YJQA 4GPD1 5JCJD 2H6EA 1PZEA 1SNYA 4PIVA 1E7QA 3ZN2A 2UUPA 3ZWYA 1LI4A 2CF5A 3AU8A 1GQYA 1WDLA 4ILKA 1EUCA 1B2LA 5G0TA 4UULA 4FGWA 5IAAA 2DUWA 4KZPA 3ICCA 4GX1A 1TT5A 4QSMA 4FFOA 4OXKA 1LSOA 2EKLA 3FD8A 2YDXA 3ZV5A 3E9NA 4XQEA 5ICMA 1PZFA 4Q39A 4CMGA 1D1SA 1Y9AA 3WGGA 1UZLA 2UVDA 1VI2A 2IZ1A 1D8AA 2J6IA 4PLTA 1RM5A 1LU9A 5AXCA 3DZIA 2IZ0A 3MJVA 3KETA 5K6AA 3TPCA 1F17A 3U62A 2WDZA 5HBRA 4BMVA 4Z0HO 4CM6A 1X0VA 1NTOA 1Z7EA 1U3VA 3BMQB 4ROSA 4YAKA 5I7FA 5U1PA 5A4DA 3QRWA 2Y67A 1H5QA 3VH2A 1TI7A 1H6DA 3PTZA 1FDSA 1HDGO 1KEVA 4GVXA 4ZJUA 1QYWA 3GZNB 2HK9A 3D4OA 1YBVA 3R3SA 1EK6A 1P1HA 4R4JA 4HXYA 1QP8A 2YV2A 4BNFA 5MGBA 2BLLA 1NP3A 1K6XA 1KY5A 2JD1A 3KBOA 1OMOA 4L75A 4XDYA 2V6FA 4Q3EA 3B1FA 1D7OA 1U3TA 2NSDA 4BO4A 3DB2A 3VZPA 1E7SA 1OI7A 1O0SA 3E48A 3WGIA 4MVJF 3I4FA 3PHHA 4ZA2A 1HYHA 4YAGA 3GY0A 3AUUA 1CEQA 3DBRB 5CP8A 4CUJA 5B4VA 5TS3A 4QX6A 4I1IA 4JJFA 4BNXA 1SOVA 1BMDA 1VL8A 1ZBQA 3L4SO 5B4TA 3H3JA 3PDUA 2JHGA 3QVOA 1HZJA 5LDGA 4EEZA 4CMEC 2FRDA 3SXPA 1C1DB 3BAZA 3OICA 4Y67A 3W8EA 4A2CA 1DXYA 1EDZA 5B12A 2PTGA 3KTDA 2XAAA 2VWQA 7MDHA 3I5MA 4E0BA 1B8VA 1GCUA 4HBGA 4JP2A 5JDCC 2D3TA 4BHTA 3DBLB 2HUNA 4PG7A 6LDHA 4XYLA 4RLSA 1MXHA 4YTEA 1E6UA 4CM8B 1SBYA 1GY8A 3H4VA 2PZLA 2Y99A 1QV7A 2W8ZA 3QWBA 4FFLA 4IMPA 4EGFA 4ESOA 4JK3A 2FPIA 3RUIA 3OQ1A 2X9NA 9LDTA 4KTTE 1NHGA 3AWDA 3DZJA 1ADGA 3HG7A 2P9EA 2IZZA 3RC2A 1TT7A 5IDYA 3S55A 3ZCXA 4BV8A 3ZH2A 4M54A 2YFQA 1H93A 5AXDA 3RUHA 3MJCA 3VPHA 4U7WA 2HQ1A 3FN4A 3PIDA 5KOIA 4IDCA 5IZ4A 1MX3A 2E37A 1JWBB 4YJFB 3TFQA 3RC9A 4KTVE 2O4UX 3OIGA 3BHMA 3PJGA 4JNKA 1R15A 4CLEA 1KVTA 1LX6A 1W6UA 4IBOA 1CRWG 3M1AA 5AVOA 2B35A 3H2SA 3WSVA 5CDYA 5CEJA 1HDZA 2CUKA 3N58A 5DNAA 5FI5A 4TROA 4BO3A 4E5PA 2W4QA 3BMOB 3WGTA 4M55A 4AJKA 1VJ1A 2C20A 1PZHA 2FR0A 4KUHA 3PJFA 3RSHA 1FDWA 2VT2A 2IXBA 2IE0A 4CMHA 1YONA 5L40A 1ENOA 4J1QA 4W6ZA 1ISGA 1SB9A 4IDFA 4RZIA 4YDRA 1YS4A 4FFMA 2WYWA
chains in the Genus database with same CATH superfamily
4GX2A 3EN0A 4BKOA 1E3MA 1GUYA 1A2QA 3QWIA 3WFZA 5HKBA 3MMXA 1GGKA 1Q20A 5AI8A 4YP7A 1P81A 3M82A 4QYXA 4J90A 3IPRA 2N3ZA 4Y2TA 1JDNA 1YR7A 2F1IA 5ULLA 1ZQ9A 1P7WA 3G0BA 3KNZA 1W4AA 5TQVA 2WD9A 4FLMA 5JZMA 3B5IA 5B3JC 1VM6A 3ETLA 2BFFA 2WKRA 3CE6A 3N2EA 4OEHA 2ODEA 1W8DA 3BCSA 2GPSA 2XQGA 3EDYA 3NBAA 3IKTA 3CH6A 1ABBA 3GNQA 3K2BA 1OTYA 1U7UA 2AKAB 1UAAA 4LNUB 1SXIA 3V1YA 3INYA 4ITVA 5KKAA 2IBMA 4EHAA 2VPYA 5LQNA 4EI2A 5T4BA 2FEAA 3TZEA 3LH5A 4HAUA 2DQKA 3H5LA 4HNSA 1SWWA 1YJ8A 3NXSA 4OKIA 3TTXA 2HXYA 1IK6A 1GPNA 5TSDA 3ZE6A 4HVCA 1TZKA 1A2KC 1P8AA 1BWPA 2OKGA 2P91A 3PF9A 1X19A 2RSLA 4MB0A 5AK6A 3T3MB 5TIIA 3THXB 4CEJB 1L7QA 5AJWA 2A7QA 3JRNA 1YMVA 3QEMB 4BX8A 1O54A 1T1IA 2NOAA 1OAAA 1FQKA 1UFKA 1UT5A 2GRUA 2JGKA 4KH0A 4RD6A 3ZQ6A 4Z7NB 1N0VC 3O2JA 2OXIA 1AN0A 2RHDA 1BEEA 4YPFA 4CQJA 1JHQA 2VTBB 1JDUA 3K0AA 3VYWA 4ZGBA 5I6DA 2OV3A 4G65A 3HM9A 2O2YA 3NG1A 4Z4QA 2I4IA 4BX0A 2EGGA 2VJAA 5FADA 4ZVQA 4D81A 4W7HA 3KR0A 4HUQB 3QUAA 3N8DA 4QASA 4TXJA 3GIWA 1E2NA 4B5KA 3NTUA 5CNMA 1J39A 2FN3A 2Q3FA 1YF3A 3VO2A 4G41A 4GKBA 2KWIA 2EXXA 4IRMA 2JIQA 1JSLA 5IS2A 2C3OA 1MVOA 2DLCX 2RONA 5AMXA 1TFUA 2ANBA 2GRJA 4UHKA 3CGWA 1KKMA 4HEJA 3I83A 5DO9A 3IHTA 1MO5A 2DUNA 1JA0A 1G60A 2PGXA 3WB2A 3WBJA 1SBZA 2CJYA 1VHQA 4KO2S 5HCNA 4RHTA 4PYRA 4CR6A 1TA9A 2YVKA 4QDOA 5HR5A 1KYIA 1TUBB 1BDHA 4FHEA 3HHPA 4RM3A 5LBIA 2PGIA 4D9CA 3I9V6 1XJWA 3IAM1 1UKAA 5EKUA 5A4MS 1N9GB 4UNIA 1EMDA 4ZC1A 5LYJF 3L0IB 3PGVA 3UWPA 4E5KA 2RFLA 1C0EA 2VP6A 2XWPA 3GBVA 4G1VA 3AB3A 1Z7BA 4L78A 3SQMA 2BN4A 3B3AA 3GGCA 1IJBA 2ETXA 2Y9PB 4Q12A 4IIEA 1HYEA 5CU7A 4FM9A 3B7WA 2AFHE 3EFEA 3GLTA 4YJGB 2R751 1MJGM 2O7SA 1V6AA 5EJ2A 5K3DA 1GV0A 3LC1O 2ZK7A 3QJYA 3G17A 2I3BA 4FJ0A 1QX4A 2FPSA 4CQLA 4DABA 1J90A 3A3NA 3MS2A 1XWFA 3P97A 3V8RA 3WGHA 1Z16A 4EW3A 2QG9A 5JRDS 1UDCA 4HDRB 3V4SA 1P7VA 1QCZA 1WB5A 2HHLA 3I4LA 3MAAC 4WDRA 3FRJA 5IAGA 3VAAA 3BFVA 1JG4A 3EZXA 4QQ8A 4AYXA 1FFBA 4CQMA 1E6EA 3LDHA 2AOUA 2BGIA 3C15C 4F56A 4LZLA 3UMRA 1OJLA 3HU1A 5KYVA 4AMYA 4P4NA 4ARVA 2BP7A 1H8HA 2SBTA 4HNAB 4O2BF 2GZRA 3V2HA 2GEDA 3G6WA 2HDNB 2VAWA 4UBMA 1L4NA 1P6UA 2QN8A 2UZ1A 2QKYA 1CY0A 2H1VA 5G0UA 4E7PA 5EPUA 1S3IA 2NO9A 3T1VA 3VTZA 3I2FA 4BDSA 5AM4A 5TNXA 4V3CA 4PINA 5LOVA 2DR2A 2VJOA 1E2GA 1DBVO 2QRLA 3H75A 3O84A 5FOTA 4BO0A 2XCRB 3CZAA 3VC2A 4EKYA 1U8FO 3LU1A 3PVCA 1XA0A 2A84A 1M5RA 1HY3A 1W85A 2P2SA 3IT2A 1RRPA 3MN1A 4L15A 3AV0B 4B17A 1K06A 1O2DA 4V0RA 3ZUPA 5A5VA 2IHUA 1IIRA 2DLNA 2HPHA 1QVRA 2P4HX 2RMKA 1V3VA 1G5IA 3H9UA 3K8QA 4LCBA 3W8RA 4EJFA 3K71B 1T5OA 3MTIA 4HDAA 1SVSA 1GZVA 2ZVQX 1DOZA 2WHYA 5K3AA 5MN6A 1UP6A 4FGSA 4O3MA 1R6BX 1XTIA 2R7AA 4YALA 4YEDA 1SHZA 1IXSB 3AEKA 3KQYA 4I19A 1M8JA 2OAQ1 1DEAA 2WQZA 4MQEA 4X66B 4QEZA 4UDXX 1CK4A 3ASYA 3MTEA 4PLWA 5DX0A 1GXSA 1TYDE 4RF4A 4MQ4A 5HQ3A 3LCRA 3WY9A 1J2TA 2O23A 3L0ZA 3OPYI 2BKVA 1EXWA 3H11A 3LQKA 5JPCA 3I0ZA 2B25A 3PR1A 4P93A 4HDSA 1VL5A 2ZCVA 1L7BA 4IHAA 4IILA 3WXBA 1MIOA 1ZUHA 2ZQ5A 3SS9X 1WQ4A 1QFYA 2G9ZA 2OGWA 3KKKA 1NDUA 1WU8A 5JNVA 5J5AA 1T3ZA 4HC4A 1ODKA 5KNBA 4CEJA 4HTFB 3L77A 5IARA 5EJ9A 2PYIA 5LC1A 2QXTA 5COBA 4P08A 1L5FA 3STYA 1PNTA 2TMYA 1Z12A 4JJEA 4TYWA 5CB6A 3PF8A 4XEHA 1C8VB 3CCFA 5B58C 5BSEA 2VDNB 4D7AA 4E15A 2Q45A 1DWQA 3BQNB 1Q1EA 3DTNA 4H7PA 4HZUB 5DHFA 5EWMB 2OPHA 4C7JA 3TUJC 4PPNA 1USWA 2LWIA 2PMFA 1KORA 4AW9A 1NOKA 1X9IA 4C7VA 4ZI3A 1XZLA 3OLCX 3COWA 1B1AA 4HVTA 2E21A 1Y5NA 3DXZA 1EE1A 3K9LA 3OJWA 3U13A 2ATCA 1P5HA 1YH3A 3IESA 3MGAA 4RZ3A 1FDIA 4XQGA 1Z6YA 1MZPA 1WP9A 3KYDB 1M83A 3ZWOA 1IHPA 1NU6A 2WJHA 3EGXB 4IUCS 1B2RA 4ZOBA 3ZDCA 4C6SA 2H92A 5ITWA 2VLIA 1BG6A 3C3WA 3NIWA 2I8AA 2LE0A 1SUEA 3SYTA 2VUHB 1WNTA 2GVZC 4RS3A 4XH9B 3TS1A 1BN7A 4Q48A 4HNQA 4KVGA 3SBOA 1L9KA 2H9AA 2HT6A 3GRAA 4FYKA 4MKFA 4O25A 4KR7A 1CZHA 3FROA 4CLOA 3LJKA 1TMOA 4JYCA 4P7KA 2N0SA 4PSUA 4Y1RB 5JSZB 1G4UR 1RPNA 2AZDA 4BUZA 4CR8A 2DT8A 3HWX1 4C7OA 1SXPA 3ZWNA 5ETJA 1Y9EA 1XD2B 3LFHA 4L9WA 4K6CA 1KKUA 3I2HA 4WOKA 4IJQA 3S44A 4B6GA 2FG7C 2ABWA 2WM8A 2WU4A 4LCJA 2WIFA 2VWPA 2OCXA 3BKXA 1IMOA 2ADFA 2VZ9A 1NVAA 5DLYA 1BIFA 4CTKA 5BN5A 4B3SB 1E4EA 4RKYA 2QRQA 4WKOA 5DISB 1GPKA 1RYDA 4EPWA 3H4TA 1DIGA 3O74A 3BILA 1VKZA 3QI7A 1TVEA 2B5VA 3ROMA 2PKRA 2DXIA 3VZRA 1NJ2A 2IU3A 1EFUA 3N3BC 5IUJC 2OV2A 3Q12A 1G291 1HF3A 2P8SA 1U0SY 1GEEA 4YCSA 4NYJQ 4WT7A 1OFIA 2HV9A 4IZ6A 5KHOC 1NJSA 3QUSA 3K6SA 1R1DA 4MA4A 4G4GA 2ZJZA 3KZVA 2ZAYA 1BVHA 4JODA 1EVJA 5AM2A 2BRUC 3A58B 1U5CA 1RD4A 1K3FA 1HMYA 4WLUA 3J81A 3ICPA 4R54A 2I3ZA 2QMOA 3BC1A 4CRWB 4ZFNA 4U7PB 1UBUS 4FPXA 3C8UA 1MT0A 1Y5LA 4A0HA 3ADCA 1U2DA 3EZ7A 2H3HA 5AHWA 2X8AA 1T6XA 3P0HA 3UQYS 4YLYA 4LOJA 2WF7A 3EPPA 3TW4A 1JLLA 3I72A 1EGAA 3DM5A 3HYLA 2XKJE 5ARCA 3QBTA 4CTOA 1L5ZA 4CU5A 3MLEA 2WF6A 5LBUA 4EW6A 1WR8A 5HOEA 4QRDA 3OMWA 2X0RA 2XF2A 3DEIA 1II8B 2QXYA 1NPYA 1UCFA 4TT8A 4R5MA 1EWRA 1Z0DA 2ZLBA 4MAMA 1NXQA 2MT9A 2O8DB 3IDAA 3TVDA 5EFZA 2JLZA 2QRNA 4Y2GA 2JAXA 4L4ZA 4WN9B 1T34A 3PYXA 5IK2A 1V6SA 2KJQA 1YS6A 4E21A 3HH8A 5FTKA 3EYWA 4PVCA 3B1JA 3A6HA 2YMMA 2TMKA 3G68A 2HGZA 2A0WA 4GKKB 4HQFA 2UUBB 1J9GA 3PGLA 4PPFA 5A03A 1QF7A 5KOHA 4OSEA 3NI2A 3M2PA 3TB4A 4ZOAA 1TYCA 3TW8A 4GI1A 4TL9A 3A36A 1OC4A 3G5UA 5D8DA 3A1CA 1CUYA 1IVNA 3EEIA 2NV0A 1KFCB 4OLFA 1RTTA 2H7VA 4FKMA 2WZQA 1QONA 4PHTA 1RLTA 1XEFA 4L4YA 4Z1MA 5CCDA 2Z9BA 3H0KA 5JYBA 4GSKA 3NDBB 4TWIA 2VOJA 1KI4A 4Q1AA 3COJA 1O7JA 4YS6A 3KJIA 3UJPA 1W7AA 2P9QA 2B82A 2VEOA 1BTOA 3S0JA 3TQQA 1TC2A 2RH5A 3BB4A 1V4VA 4J1TA 2BEUB 2OTCA 5KEIA 3U09A 3JXEA 4MW9A 1Z83A 4JGGA 3EVCA 4MITA 5EWLB 3D7MA 3DT8A 5G4KA 4TWBA 4TTSA 3TEMA 1Q7RA 3T7AA 4CT0A 4MQBA 1NVUQ 1FVFA 1TF7A 1YE5A 1A9QA 1NBWB 3T9EA 5A9SA 4KQ9A 5LA6F 3WMWA 3AT1A 1G2QA 1T0UA 3W2EA 2E85A 2ZI9A 1PX2A 1KDPA 1XLVA 4Y2XA 3GVHA 3M5PA 4G3XA 5BN4A 4G1MB 3O7WA 3A9RA 3OE5A 1WW8A 5HSGA 2BP7B 3U3KA 4WNCA 3NJ8A 5AOBA 1PJSA 3CUTA 2QL7A 4FK8A 1TTHA 2IUSA 2Q6LA 3IUSA 3O8QA 3G13A 3O1JC 5L7WA 1GGHA 4IHJA 3D7LA 4ZREA 2CLSA 2CV2A 2EKPA 2UZ1B 1C9KA 1JSZA 1K3TA 1Q7CA 1QHHB 2YYAA 2BT4A 3OZFA 4LGVA 2GN0A 1EFKA 3BA1A 3TCKA 3P27A 4D9FA 2EJBA 2YWJA 4IGEA 3EZYA 2AK3A 3V5NA 1CDDA 5LOVB 1BKYA 4S1PA 2JI4A 2VTKA 4IWXA 1DX6A 4UU0A 2BFOA 4D9JA 1DXHA 3BPSA 1W85B 4DLYA 1IQ0A 2IYZA 1EVZA 1I8TA 1V11A 1BCRA 1PQUA 3NYIA 4P3PA 1FMJA 1GR0A 2P78A 5BV8A 3MBOA 5EN4A 3V3KA 3R0XA 5KIAA 4O4IA 2CLIB 2GCGA 1ZW6A 3L3BA 5C9ZA 1E58A 2ZUTA 4DIKA 5MFPA 4LE0A 3ET5A 1D2NA 8ATCA 2AG6A 5BRAA 5TMEA 1NP6A 2J5RA 3FMGA 4JLJA 1B0PA 1Z2DA 3AEKB 4NU6A 3WWEA 4IICA 2XTMA 1XMXA 2X1HA 4F9TA 2DKOA 1GXSB 4MR7A 1XYYA 1FNCA 1H1DA 5J1TB 3IURA 3KKLA 1YJAA 1NYRA 4PIPA 3RGWS 4IIHA 1R00A 4E03A 1KU0A 4KXFB 2GK3A 3H11B 4I4CA 3HZOA 3VJRA 4TV8B 1PQYA 4CHTA 1Z6ZA 2WI8A 1WWKA 3EY9A 1ZUNA 4GPAA 3G8DA 4LDQA 3THSA 4BFYA 3IDFA 4FHCA 2CVPA 4ALJA 2HEIA 4ATNA 4ZCPA 2QLBA 3GLKA 1PWHA 3OCVA 1AV7A 1QWOA 3FIJA 3BK1A 4X6LA 4KH1A 2JW5A 4W5HA 3DKKA 1LBHA 1O5TA 1PJBA 1JZQA 3GFPA 4IFBA 3SX4A 3W2FA 4CV3A 3U4QB 1JQBA 4P0PB 5C7OO 4UTNA 1U8AA 5T5QA 2GR9A 2B0CA 4LRYA 3ZW8A 1VG8A 1VB5A 4XTRA 1CF4A 2AEJA 5M7EA 3LRTA 4EG0A 3IXQA 2YN0A 1E1NA 2QI9C 1JS1X 4DWVA 1R3UA 4LMRA 2DFNA 5EERA 1SCJA 3REOA 5H3CA 2EX1A 3FPBA 2X8WA 3IBTA 4UTVA 3HACA 1WU7A 5DM0A 3TRHA 3ZDQA 1OAKA 1XMOB 4KQ1A 1JYEA 4HGRA 4B4WA 4F9FA 4YT2A 4I8DA 2BHNA 2VWHA 4BMPB 4D8WA 3HWRA 4WXYB 4L73A 1QG2A 4QXQA 5B3AA 1D0IA 2CYCA 3LGAA 4XIGS 4YRZA 3H2ZA 3VR5D 3FPLA 1QH8A 3RVMA 2XJ9A 3VZCA 4E1VA 3E05A 1TTQB 2BEWA 4OB7A 1TUIA 1UXGA 1CQPA 2PGNA 1HTTA 2G1UA 1NJ1A 1E8DA 1P2FA 1PBNA 2FQXA 4DLUA 2WTXA 2ORED 4YAOA 3ZU4A 5ILOA 5CVUA 4C7OB 1JH8A 1Y42X 2GYYA 2DHDA 3ELUA 4NPAA 2MCFA 3EVNA 5JCJA 3QVWA 4R3UC 2JKVA 3KOZA 2ECPA 4H0CA 4IVRA 1BGVA 3IAM6 3HCNA 3UHFA 5KOJA 1DUSA 1JMVA 2Q1SA 4LRSB 1C0KA 1KDRA 4G9EA 3UUGA 1XELA 4LPKA 4TM8A 3O1LA 5AI0A 4DA7A 1E4EB 4XCQA 1WXXA 2ZU0C 5IMSA 3TFOA 5EP1A 4LJLA 1MJHA 4XVUA 1P2UA 2ZWOA 1R5NA 4M1MA 2P3OA 5CRIA 1JAIA 1Z25A 3PLNA 4G86A 3COZA 2ZQYA 3S7ZA 5LMUB 4B3TB 3HYRA 2F1JA 1AOXA 4RGQA 3ESRA 4YX9A 5HHTA 2XUPA 3QEOA 3SQDA 2G4LA 2PRYA 4PIMA 4X7BA 1OCEA 1Z88A 5AP9A 3SZGA 1ZJ5A 2EQ5A 1UBEA 2HHJA 2R00A 1GQRA 2BKUA 3I4CA 5TX7A 3IR6A 3S2IA 4LF6B 2ZR8A 1G8HA 2QTBA 5ALXA 4XYBA 1EDDA 1OQAA 2XYRA 3BUSA 3WS7A 1C9EA 1P73A 4J2OA 1JKIA 1L7PA 2NSJA 1F1JA 3PVZA 1VYTA 2EJWA 4DLLA 3MQ2A 4HDQB 3M6VA 3NRCA 5K8VA 3A4YA 3P2IA 4RD1A 5CLHA 4S1TA 4UE6A 4C01A 1ZSVA 3IV9A 1TEHA 3F67A 2DH5A 3RI3A 3WR5A 4EBBA 1MC8A 2JS7A 4HRAA 3BICA 3RRZA 4US2R 2JH8A 2WZDA 3DWIA 3TXAA 2CK3D 1AQYA 1HYGA 1N5RA 1XDZA 2H1SA 1NW9B 2VVTA 4MOWA 3T8YA 1G5HA 1FMTA 2VWGA 1YL5A 2HMSA 4DARA 3NHWA 2NO1A 1SD5A 4D0LB 2NTEA 1PT6A 3IIIA 1KO8A 4WBNB 1CR1A 4J0GA 4A91A 1W36D 1J0CA 3A3PA 3GLFE 1T2EA 1GTZA 1GYPA 1IZZA 2PH1A 1EPUA 3VKFA 5LMNB 4GMXA 1R16A 4N3AA 3CEPB 4MR8A 4J7XA 4ESEA 1OH7A 5D6NA 1N3IA 3B9BA 4O02B 3H6KA 2CFOA 3UT5A 1YL6A 1CDZA 2F48A 3RJTA 4XLZA 1Y0BA 3IMGA 3QEKA 3H8JA 2PJUA 1GQFA 1ILWA 4HD8A 4NNPA 2O8CA 3CNEA 3K5HA 3M6LA 3SFVA 4J76A 3WVNA 3OTHA 1EZ4A 1EESA 5K3BA 2AVDA 3D1VA 1FTSA 3FI0A 4LHXA 3TW8B 4BFTA 1O0BA 3N7AA 5IAJA 3THWA 3ROTA 1QCDA 3CEAA 4JLAA 4UM5A 3ZZ0A 4MX8A 3PCTA 2C0PA 4PVDA 4JI8B 1UWCA 1L8QA 3T1OA 2C82A 5CXSA 2M98A 1K2VN 3I58A 2D5IA 4NBVA 1FXSA 5DM70 1EIZA 1TVMA 4MDFA 4YCMA 5AHOA 4IV0A 2QLMA 4IWYA 3WLHA 1N5KA 5T7BA 1SQFA 3NIDB 3CONA 4Q9KA 4BFCA 2GETA 2RK6A 3TLKA 1HQCA 2QNBA 1JA9A 2DKNA 2CL5A 4NQZA 1RQRA 3DWEX 2UYQA 4U9UA 4XB1A 5HDBB 4KIJA 4XQ9A 3D3KA 5A3QA 5A9SB 1BXZA 2WSLA 4M0DA 1B41A 1WS6A 3D6FA 1L7NA 2HTEA 4P22A 1YE3A 4RIIA 1PJ3A 4X45A 1XVIA 2E5WA 5DLPA 1I13A 1KXJA 5BN4B 1EGVB 3SMQA 1D2RA 1IN1A 2D5BA 2VYCA 3URKA 4K9LA 4E2WA 2PX3A 2X2PA 4OQDA 3NUGA 1FP4B 2PBRA 4F86A 2WOJA 1ODSA 4L8VA 3I73A 3O8QB 1PFQA 2Q28A 2EHDA 2FDXA 4IHJB 1C1HA 4XKJA 1RS0A 4LSWA 3O4GA 1BW9A 5DYIA 1YU9A 5H4HA 3HZZA 4I2NA 1QIEA 4G97A 5JV5A 1E1RD 4G5HA 3AEUA 1R3DA 1ECBA 5JBQA 3P94A 4F11A 3PXCX 1XDBA 3O0DA 4WNYA 4GLFA 4RTSA 4HX5A 4RUKA 5IC5A 1FJHA 1K88A 1Y98A 3H6HA 1UBFA 4UTOA 3QYJA 4NV3A 1HC7A 1NXPA 4NMLA 2V3VA 3ODGA 4FGLA 1NGSA 3H7IA 3WLFA 2CFCA 5C5IA 5C5DA 3KD2A 2ONZA 2WD8A 4ER0A 4JR1A 4I2VA 3FMPB 3LIIA 1F4PA 2XVMA 5BQ3A 4WZAB 2P11A 3K9GA 1UC8A 3KAPA 4E08A 4L0MA 1CJMA 1WBJB 5DCLA 1SZCA 3N3AC 1CQJB 3NHRA 4X1YB 3ZWXA 2IZ7A 2P79A 4MV8A 3BFJA 4UTXA 3ROZA 3GN1A 3L49A 5JBNA 1FFDA 3FKJA 4NG4A 4UAJA 3MJHA 4Q7QA 4Z4CA 1E3LA 2QQ5A 1UEJA 1M2EA 1WP4A 4UNRA 4FDVA 4N7RA 3EUWA 3L46A 4YMGA 1FFEA 2CJXA 4FFBB 2HTFA 1UFQA 2C9OA 1CY4A 1JQEA 1FFWA 1W19A 3A05A 4GNKA 4DYVA 5LDDC 1EWQA 3AUFA 4ALIA 1RZRD 3KSUA 5KTKA 2A9OA 3M33A 4I50A 1MVLA 2IEBA 4ZVVA 4AG6A 4RTJA 4RJIA 4ZICA 4XOIA 5F1PA 1R5JA 5AVWA 4ARAA 2VXOA 4KXXA 1A8IA 1WUHS 4QFDA 2YTZA 1I3LA 5CGZA 4TMKA 4DDKA 2LRHA 4YB8A 3RAEC 3Q4GA 4JOSA 2HFKA 1DV2A 1R74A 3C6ZA 1IXKA 2QP3A 3GXBA 3FCOA 3TF5A 2FZCA 1HSOA 4IO1A 1E18A 4NWIA 1C4XA 5BQXA 3QUQA 1KQGA 4RVFA 1FK8A 4PCVA 3MRSA 1EAYA 2WD7A 2NPOA 3CX6A 3MMPA 2D7CA 5K8JB 2QLLA 1ZC4A 3CQ9A 5EQJB 4PN7A 4RPLA 4GRAA 3I1JA 3CX4A 1A8QA 1LZLA 2I66A 2OUKA 1C3VA 3GVIA 4OQXA 5A5EA 2BISA 1OXXK 3VA7A 3JAKB 2IPLA 3W78A 4PZ0A 1ZJYA 3QA9A 3D2CA 4YAFA 5JNLA 1YXMA 2H08A 3N2GA 4KNVA 4KN8A 4U3JA 3TR5A 1CB7A 1ND6A 1ZIDA 1N34B 1L8AA 3TNYA 4J0CA 3K72B 2R6HA 3FHJA 1QH8B 5I7WA 3HNOA 4LBWA 2BEWB 1T9DA 1K9SA 1LLCA 3MGGA 3IV6A 1BNCA 2CVQA 2ZJ0A 4YAJA 2QR5A 4KXQA 3OUZA 1IN6A 5H9VA 2V9ZA 3ZGVA 5A0TA 4NE7A 3O8OA 5TF0A 3PXGA 4BX2A 2YXEA 4NU0A 1W88A 1XF1A 2FQQA 3V8EA 3KJQA 2BOVA 1TKBA 4EK9A 4FQ7A 1W73A 5DF1A 1IK4A 3QLVC 4HBZA 4YC7A 3WO1A 2C4HA 2PXHA 4BQPA 1M5TA 4C5AA 4F72A 5JQWA 2MYNA 3F9RA 3IAAA 1I6MA 2OYCA 3ZTWA 4WZ6A 1HLGA 4M89A 3W6OA 2NXCA 3OA2A 1C50A 4MUKA 3AG6A 3PPXA 2HK8A 5FWYA 1F0KA 1CZUA 3PD7A 2ZSAA 5C1DA 5HRCA 3U16A 4LF5B 5JD4A 1VHJA 1RHJA 3KR1A 4L4XA 5REQA 2ZRDA 4LFAB 2X8JA 4Q3AA 1GQSA 1KOLA 3EZGA 5C1PA 4B85A 4LI3X 3LZ6A 2EX4A 2PUVA 3K1JA 3K96A 3P2JA 4GQAA 4LXQA 3WICA 3R5JA 5BVGA 5C32A 1O0CA 4NEHB 3OEWA 2A1IA 2ET6A 3L9XA 1R9NA 5JAIA 3HDQA 3FCXA 4J0QA 4MHSA 2FKNA 2BM8A 1MA3A 1EBUA 1AUPA 2F59A 3EXIB 4KMMA 3ZLBA 4JJKA 1Q3HA 3GPBA 1KWKA 1OFVA 1P0QA 2II6A 3EXG2 2AXQA 3PEVA 3SVTA 4URFA 4EF4A 1A9SA 4IJVA 4ETWA 5IKMA 2N75A 2BMFA 3P2OA 4OYYA 2QX8A 3PUHA 3DLBA 1C4OA 1IATA 1I2AA 1WPGA 2SKCA 1NRIA 2DFVA 1MB3A 3GJSA 2WVAA 4LY6A 2B3DA 2ZJ8A 1KAOA 3A4NA 3E5RA 3SE7A 3UTDA 1R4MA 4WE3A 4R9SA 3RROA 4PNPA 1UOEA 3QBVA 4M9SA 1VGQA 4X5OA 3O83A 5GJWC 3R8FA 4M8SA 1WF3A 1XA3A 2A7XA 2XGMA 5TJ9A 1U0BB 1JR2A 4XYGA 5FAXA 4MS3A 1BMQA 3SAJA 3ZQJA 1P0IA 5H7XA 1WMFA 3RG2A 3ZE7A 4LSMA 2BTEA 3N2IA 4WFJA 2PT9A 1HE1C 2A5GA 2CEKA 2X5JO 2GEKA 1Z5UA 3FJYA 4AN4A 4EUHA 1GL7A 3PFNA 4G81A 4W7IA 2RCYA 3FTEA 4TL6A 3UAZA 3DVSX 4DLWA 3CLTC 2WG2A 2QY6A 2HHCA 2ZWAA 3U7QB 2QA5A 3R3UA 2FEMA 1JLMA 1LV8A 2H2AA 4I4TB 4RKRA 3V7UA 1C2YA 1MQ8B 1SJ9A 3EA5A 2DCUA 3F5MA 4M7OA 4TUYA 2RGXA 1T8YA 2FPLA 4QXAA 2EQBA 4DCNA 3FVRA 1Q2XA 1JPJA 4PE5B 1R12A 2PS3A 3CBGA 1CS4C 3ETDA 3IEXA 4XSVA 5G4LA 3QQ5A 1XVTA 4RQUA 3THWB 1MVNA 2D59A 3GJTA 1K6EA 1X1SA 2XH8A 1QIKA 1Z7WA 4NCKA 1U7PA 2DFDA 1ZJ4A 1SKMA 5E3JA 5K51A 3WMXA 2QZPA 3RVQA 2HA3A 4EG6A 4FIZA 2WV7A 2F2TA 5F23A 1M0TA 3KEGA 1TO2E 3NOVA 4YMLA 1RZUA 3R7DA 4PC1A 2C2OA 4AUEA 1CY7A 4F60A 5AM3A 2O5RA 3EPJA 1HI9A 4I9HA 5KDOA 5AFSA 1XQ6A 4PC7A 3P4XA 3PHIA 4F6LA 1C0IA 2FXIA 4JWKA 2P62A 1KWGA 1XU7A 3VVCA 2C4VA 3H5WA 4X3PA 4DCOA 2UYGA 5CFOA 4XWTA 5I7OA 2WBLC 1P1IA 4QT0A 5JCOC 4HH1A 1E2IA 1JV2B 1VP3A 3KD3A 1N2BA 3ND5A 4GDFA 2Q8NA 2VDVE 1XMIA 3PXEA 3PPIA 3GZTB 1I0ZA 4H7IA 1Y1KE 1MD9A 3MLAA 1JLKA 2ZU6A 1MAAA 4YMUA 2PJRA 3GT4A 1Y37A 3EFHA 1A4UA 1YZ3A 2UZIR 4BQRA 4AX8A 2RHWA 1X2EA 4AJ2A 2PLWA 3F6SA 4OSPA 3BTOA 3RC3A 5LXTB 3NBMA 4E88A 1SBTA 5SZJA 1L1QA 3W9SA 1M2JA 5E1BA 1L6RA 3W3ZB 2YFYA 4OHFA 4MIOA 3FYUA 1NAHA 4AURA 4U2EA 2ECFA 1V3UA 2X41A 4G09A 4CKEB 4GXNA 4TS4A 1BW9B 2G9QA 1UZUA 2HF7A 2OCBA 1E1MA 2FHPA 1XO1A 1ZGCA 2WU8A 1KMHB 3PENA 4RPHA 5J23A 1VXOA 3NTLA 4IVPA 2WJJA 1WHTB 3AEUB 3M3PA 1J25A 2J3IA 2CCKA 3OTGA 3TZCA 5DX1A 3UXEA 6PFKA 5AO9A 4IJUA 1E2PA 4BQSA 1V3TA 2O07A 1V7QA 1Z18A 2A3RA 1HFWA 1UBSB 2C29D 2GHIA 4QPPA 4HJXA 4MP6A 1IXRC 3TW0A 3BMQA 1ZCBA 3ZDEA 1ZISA 3L7KA 1MOSA 4DPKA 4RA6B 5FF9A 4Y6PA 4OAQA 5EE1A 3T4PA 3L1UA 4KN6A 4O4LB 2AE2A 4UCQA 4XARA 821PA 4O3FA 3NBXX 4JJZA 4B7UA 4M0UA 2EX0A 1YDFA 2A9FA 5L8VA 2GCNA 2NXEA 2UYOA 3NNSA 2Y4NA 4WW0A 5ISMA 2O8NA 1GT6A 2BUAA 1PR5A 4W9NA 3HA5A 4KQHA 5LUBA 1ZGGA 2N47A 1T8RA 2I4RA 1ITZA 3HPRA 1T6YA 3O5AA 4J29A 4MW6A 3A06A 1H2RS 4XDGA 4CCYB 4CETA 1TK2A 1QUEA 3ERCA 2ZE8A 1S89A 1G6OA 4TQAA 1ADFA 1BZYA 4RM2A 1B8UA 2V65A 4CDMA 4QGSA 5B1EA 4O2LA 4B46A 4X00A 4IDEA 1E4OA 1ORRA 2UZ0A 1ANKA 2PMCA 1RRFA 1VFPA 3R5TA 1ZN8A 2ZSHA 2XMCA 3PEEA 2YHAA 3T5PA 4JYBA 1GL9B 1REQB 2P35A 4JYMA 3LV8A 3F96A 2X6RA 2VZLA 3B2QA 4PR0A 2ARKA 1P7ZA 2GM3A 3G2IA 3DEZA 2Z57A 5K8CA 1WKVA 1L5HA 3AIMA 2FA9A 2O2HA 4UM9B 4HWPA 1Z17A 5KPJA 3ND6A 4BP9A 8ABPA 4BRUA 3M81A 2AWOA 2PDAA 3FOWA 4LDAA 2CL6X 4YRCA 3JQAA 4PYLA 1VIMA 2DY0A 2ZB3A 3C3PA 4PM4A 2WD7B 5KWSA 3NTOA 1NVBA 2MU1A 3GWZA 5KNCH 5HK9A 1CNFA 4IQ8A 1PGQA 1G20A 3ROKA 5JWOA 2YZ7A 3I9KA 2FPUA 4B6RA 4REMA 2VA9A 1N2XA 4OXYA 1VPWA 4FKZA 2IEYA 3OM1A 4GI5A 4X65B 1F7VA 4QG3A 4OP2A 3W5IA 2OCKA 4OYHA 4AP6A 5K0GA 2ZRJA 4RY0A 4MLDA 4PXAA 1U2GC 2D2XA 2BFCA 4V3BA 1ID8A 4WCFB 1DTSA 2UZAA 1OASA 3PICA 5JH7B 2V5UA 3TCXB 1D1PA 2GNAA 3C2QA 4QPCA 3TLGA 1BMFA 3KOMA 1ODCA 2C57A 1LNSA 2WKSA 1XCLA 5D86A 1L6IA 2P2NA 3AR7A 2X7JA 2CLOB 2E4XA 1P33A 3MGBA 4IZIA 2HK7A 4G37A 1DPFA 4P81A 5D00A 2FE1A 4WNAB 3SVZA 1QAOA 2G4VA 4C76A 4A92A 3L0SA 3O8OB 3KU4A 3O2NA 1W88B 4H1WA 2WE7A 3GFGA 1E59A 3RH0A 2WQ7A 4EHLA 2Q9AA 4B44A 5DBFA 3D8RA 1G1MA 1NSTA 2VDLB 3QWFA 3ZWCA 4Q02A 3OLXA 4MLZA 1H22A 2OD7A 1GTG1 5H80A 3M1IA 5FWYB 2QI9F 3DLAA 3LKZA 1I7DA 3DLCA 4B3RB 5DKFA 1JYFA 1RMYA 4FWTA 1JLHA 3BRWA 1X9GA 1N1EA 4MV4A 4WPGA 5REQB 4W5OA 3GQBA 4P4UA 4WAUA 2X8JB 1UKZA 1HDIA 1XFAA 1MB0A 3WKEA 4HV4A 5BVGB 4QDZA 1NF2A 2LDXA 2QY9A 3RBVA 1VJTA 3OIFA 2FDRA 5TPZA 4D2IA 1EZZA 1EYZA 3ADPA 2DPLA 5L3ZA 1ZN7A 4ARZB 1UIRA 2Q8QA 5CB8A 5K6AC 5K45A 1V9LA 5CVDA 3FY4A 1U5AA 4KHPB 4X20B 5ALTA 4GUDA 4J1SA 1AQJA 3BHNA 3V4VB 4CZ2A 3BIXA 1KZ9A 3CVYA 3E2MA 4OYLA 1RSZA 4MR9B 3OCXA 3IBSA 3MWGA 3QPBA 1CVLA 4UBLA 4UPVA 1FYEA 3DEHA 1BHO1 4RYLA 1LPOA 3I2GA 4W5NA 3L8EA 2YHIA 2Q1UA 2JAPA 4LJ4A 4TOIA 2Q3JA 4F8YA 4KRGA 3PIIA 4ZKDA 4KR3A 5CDGA 1CTQA 2J3JA 3BZWA 1R4MB 3RKRA 4QYWA 1U4NA 2EYUA 2WWTA 3PEWA 4DQXA 4NEQA 2JGAA 5BMVB 2XZLA 1PS8A 3UK0A 1JHUA 1AQLA 1XYVA 4I1UA 4XQ0A 1UKVY 2PAFA 3EHEA 1GAJA 1L4YA 1R0XA 1X87A 3OQIB 4LXXA 2I65A 4N5DA 4TLAA 2IYXA 3I2JA 1JILA 1XLWA 3JQBA 1FVOA 3C5EA 1Z4NA 3TFWA 4F3KA 4R0MA 4V0KA 4DCSA 1SVLA 1U3FA 1JQKA 1S2GA 2QTMA 3H1FA 5KCZA 3SHOA 1MV5A 3QVSA 5DCUA 4E5VA 3L4JA 2OHIA 1FZTA 5T4EA 2F8LA 1CUCA 3B8HA 1FU8A 1T3TA 3TSWA 5FWDA 2K7ZA 3TBHA 4K28A 1OFGA 5H4GA 5FQNA 1L5OA 5DHPA 4F9GA 1C81A 2QZ4A 1CUBA 2I4OA 2JVJA 2QPOA 2V6MA 2YZNA 3C8DA 4DJEC 2J0UA 5TV2A 3F5SA 3MJTA 1UMKA 1I7NA 1THMA 1W1WA 4EX6A 1DQPA 3BRQA 5J4YA 1P74A 2R1TA 4MQMA 3AM1A 1CY2A 4M0KA 3PLAE 3EFOA 4HUJA 4QPZA 5J40A 2W58A 3SJ7A 4C7XA 1ZYUA 2XB8A 4EDFA 4LEIA 3CR3C 3EMKA 3S8YA 1GKIA 2H1WA 3JQFA 3CEMA 4EYSA 1ZN2A 3L7AA 4TKZA 1FXUA 4YAUA 5BSWA 1IY8A 1CC1S 5GGYA 3WIDA 2OECA 3EODA 1OBOA 3IAFA 4FKBA 2QYHA 2ZT7A 4HWOA 1B14A 1E2KA 4R98A 1RHQA 1I7QB 5ALKA 4E1AA 1Z08A 2QJTA 2VTEA 1ZD9A 1YQDA 2CHGA 5DYWA 5DBGA 3DKVA 4RFLA 4BMZA 1UBNA 2J5KA 4JDUA 3CW8X 3PQCA 2Q3MA 5CBPB 5DTMA 1FFAA 3IULA 3BH6A 3UOWA 3VH4A 3M6IA 4KE7A 5KAPA 2FW0A 4P80A 5FOQA 1O94A 1GTRA 2PK3A 1NLYA 2PL3A 3BK7A 4MUNA 1NJ6A 2G0TA 5FRDA 3TUIC 4NKRA 2G5PA 1V4NA 2EZTA 4EYKA 4JOQA 1K3UB 4AUNA 3UK7A 3EOBI 5JAZA 3TDNA 1Q44A 4DNOA 5J43A 3H3XA 4KJXA 1QV9A 3WGUA 3KKEA 1W59A 3LD9A 3FYUB 1J4AA 5FUXA 3L0DA 3U6KA 3A1SA 5J4KA 3IAXA 3MTAA 1MC5A 4LJ5A 4LK2A 4LWQA 4QUEA 3CRZA 3GMTA 3G85A 4Q1VA 4L27A 4JUIA 4MWBA 3NOOA 4JLSA 2QZSA 3TEJA 3U1TA 3FYSA 1RWOA 1T8SA 2JDID 1ESMA 3K0BA 3IOYA 1WW3A 3I32A 1ZLYA 2G07A 4Q4AA 5KX5B 2VAPA 3A9UA 5JC1A 1CZRA 1X70A 4FQ5A 5F4BA 3CWCA 4MVJH 3H65A 1GFIA 3SEQA 4MARA 4C89A 1APBA 1EVEA 3Q9NA 3R8CA 4M49A 1R7RA 4G24A 3JX9A 5JQGA 5HE8A 2QD1A 4KQKA 5K2MA 1KDZA 1HZZA 1L0BA 3PUXA 5FR1A 4CM5A 2Y6UA 1A7UA 1LPNA 4RVUA 5FXMA 1JDBB 4O2AB 4P2BA 3KQSA 4XZ3A 2I67A 2YNMC 1X94A 5I48A 2X23A 3ZJYA 3SVLA 2NNLD 3PQ3A 5LU8A 4JS0A 1JQ3A 4JQCA 2EARA 3E23A 1P44A 3RRXA 3U4AA 2XKAA 2JFNA 4HB2A 3L2OB 3BD9A 4AWXA 1SVWA 3JZDA 3I52A 3EXHB 1B42A 4PHCA 4PRKA 3VTFA 2OL4A 3CPEA 4HDNB 4MQLA 4BTVA 1V39A 3BRSA 4HH4A 3AR5A 3QMVA 4QVIA 4IDAA 1Q0TA 5ITZA 2QE6A 2QR2A 2ZRIA 3DS8A 3DW1X 5DM1A 1VDZA 3R9KA 1SULA 2VZ0A 2CN1A 4Z8XA 4F8EA 1ZAKA 1KZYC 3QUCA 4ZWNA 2Z5VA 2OCYC 3I76A 4GDMA 1JSXA 1M8GA 5HJ2A 4FCWA 3ZY6A 1FUYB 2VPTA 1ARZA 1GWNA 1JU3A 2H7XA 2PVPA 4JP3A 4U9IS 3SP1A 4RJTA 4D25A 2FR8A 2JCYA 3ZBTA 4YR9A 3HYNA 2IYOA 1P1JA 4NMWA 4DQVA 3NX4A 1YA8A 5IBCA 1K0FA 1NE2A 1OBHA 1HSZA 3JQAB 3MB8A 2VT3A 4BE4A 5I7VA 1MX1A 2D5AA 3HL4A 3P9KA 5KYXA 1X92A 2REXB 4JL8A 3QVGA 4TXNA 4ZOCA 5T8KC 3D02A 1K8QA 2CLLB 1RW4A 2DUMA 2OCPA 3Q2IA 3O1IC 1BQEA 2PV0A 4UCFA 4YRAA 5C8ZA 3ZLUA 3E53A 3HRHA 1EA5A 4R2HA 4RK0A 2YXNA 5F3RA 1YTLA 3O8RA 2ZSDA 4RZHA 5FBQB 2CK3A 3AF2A 3V4RA 2FEPA 4Z9FA 1A7KA 2WIJA 4OYRA 4W82A 2MYTA 5WRFA 3ILXA 3M4NA 4NAHA 1XTPA 3WKBA 4ACBA 1DJMA 2IQ5A 2WSYB 7ADHA 2PPLA 1F8FA 4HAOA 3VSCA 5CNKA 3GP5A 2MINA 3MWDB 3ETGA 4XD7A 2PUBA 5EJEA 2NO7A 2YN4A