4AJPA

Human ldha in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol- 6yl)amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
329
Chain Sequence
ATLKDQLIYNLLKQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 329
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ajpA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4ajpA02
4WKGA 5JSFA 2FMUA 4M54A 3U62A 2ZTVA 1XIVA 1YO6A 1E5LA 3BTUA 2GLXA 2EWMA 4CPDA 1WPQA 1C14A 2JCYA 1I36A 4RF3A 1A71A 1ZUD1 1VKNA 4JP3A 3G17A 4XX0A 1V6AA 2PKQP 4XJSA 5JMPA 2DAPA 4ROSA 4HFNA 1PR3A 3U49A 3DO5A 3FNGA 4BNGA 1JQBA 4DBZA 1LQTA 1GR0A 2GRAA 2HCTA 3U4HA 5TT1A 2NU6A 3ZCXA 1DLIA 3VPHA 2FPGA 2WYUA 3DAFA 1ISGA 3PHJA 3QSGA 1DIBA 5G4KB 2O3TA 5DOVA 1B26A 4FB5A 1GQQA 4CR8A 1ULSA 1KEWA 3AK4A 3WOHA 1L7DA 5A1TA 3NDIA 3EUWA 5CDYA 3JQAD 4TKLA 3ZNNA 5A04A 4BNKA 3KVOA 2VCYA 2YDYA 3A28A 1QYVA 4IY1A 5IXYA 1NQTA 4J4TA 2CVOA 3W4KA 4CMEA 4R1SA 1BXGA 2Q1UA 3GEMA 1PZFA 2P9EA 6LDHA 4PLFA 3JQ9A 4FFRA 4JN6B 4JCOA 4WCFA 3H9GA 1HSOA 3TZHA 4AJ2A 3BXXA 3A06A 4YAKA 2VHYA 2NNLD 3HN7A 1V8BA 3VAZA 2JKVA 3TFQA 1H5QA 2JFGA 4WE3A 2R00C 2P91A 3ZU4A 4BO4A 4MVJD 4BUCA 1GEGA 4FFPA 4KQWA 1LDYA 1Q7CA 4KWHA 3K92A 3U0BA 3WWZA 3CINA 1FDVA 4RF5A 5IDQA 2O23A 3Q6IA 1X13A 1YBVA 3DEYX 2FZWA 2IYOA 2OMEA 4AJPA 5CG1A 5GY7A 4H16A 5CP8A 5JC8A 5H83A 2C7GA 1YOVB 2O2SA 4LMRA 3RBVA 3AW9A 1SB8A 1EE2A 1NPYA 1VLLA 3QWBA 4M86A 2NQ8A 4OJNA 5CPFA 3LLSA 5DNAA 1YL5A 5J23A 3NTRA 1ZSVA 4FD3A 4DGSA 3WSVA 5TC4A 3VPSA 3JYPA 3PLNA 5F5NA 1Z7EA 3ZWCA 3RSHA 3JQEA 4X54A 3RC9A 1P45A 2W2KB 3W4JA 1HDRA 1F06A 1HETA 1HSZA 1L7EA 3BAZA 3GFBA 4Y67A 1ENYA 3COSA 3LC7O 4CUKA 4L9RA 2C2XA 2WYVA 1TLTA 4JBIA 4KP7A 4BB6A 2BGMA 4BGIA 1LDGA 1ZIDA 3MJCA 5JNLA 1B16A 2DU8A 3EW7A 5JCJD 4B79A 2EXXA 4PG5A 3RKRA 2B5WA 1DAPA 2IXAA 4M89A 4R16A 5ILOA 1ONNA 2QZZA 4JQCA 1D1SA 3NJ4A 2QG4A 5A02A 2GYYA 3HB5X 2VRBA 3BTOA 3DFUA 3CUKA 3ASUA 3E8XA 1O94A 2ZQYA 1H94A 1E6EA 4J49A 2W98A 3EC7A 4OKIA 5GZ6A 1GUFA 1KVRA 1PZEA 3NX4A 4YJFA 1DLJA 1PGNA 2RH8A 3DZKA 3RQSA 1BXZA 3H8VA 3WJ7A 3JYLA 2FN7A 1ZXLA 3H9UA 5ITWA 1MC4A 1NQOA 4KWIA 3JYOA 1RM0A 1UDCA 4YAGA 4MIOA 3RBXA 1DRVA 2GZ2A 5I7SA 2Q4EA 1U8FO 3F3SA 4XIYA 2VT2A 3UH1A 1U5CA 1CEQA 2HUNA 2X8LA 1Y6JA 3AM4A 2ZK7A 3JD4A 4NZ9A 2EJVA 4DXHA 2YV2A 3KETA 1BXGB 2Y1CA 2QYTA 5F5LA 1PQWA 3CTMA 5G0WA 5IAAA 5JFOA 1SC6A 1Z45A 1JVSA 2X5JO 4J91A 3SC4A 3ASVA 3P2OA 1TT5B 4R69A 4G81A 1Y1PA 4RVHA 1YH3A 3ZH2A 2XOXA 4BGVA 1MV8A 5TT0A 1X0XA 2X22A 2WMDA 2LDBA 1P9LA 1E1LA 3QWFA 1MG5A 4OXNA 3WMXA 4ZRNA 2NWQA 4P4GA 4E30A 1UXKA 3PIIA 5EERA 3VDQA 3L77A 3N74A 2VT3A 5TJHA 1M6HA 4QX6A 1ADCA 2C54A 2DLDA 2NU8A 3NGXA 3PVZA 5A5FA 1S6YA 1V3TA 4OOEA 2C5EA 1Q0LA 4O1MA 3X2FA 3E5MA 4BMSA 4BQPA 3MWEB 1PZHA 1IPEA 3BHJA 1T2AA 4R51A 4MIYA 4DPLA 3E9QA 5HS4A 2ZCVA 4II3A 2AXQA 4D43A 4DQXA 3TL3A 4N5NA 2HRZA 2A35A 2YHUA 3F4LA 3AUAA 1SPXA 4K6FA 3V1YA 4ND4A 2W2LA 4UVEA 2RH4A 4FBGA 1E92A 2CNBA 1I2ZA 3GDGA 4HP8A 3JD1A 1YS4A 3P7MA 3WGYA 3AUTA 4KOAA 4Y9DA 5KVCA 1OBFO 1R0KA 1QP8A 2PTGA 3L6EA 4IQ0A 4OM8A 5DULA 2W8ZA 5TX7A 2BLLA 5AXCA 3ZNPA 2DKNA 4FFOA 5FI3A 2WWRA 3KRTA 1N9GA 1UXGA 4BNYA 1E3SA 1Z75A 3E03A 4CLDA 3H5RA 4U6QA 1PJ4A 4J0EA 2VYNA 3H2SA 1PJLA 3T7EA 5K6AC 3GT0A 3QWAA 1A4IA 4GVLA 4D44A 4GLLA 1DEHA 5KJFA 3F5SA 3L07A 1LSUA 1FMCA 1C1XA 4AICA 3HFSA 1HZZA 1KEVA 1DHTA 1XQ1A 4J4BA 3D4PA 1ADGA 4BO9A 2CD9A 1L1FA 1LLQA 2Q1SA 4Q9NA 3UCEA 5IZ4A 1KVUA 3E9NA 1C0LA 1SEVA 4BO7A 1I8TA 3W1VA 1ZK4A 1YBMA 3KSDO 5AXBA 3HUDA 7ADHA 4GSKA 3NTQA 1B8UA 2DUUA 4B3JA 2BFMA 3DZBA 4R41A 1K5HA 3M2PA 4O63O 4CM7A 4L73A 5JBIA 4IIUA 4DREA 1LTHR 1NWCA 2I3AA 3AWDA 4KTVE 6ADHA 5BSFA 2P68A 4UVDA 1NFQA 1HYGA 4CL8A 1QMGA 1DC6A 1PS0A 1R4MA 2SCUA 4GVXA 3FTNA 4LRSB 4IDCA 2CSUA 3JQBA 5HBRA 3ZWVA 1LLDA 3MWDB 1A9YA 3FWNA 1T4BA 2Z1MA 4IJUA 3F5QA 2OXIA 1P74A 4BNZA 3BTSA 3ZWBA 3TZCA 1PGQA 5BSHA 1LDMA 4WNIA 4U5QA 4D3DA 1KIFA 1HKUA 4AJEA 2W4QA 4YPOA 2NTVA 2VNSA 2J8ZA 3HJAA 2EERA 2NTJA 1MFPA 2IZZA 4A26A 1DRUA 2X0NA 1VL8A 2J3KA 1NAIA 5JC1A 3PP8A 3WTBA 1UZMA 4TVBA 4S3MA 4IM7A 1G0NA 1P31A 1BDMA 3AY6A 1WDLA 4EITA 4CM6A 3MJEA 3S8MA 1C0IA 3D1LA 4ND1A 1JWBB 3G0OA 3GZNA 4YQYA 1H6AA 3IC5A 4ALJA 1BTOA 2VZ8A 4N5MA 1RYDA 3C1TA 4ZQEA 1QYXA 3OQ6A 1YQXA 4E0BA 2J3HA 1S7CA 3E48A 4J6FA 3GGPA 2C5AA 3KB6A 3AOEC 4CM4A 2R6JA 3JCZA 3PZRA 4GMFA 1C1XB 5T64A 4HX5A 4NBWA 4NBTA 4ONEA 3RC2A 1A7AA 1GADO 3RFVA 3DTTA 2AG5A 4YAIA 2Q2VA 4EJMA 2G1UA 1PGJA 1QYCA 3JQGB 4HWKA 4W9NC 3PGJA 4IJVA 4KDEA 4FS3A 5ER6A 1EVYA 4ZN6A 1ZEMA 4XGKA 3QWHA 5A3JA 1NP3A 4BOYA 5A9RA 1HWYA 1R16A 1PR9A 4E2ZA 4WOJA 3GDFA 2D59A 3LYLA 4EBFA 1X15A 2Y1DA 1J5PA 3HDJA 4CM8A 1SZJG 1GCUA 4U8GA 4QEDA 3CZRA 2Z1NA 2V65A 4ALKA 5JPIA 2POQX 4NJMB 1CWUA 4QSMA 4AJNA 5CPBA 4XCVA 2P9GA 2H1SA 4O6VA 5TLSA 3I52A 4BNJA 1R4MB 1ISIA 2H6EA 4OYRA 4WLOA 4B8ZA 5L45A 3GQVA 2DT5A 1IUKA 1PJBA 1HE3A 1GUYA 3C8MA 5KNLA 2HU2A 2CUKA 4N7RA 4CMBA 2PH5A 2WE7A 4R3WA 1X0VA 2HO5A 1A4UA 3RJ5A 4ALLA 3H9EO 1GEEA 1U3VA 2QW8A 5HWSA 2GN4A 2VZ0A 1DDOA 3H7AA 2EF1A 1Y9AA 3HG7A 4RVSA 1XDWA 3INRA 4CJXA 4ZQFA 4ZJUA 2Y0EA 1YBAA 4I8XA 5DF1A 1GQ2A 4PG7A 2I99A 2EHDA 2O3JA 2IZ1A 1WZIA 4M1QA 1P1IA 3I5MA 3PWSA 4L4SA 3ITDA 1YB1A 5B4VA 5EMHA 3FNEA 3GAFA 1ZNQO 1GZ3A 4MP6A 4AJ1A 3UW3A 4CMCA 1UJMA 1ZVMA 2CDCA 4CMIA 4FW8A 5T57A 1HDCA 4IS3A 2X58A 1B7GO 1Q7BA 2ZYGA 4I5FA 2Y68A 4UUMA 3PFWO 2BI7A 3KUXA 1D1TA 2G17A 1YDWA 4DC0A 2B4TO 2ZTMA 3GZNB 5TRTA 2ZCUA 1JU9A 5L51A 1E7RA 3KXDA 4DLAA 3PFFA 3ZHYA 4EUHA 3SJUA 3VKVA 2CFCA 3UCXA 3DBRA 3LU1A 3QVSA 5A05A 2NVUA 3ZN2A 2YY7A 1J49A 1MA0A 1I3KA 3QA9A 3SJ7A 3Q11A 3WGGA 2EG9A 4IDDA 4B4WA 4BNUA 4K26A 4WLEA 3GG2A 3D3WA 4DYVA 4AJKA 2JD2A 4NU5A 4BO3A 3PEFA 4FOOA 3R0IA 4PZCA 4NH4A 4JJIA 4ALNA 3BIOA 3N7UA 4LGVA 4ZQGA 4RGBA 4MVJI 1LDNA 3ZV4A 4YT2A 1AUPA 3DZFA 2FPIA 5THKA 5IDWA 2HK9A 1E1KA 1U8XX 8ADHA 3F4BA 3NJ8A 3GN1A 1ISJA 1IHXA 4IINA 5I8ZA 3S55A 2Y67A 3HE3A 5BSEA 1NPDA 3OIFA 4FDAA 1NYTA 3BMCA 2PNFA 4QT0A 3RU9A 2NADA 1E5QA 1UAGA 1O0SA 1PJTA 2XPCA 4Y6RA 3W6ZA 4FIZA 1QSGA 4PRLA 2D5AA 2VOEA 4WCDA 3TSCA 1XWFA 3LF2A 4LSMA 5CFZA 2JCVA 1LI4A 1EMDA 1ZFNA 4MVJP 2I3GA 5G4LA 1UDBA 3BHMA 3GG9A 1I0ZA 5DN9A 1W6UA 3DDNA 4N18A 4TROA 1WLYA 3GVXA 4Q3BA 3RAJA 5JYEA 2Y1GA 2O3SA 1LLCA 1JKFA 1M66A 1VL6A 1YGYA 1FDTA 3AY7A 3I4CA 4J90A 5CEJA 1X1EA 1XA0A 7MDHA 4BO2A 3IL2A 1U5AA 1F12A 2IZ0A 3EDMA 3O26A 1QKIA 3HDQA 3PJEA 4CMIB 3WNQA 1PS8A 3C1AA 4CMHA 2VOJA 2B0JA 1I3NA 4A7PA 3KV3O 3LDHA 5BT9A 4F46A 4XYMA 4Q3DA 5TNXA 1FDUA 1NBOA 4DUPA 3WQQA 2O4CA 1WMAA 5ILGA 3MOGA 3RASA 1H93A 3JQ7A 1T4DA 1T1RA 4YAEA 1QLHA 4OMUA 3JD2A 1YQDA 3HADA 1K0UA 1UZNA 3V5NA 3GH3A 1JKJA 3K2EA 4YJHB 5U4QA 2E37A 5HRUA 3FBTA 3PZBA 1FK8A 3GA0A 4II2A 2Q1TA 1E7WA 1EQUA 2X23A 4U6SA 2JAPA 4NFYA 3T4EA 1R15A 4YCAA 5KJEA 3FR8A 2X9GA 4OSOA 4LVCA 3CPSA 1CERA 3CIFA 1PJCA 2FOIA 3DBLB 4CLEA 5L7TA 3GVHA 5CDGA 4E33A 3OEWA 3QIVA 1X7HA 1N7HA 5AOVA 4J2HA 3TOZA 2O3QA 1A72A 1MFZA 1AHIA 4IDGA 1Y8RA 3GC6A 3ZNQA 4Z3KA 5TIIA 4B3HA 2JFFA 4BMVA 3VTZA 1T2CA 1VJ0A 3RVDA 4J43A 3VZPA 4F6LA 1NPTO 1ZSNA 4AJJA 2ZQZA 1BSVA 3L4BA 1KYQA 2ZATA 1LSSA 4IUYA 4XDYA 3HZZA 2OP1A 4RQTA 1PEDA 3RIHA 2GCGA 1WXDA 3QVTA 1CQIA 1O5IA 1EBFA 3DHEA 4NFSA 3D5TA 4J2OA 3VVCA 5BR7A 2IEBA 3W4IA 3GGGA 2VN8A 3LC1O 3RUFA 1LRLA 3R1IA 2C59A 3AU8A 5A9TA 4L74A 4CLRB 3GAZA 5HM8A 3LT2A 2Y1OA 3DONA 4NMHA 4PG6A 4RPHA 4OXYA 1B14A 3INTA 3CZMA 2FP4A 1K3TA 1AXEA 3MTJA 1RM5A 4FGWA 4IJKA 3V1TC 5IDYA 3WGQA 3VC7A 4DYDA 3G79A 4WUVA 3TWOA 3UCFA 4CV1A 4LK3A 1E0DA 3FCOA 1W4ZA 5KOIA 3K8ZA 4R9RA 5IDXA 3F9IA 3L6OO 3C24A 4XZ3A 1EUCA 4OAQA 3LF1A 3KTDA 3DOCA 2J5RA 2HDHA 3IJPA 5L53A 4GI2A 1XGKA 5CDSA 3K73O 3OH8A 3VPFA 1DBVO 5JAZA 5T5QA 4MKZA 3QVOA 3E5RA 4LMPA 1YJQA 2GO1A 3BMQB 4FC6A 4MOWA 3AJRA 2AEMA 1JAXA 4N5LA 4BB5A 5GZ1A 5FYDA 4TSKA 3L9XA 2CF6A 5HS6A 1KBZA 3Q2IA 3ZW8A 1GYQA 4XRGA 3BMNA 1KOLA 2GF2A 2PZJA 4A2CA 1P0FA 2Q50A 4HUJA 1PX0A 4ILKA 4DTIA 5CG2A 5DZSA 5KKCA 3OEYA 4YT5A 3JQ7B 5LDGA 4DMLA 1NAHA 4BIIA 3I9MA 4OH1A 4Q39A 5BNFA 1BG6A 4QTZA 1YWGO 1ZK2A 4E2WA 4D0RA 1VM6A 2QRLA 3WIDA 4E32A 3R6DA 2PD3A 3PGXA 1YDEA 1E3WB 4HV4A 4D0SA 1NR1A 2JAHA 4NNJA 1QLJA 1NR7A 3PRJA 3FPCA 2P4QA 3WIEA 1U2DA 2OL4A 2P5UA 4TMFA 3V1UA 4RDIA 3LT4A 5IF3A 3A4VA 4IGFA 2PD6A 2D1YA 1GD1O 3G1TA 3WMWA 4PG4A 1Y8RB 4WGGA 3R3JA 4OQYA 3U4IA 4MP3A 5EL0A 5KTKA 2YHIA 3L6DA 2XAAA 1Y9EA 1NQAO 1ZK3A 3D64A 3JSAA 1AE1A 1ENZA 1UXIA 2C07A 1JTVA 1NQ5A 4J7UA 4XYGA 1ISFA 3RUIA 1T24A 3JD0A 4MVJF 1TA4A 1CDOA 3TZ6A 2OOSA 4GL4A 3F1LA 2NU7A 3B70A 4DQUA 4JNKA 4ZGWA 2OBYA 3U9LA 4YXFA 2OORA 2ZYAA 4G5HA 2ZB4A 1BMDA 4E21A 3F6YA 1MXFA 4NI5A 3UKOA 4ZRMA 2ZKLA 4UEJA 1MX3A 4KUEA 3IUPA 3KEQA 5KVQA 1MLDA 4WEOA 5KWEA 4YT4A 1PZGA 1XQ6A 3ZDFA 1A27A 4B7XA 3HWRA 1SMKA 2Q2WA 5C3MA 2Y66A 1OZAA 3H3JA 2DM6A 5G0SA 1I3MA 3RFXA 1HF3A 1GL3A 2A9FA 3PQFA 3OA0A 4OHUA 2X4GA 4MVJM 3ZGYA 1EVJA 4PLCA 2YYYA 3GN2A 1BW9A 4G65A 2CDBA 1GPJA 4MDHA 4XQ9A 1QXSA 1U2GA 2V6GA 3WGIA 3PK0A 3P5SA 4PVDA 4WCFB 1TEHA 2Q45A 4GX0A 1N1EA 2EEZA 3OIDA 1XSEA 3BMNB 3OF2A 1VI2A 2E49A 3B20A 3GRPA 4KMSA 5JDCC 2JD1A 3WYCA 1Y81A 1P1RA 2JHGA 4I08A 1N1GA 2AEFA 1DC4A 2HAEA 4XB2A 2O48X 2PGDA 3C7DB 3LK7A 1ZMOA 4HY3A 5A06A 1YL6A 3PJDA 3O8QA 3VKUA 3UHAA 3UXYA 3PHHA 5BQFA 1DFIA 3M6IA 4XYEA 2CY0A 4QO7A 4FCCA 2B37A 3F1KA 5IFLA 2I6TA 4UAGA 3FRJA 1ENPA 1GCOA 4AJLA 1ZK1A 4K9DA 1XLTA 2PA3A 2YJZA 2FSVA 2D5CA 3D7LA 2GNAA 1IZ0A 4BV9A 4BNHA 4DMMA 4J9UE 2PZLA 5CEEA 3NAQA 5JS6A 1SEPA 3ETGA 3V2HA 2WJPA 2X0JA 1T2DA 4YQZA 1R6DA 1YKFA 4TRJA 4UVGA 1YB4A 1NHGA 2ZIZA 3RROA 4GX2A 2NV6A 3EHEA 3MTGA 2D2IA 2H9IA 3CKYA 4ND3A 4ZD6A 3V2GA 3WNVA 4PLVA 3U4DA 5JW6A 3NDRA 3CEAA 1DRWA 2D8AA 3G1UA 4TRNA 3AUUA 1E3JA 2QZ9A 4INAA 4PIVA 3BYZA 4ZA2A 1F0YA 3FSRA 1A7KA 3KZVA 1KERA 3AI3A 3DQPA 2GN6A 3FR7A 4PFJA 3Q9UA 4C7JA 3IAHA 1HL3A 5KCZA 3JYQA 2Y0DA 4CR6A 3ZU5A 3WSWA 4MIEA 4GKBA 4W7HA 4F6CA 1UXJA 4YJFB 5TQVA 3AOGA 3I4FA 5ER9A 3ZHBA 4W4TA 4YA6A 3UGKA 4O0LA 1ZO8A 2DFDA 4TRMA 3TJRA 2V6BA 4EJ6A 5AXAA 1JDJA 1UR5A 4U0KA 2X0RA 1GPDG 1R66A 3FPLA 5JAMA 1ARZA 1BW9B 4BV8A 3LT1A 4IBOA 3HDYA 2B83A 2BRUA 1F14A 1RM3A 4EUFA 1ZJZA 3NGLA 2YQ4A 4TVOA 3WICA 4DPKA 5EJ2A 2RHCA 4J7CA 4RO0A 3KYBA 5FF9A 2RAFA 3VZSA 3DAGA 4J1TA 2RIRA 2WM3A 1H0KA 1GFSA 3H9QA 4FQ8A 1U7HA 4IDBA 2A94A 3O8QB 4P4NA 2AW5A 5EIOA 4R1UA 3OQ1A 4NBRA 4CV2A 4CQMA 1B3RA 3T7CA 2O50A 3H9JA 3EK2A 2NQTA 2VRCA 1LBEA 1NHWA 5HTOA 2C0CA 1RJWA 1SO8A 1NFFA 2X86A 1WZEA 2WD8A 3JQ8A 4ND5A 4NK5A 1E7QA 1DFGA 3M1LA 2OBNA 1JA9A 3ETEA 4Z0PA 3UUWA 3DOOA 3VVBA 1LDEA 1Q7GA 3I9KA 3FBGA 1N92A 5EQDA 1HDZA 1N8KA 4J1NA 4AJIA 3GY0A 1ZKMA 4IDAA 1HLPA 2EV9A 2Y1EA 4UUPA 5THQA 1TVEA 1AHHA 3U09A 1OOEA 5ADHA 4JP2A 2Q99A 1G0OA 1LLUA 2VWHA 3PYLA 4OGWA 4OSPA 5HA5A 3RU7A 5B1YA 4I5DA 4A03A 4CM3A 4BNMA 4D41A 2PFGA 1Q0QA 4PLYA 4I5EA 2NU9A 2CF5A 2G76A 1LRKA 1WVGA 2YDXA 3DHYA 4EJ0A 1H6CA 1IB6A 1N9GB 2X5KO 4WLFA 3DWFA 2E48A 4CODB 5ENVA 4BO1A 1P1KA 3PHIA 1HDXA 2NTNA 4WLVA 2QRJA 1UH5A 2WE8A 3QVXA 4GX1A 4IMPA 3ITKA 4LVUA 2WD7A 4Y6SA 3STHA 2H5LA 3JQFA 1J6UA 1Z7BA 3WLFA 4IPTA 3AM5A 4P22A 1C0PA 3NDJA 2Y05A 2J5KA 2DQ4A 3ZWWA 4CQLA 5B4UA 2HK8A 3B1KA 3OSUA 4ZHSA 2QYSA 4FSHA 1EBUA 3JQAA 3SLKA 4EEZA 4XGNA 2WTBA 4YEDA 1Y5MA 2NVBA 3D4OA 2HRBA 1YL7A 4RVGA 4XYLA 3ROMA 3ZWPA 3OBBA 2UAGA 1BXKA 3FWZA 3INGA 3IUSA 3ZW9A 5IXSA 3QRWA 2UUPA 3K2BA 5EINA 3WGHA 1PU2A 3RUDA 1V35A 1P3DA 2BHLA 3EYWA 1OC4A 2OFPA 2VHVA 3QWIA 4XB1A 2RHRA 4RCVA 3OP4A 1EVIA 4MVJA 1HYHA 5JXWA 2AG8A 2NACA 1LEHA 5B4TA 5I9LA 3LLVA 4ALIA 2PK3A 1PS9A 1EQ2A 3NKLA 3SC6A 2BFOA 5H81A 1ZXBA 2GSDA 5TS3A 2E6UX 1NVTA 1P1FA 1P1JA 4Z9YA 3WQSB 1BVUA 4J0FA 3OECA 1H6DA 5EN4A 1IHYA 2DBRA 3DZGA 2PZMA 1YQGA 5ES3A 4PG8A 3JYNA 2DPGA 2H63A 3X2EA 3HB4X 1X1TA 3TRIA 4LISA 3L4SO 1P33A 4DIOA 3NT2A 3HQ4O 1GDHA 4NBVA 3ZV6A 3ROKA 5L9AA 3QJ5A 2J5QA 1KVQA 2I76A 5G2OA 2AQ8A 1XR3A 3L4BC 3OETA 4AJHA 2X7HA 3JD3A 1I30A 1PL7A 4RPJA 2IDZA 3M1AA 3S2FA 3QQPA 3MOIA 1RM4A 2FZEA 3JQ8B 4RPLA 5A03A 4B3IA 3WGZA 3PQEA 4R5HA 4R3NA 5L40A 3OQBA 3WB9A 4NPCA 2HMWA 5EESA 4MKXA 2CDAA 2DTXA 1ID1A 4L4RA 3QW2A 2BMAA 1WDKA 2QQ5A 1VKOA 4HNHA 3BHIA 3GNSA 4JXKA 2VWGA 3JQ6A 4B7CA 4FJ1A 3ULKA 2BI8A 3BMOA 9LDTA 1FDSA 1LC0A 3PJGA 5JAIA 2EW2A 4FR5A 4L75A 4QFDA 5L3ZA 5BNTA 1B2LA 3ZI0A 1K89A 2BD0A 3DXFA 4YB8A 5H82A 4RDHA 2AEJA 4KTTE 4L8VA 4XIJA 1CJCA 1HTBA 5K0ZA 2JJYA 4IXWA 4PLWA 4P38A 1ZCJA 2ZB3A 4KDFA 5G0VA 5JCJA 1IZ9A 4RF4A 4Y98A 1HEUA 1I2BA 3VPXA 3WX0A 1BWSA 4EUEA 1QR6A 1HE2A 1F8GA 5IN5A 4BKQA 2AHRA 5JE8A 1K6JA 4NG5A 2PY6A 4DPMA 5K6AA 3OICA 1WMBA 3DBHA 5I8WA 2VHXA 2NM0A 3GPIA 3PQDA 4DIBA 5MGBA 1HXHA 4D45A 2WD7B 1WP4A 5I9NA 4D3FA 2C7VA 2IXBA 1XU9A 1I01A 4CMEC 2C20A 3ANMA 1W0CA 1NFRA 3JQ9C 4CM4B 4E5MA 4OXKA 5F1OA 1JN0A 4WCFC 2V6FA 1DB3A 1E1NA 2TMGA 4DBVO 1ORRA 3OM9A 4K1LA 2JD0A 3FTPA 4XJTA 5EQFA 4BHTA 4XYBA 3GPDG 2UYYA 3GRKA 1PJ2A 2EGGA 3H4VA 1NTOA 4B4OA 1XELA 3CE6A 3GUYA 1I3LA 1R37A 2ZTUA 3AI2A 4I1IA 5ENDA 3EAGA 5F21A 2I67A 5L4NA 1UXHA 3UF0A 5TJ9A 3B1FA 1IY8A 2JFHA 5TSDA 1I5RA 4OO3A 4P8RA 4TZTA 1NNUA 3AU9A 3T4XA 3AFMA 4ESOA 4XQEA 5CDUA 3K6JA 4DVJA 4CM8B 3S2EA 4PLHA 3JTMA 4Z0TA 5C37A 1R4NA 2GZ1A 2OP0A 3WR5A 4JROA 2B69A 3WLEA 4AJ4A 1GAEO 4DLLA 5FEUA 2JHFA 3SVTA 2RCYA 4AVYA 1U4SA 1JW9B 3K30A 3ST7A 3RFTA 3GOHA 3GF4A 5JO0A 3G49A 3I6QA 2PV7A 3DAPA 1G1AA 3WWYA 2ET6A 1KC1A 2W2LD 1V3UA 2VHWA 4TQGA 2X9NA 2YUTA 4EW6A 1XCBA 4IGEA 1H9AA 3DMTA 3ZWOA 4Q3NA 3ENNA 4OOFA 1IULA 3ETDA 5C7OO 2BGKA 1ENOA 1HDOA 3AM3A 4QECA 4NHEA 3ZU3A 5L95A 1Z73A 3Q9NA 4PN3A 4CUZA 1G6KA 3BA1A 3EY4A 1KS9A 3BMOB 3VH4A 1T26A 4XKJA 4A10A 4E12A 2VYND 1MGOA 3WTCA 4A0SA 1GU7A 1O89A 1EVZA 1U3UA 3EMKA 1VPDA 3WQRA 4AFNA 5K9ZA 4W82A 5B37A 2IYPA 1O6ZA 2VQ3A 5GZ3A 3FF4A 3GHYA 2VYVA 1ISMA 3ON5A 4BO6A 5COQA 3TF5A 3ANLA 4K28A 5FWNA 1QV7A 4J3FA 3GDOA 3DBRB 4H3VA 3I83A 3DBHB 4J1QA 4XD2A 2ZJ0A 3MJ4A 4IDFA 2NVUB 5KVSA 2I5PO 4I9HA 1YXMA 4BGEA 2IRWA 3AOEA 2EKLA 4UULA 1PWXA 4DLBA 5LC1A 3QVWA 4E6PA 3D3WB 2V6MA 4ID9A 3PYMA 3IMFA 1EK5A 3HN2A 4D42A 1YRLA 4BL5A 4PZDA 1F17A 4UVIA 1ZW1A 2EKQA 1YE3A 3I9NA 4W9NA 1HRDA 1U28A 1K6XA 4I9UA 5G0TA 2HMSA 1OAAA 4E5NA 4E5PA 1I24A 4R01A 3LT0A 2Q3EA 4M49A 1H9BA 1T25A 1U3WA 2C2YA 1C1DA 3Q0EA 3PDJA 3JQDA 1C3VA 1DSSG 3C85A 3RUCA 1YOVA 3UN1A 4Z6KA 1U4OA 1Y8QA 3OA2A 3UOGA 4YJGA 4M55A 5TGDA 2DVMA 3KSUA 3SX2A 4BNTA 4BVAA 1T1SA 4HNGA 1EUZA 2DC1A 2ZJ1A 3NV9A 2NVWA 3H5NA 1EE9A 2NSDA 4UEKA 3ADOA 4DRYA 2VZ9A 1W73A 3D5QA 3GLQA 1B0AA 3BMCB 4RQUA 2XXBA 5DOZA 2VHZA 1P44A 5T6BA 1FXSA 3AFNA 3E9MA 3KEOA 4MO2A 2G5CA 5C7LO 2FR0A 1HT0A 1MB4A 1X7DA 2EJWA 3VZQA 4JGBA 3IKTA 3R3SA 4BNXA 1CIVA 1I10A 1I32A 1QRRA 5DT9A 3O9ZA 2FRDA 2PR2A 5ICSA 4HFMA 3ZV5A 1E7YA 5DBIA 3N58A 1U1IA 2LDXA 4TRRA 4QUKA 4CMGA 3P19A 1N2SA 4U0JA 3GEDA 3DOJA 3WG9A 3TZKA 1PL6A 3VDRA 1BDBA 3ONEA 3QHAA 5I7VA 2CVZA 2P9CA 1H2HA 1ZH8A 3MEQA 1O9BA 4BKRA 2IODA 3AI1A 3I23A 3EZYA 4J1SA 3TDKA 4RZIA 4Z0HO 2VUUA 5B12A 3IS3A 1XHLA 3PTZA 4GWKA 5JLAA 1OFGA 3CMCO 1J4AA 1HE5A 3KO8A 1SCUA 5BNIA 5CEFA 1UP6A 4HKTA 4BKOA 3S1LA 2O3UA 2Y0CA 1DXYA 4I5GA 1DAOA 1F8FA 2O3RA 1B8VA 3LZ6A 1TT7A 4GQAA 2EGHA 4Q3AA 1ONPA 2FR1A 1IE3A 1E3IA 2HMUA 4DC1A 1EFLA 3PYXA 3RUEA 2Y93A 4BS9A 4C4OA 1T2FA 3PLRA 1M67A 1IOLA 1HE4A 3GNQA 3KBOA 4HFJA 2VWQA 1TT5A 3LVFO 4J9VA 1WAMA 3DFZA 4FFNA 1OI7A 2O7SA 1NXQA 4BMNA 5AXDA 2AMFA 1KVTA 2E4AA 5T67A 5IG2A 1PJQA 1GZ6A 1GY8A 5JDIA 4RZHA 3OHSX 4BNFA 4R1NA 4CM9A 4CUJA 2XXJA 5ITVA 4CLHA 1XEAA 4WASA 5KKAA 3MJSA 3PIDA 4E2YA 3A14A 3DL2A 4URFA 5C7IO 4W6ZA 3JQBC 1C1DB 3IDSA 4R5MA 4Q3CA 1ADFA 4CR7A 2X5OA 4YTEA 4NJOA 1LU9A 1WNTA 3O03A 1GZ4A 2WSBA 4XRRA 2DUWA 5L7YA 3WBFA 1Y8QB 4U7WA 3PPIA 4IZIA 4YJGB 4CMAA 1DC3A 1X14A 5T8KA 2EKPA 4MPDA 1CRWG 3VH2A 2B35A 2PD4A 1ULUA 1FJHA 2GASA 3TNLA 4D46A 4XR4A 1SOWA 2PZKA 1FF9A 2VUTA 3MZ0A 4PLZA 5JCXA 2Z95A 2Q49A 4DA9A 2BGLA 5A3VA 4Q3EA 3MCVA 4LCJA 4NDNE 2B36A 1PJSA 3ROQA 5LDHA 5JAQA 2Q2QA 3FN4A 1IPFA 1DJNA 1E6UA 2C29D 2PLAA 3ZZNA 1DIHA 5IZCA 3DB2A 1PWZA 3ZU2A 4YACA 1HLDA 2PGLA 1DIRA 3KOUA 3GUCA 4GGOA 2P2SA 1CF2O 2O4UX 3D0OA 3KHUA 2WEKA 4E5YA 4JX8A 1ML3A 4KZPA 5I7EA 2F00A 2IEDA 4PLPA 4GKVA 2Q46A 4P4LA 3WJAA 3GK3A 1BGVA 5JMWA 2BELA 2QIOA 4D7AA 3SEFA 4A27A 3WFIA 1R12A 3QV1A 3PWZA 3W8DA 1X7GA 2GZ3A 4G2NA 4IIVA 2PWZA 3JQFC 3OJEA 2HK7A 1LXCA 3PXXA 1HZJA 3OJOA 4GBJA 4XWYA 1YJ8A 3PI7A 2HSDA 2PH3A 3VPGA 4XEHA 3ENKA 4DWVA 5BSGA 4L76A 3M2TA 4WECA 3U4CA 1K6IA 4CL3A 1QV6A 3I6IA 3KM0A 3WS7A 4A73A 4MVJG 5DP2A 3ZWXA 1EUDA 1MG0A 5KJCA 1JKIA 2X6TA 3FNHA 1GQYA 2V7PA 1DIGA 5L4SA 4D79A 3FD8A 2E82A 4CMKA 5COBA 5DCUA 2EW8A 5A4DA 1PGPA 4GH5A 5MDHA 4WPGA 5F3RA 2B4RO 4B4UA 3RBZA 4B8WA 1V9LA 5GMOA 1RPNA 3OFSA 4Z3DA 3RC7A 2BKAA 2GN9A 1M76A 4JLWA 4GAEA 4XQGA 3QY9A 3AY3A 5L7WA 2UUOA 1ADBA 5DBGA 1J0XO 3C3XA 4FPXA 5CAEA 1U7TA 3RC1A 4ND2A 4DQVA 2GDZA 2W90A 3I9JA 3NYWA 1E7MA 1KVSA 1NVGA 2QX7A 5JO9A 4IDEA 5A9SA 1WW8A 4K6CA 3W6UA 3ABIA 4FC7A 3HNPA 3H5AA 4NK4A 3GHHA 4OL9A 4MVJH 2YHIB 3KYDA 4IQ8A 1ZK0A 1EK6A 1GYPA 1K2WA 3JQCA 3K5PA 4RJTA 4Z9XA 1ZSYA 1VSVA 4WJZA 2DPHA 3GEGA 4PCVA 4TZKA 1UP7A 3Q2KA 3HDHA 4WOKA 2AQKA 3GMDA 4EDFA 5FFFA 3Q1LA 3W8FA 4B7UA 1GV1A 4BNLA 2P4HX 3S2GA 2OZPA 1YVEI 1JVBA 4NQZA 1LSJA 3NRCA 5ICMA 2WDZA 2ZYDA 3GR6A 1GV0A 3UAGA 3NUGA 4YWJA 4ITUA 4F3YA 4LW8A 1AN9A 1Z82A 3P2YA 2VWPA 2Y99A 1W8DA 4S1VA 3GMSA 4JBGA 1EFKA 1B8PA 3L0DA 5AYVA 3HFGA 3IKVA 1VE9A 4GX5A 4IZHA 4HFRA 4YDRA 2DBZA 2AA3A 2VYVD 1E7SA 1PQUA 2VUSA 3G3EA 4JBHA 4OQZA 3NEPX 3WYBA 4GMGA 3OMLA 2F1KA 4LRTB 5KIAA 4OKNA 1E3EA 2GGSA 1Q0HA 3H2ZA 4J4HA 3A9WA 2OUIA 1LA2A 4M8SA 4PLTA 3EVNA 3F46A 1LDBA 4RV9A 5AQ1A 4FN4A 3D3EA 1CQJA 9LDBA 1E1MA 3E6AA 1WDMA 1UZLA 2I9PA 2R00A 3DBVO 4AJOA 3JQGA 1RWBA 5LCXA 4EI2A 1H2BA 1R0LA 4CMJA 4NFHA 4RF2A 2HMVA 3FNFA 1DPGA 3DR3A 1AGNA 3I1JA 1O95A 3ANNA 2PGJA 1I2CA 3KYCA 4RVDA 3ZWAA 1LC3A 1ZMTA 2JL1A 2A92A 4E13A 5KJ1A 3ADPA 1JWAB 1NM5A 1C0KA 4XDZA 3GVPA 2O2YA 1Q1NA 2UV8A 1AXGA 2YW9A 4KQXA 4UUNA 2BFAA 4NJMA 1LX6A 3TN7A 2IE0A 3ZWYA 4PGFA 3DZHA 3IIEA 1E6WA 5CDTA 4YRBA 4IXTA 1EDOA 4KUGA 1P77A 1PL8A 2ZB7A 4E5KA 4NIMA 2FWMX 2I65A 5A9SB 3RCBA 2QHXA 3EGOA 3VOSA 3CXRA 1B15A 3L9WA 2AQHA 1BRMA 2GUGA 5COAA 3KYDB 5KJ6A 4E3ZA 2TMDA 4D3SA 1PJ3A 1YB5A 3SLGA 4W7IA 2YFQA 3DMTC 3UFXA 4M87A 5JY6A 2D3TA 4JK3A 1SNYA 3D4NA 3GNTA 2GN8A 1D3AA 3DMYA 1H6BA 2PKRA 3LQFA 4ZQHA 3ZWMA 4HBGA 4DIFA 4E2XA 2Z5LA 2OHXA 4BNIA 1PQPA 3O4RA 4E4YA 1DOHA 1TB4A 2CVQA 2GERA 5CHEA 3OJLA 1TXGA 2PKQO 1DJQA 2UDPA 3EVTA 3IQDB 4UUOA 2CZCA 4O59O 1CETA 4WLUA 1GTMA 4FJ2A 1EDZA 3WBBA 4EZBA 4XQCA 3MJTA 4BKPA 3A1NA 4R68A 3RI3A 2GD1O 1D4FA 4B4VA 2AQIA 2YV1A 4TWRA 5DCYA 2CMDA 3WGOA 4YYZA 2HMTA 4RLHA 3U3XA 5I7FA 3IP1A 3DHNA 2EP5A 2NLOA 2OGUA 3I9OA 4Y8VA 4IJWA 3VTFA 3H65A 2D0IA 3VZRA 1PGOA 3ZV3A 4AG3A 5F1PA 3E1KA 3O38A 4WK6A 4XR9A 1Y7TA 2DBQA 4BNNA 4BO0A 3ICPA 3IOYA 5JDCA 1UUFA 2VTDA 4YRAA 1ZBQA 3HSKA 4OIMA 1SAYA 2O7QA 1WWKA 1SOVA 4F45A 3I9LA 3ICCA 1NX6A 4R4JA 5G0UA 3RD5A 3BTVA 3ONDA 4MVJE 4GPD1 1OC2A 3DC2A 4CM9D 1D8AA 3KYCB 4HADA 4XGIA 1D7OA 1XYGA 1ONOA 1LQUA 1KY5A 2FPPA 3KSZO 5KVVA 4QO8A 4ZVVA 3F47A 4CQMB 4CV0A 4J16A 1NASA 4CLOA 3ROPA 3TL2A 2B5VA 4RPKA 5EPOA 4WLNA 2G0TA 3WFJA 2X0IA 4BKUA 4MINA 1T2EA 1M2WA 4Z9FA 4ZQBA 2J3IA 1N7GA 3DTYA 4LSWA 1QORA 1O8CA 1JAYA 5F1KA 1HYEA 1LNQA 2AE1A 5IN4A 1PIWA 3PHLA 3TFOA 4Y6PA 4YBZA 4WEQA 3H6KA 2J6IA 4YVFA 1MUUA 1U9JA 4FOSA 1SBYA 1A9ZA 1BHSA 1KETA 4UVHA 1QG6A 1ZEJA 3IP3A 2A4KA 4GWGA 4IMRA 1YONA 3GVIA 4H15A 4CV3A 2GPTA 1ISHA 4FFMA 2YFHA 2B4QA 4YR9A 4QXMA 2DBVO 3TQHA 4EYEA 2WYWA 3DZIA 3ORFA 1KY4A 3FI9A 2QRKA 2DTEA 2YV3A 1JLLA 1ZJYA 3C7CB 4I9NA 2BF7A 3TPCA 4RPGA 1MXHA 4EGFA 5L4LA 1VSUA 1UP4A 4NU6A 4L0QA 2G82A 2JCXA 3S2IA 4GLOA 3LC2O 3ZHZA 3TOXA 4PRKA 4CQLB 4RORA 1CYDA 2GR9A 1A5ZA 1VC2A 4PLGA 3JQAB 4A5OA 8LDHA 3WYEA 3OIGA 1R0SA 4GGPA 3ONFA 4RVFA 4BO8A 3FHLA 2FSSA 1LSOA 1DIAA 2FR8A 3VH3A 1EZ4A 3E82A 2Q1WA 4AL4A 1DO8A 3GGOA 3ZHXA 4YJHA 3VHRA 5DBFA 1NWHA 3B6ZA 2DTDA 1DHRA 4HXYA 5JYDA 3WGTA 1IYZA 3BZUA 3UVEA 1LUAA 5DDIP 2AE2A 4MKRA 5C5IA 3E18A 3OJFA 3V2UA 3DZJA 1MP0A 1VJTA 3RWBA 3DBLA 4MP8A 1GYRA 2OO5A 5TF4A 5IJZA 1HDYA 1PSDA 4GSLA 2UVDA 1M6WA 1P0CA 1V3VA 2VTEA 3LSYA 2ZB8A 5JDIC 4BNWA 4IS2A 4JJFA 4UEOA 3SXPA 4NBUA 2NUAA 4R9SA 3PWKA 5U1PA 4BQRA 3H3FA 3PJFA 3QE3A 4H7PA 4BGUA 1KEPA 4W99A 1BVRA 3B1JA 1KEUA 4PZEA 2BFPA 4CM1A 3CSDA 4XA8A 4N54A 4CLOB 4YJDA 2EP7A 4KUHA 4UREA 3VH1A 3K96A 1Y5RA 4FFLA 5T8KC 2J3JA 2HLPA 2R2GA 1RYEA 1Z6ZA 2FY8A 1UAYA 4RL6A 4CLRA 4LN1A 3RKUA 4NR0A 3ZNOA 5FI5A 5AVOA 4QQRA 1VL0A 4RVUA 2X9VA 3ZWNA 2EIHA 1DC5A 3GZ4A 3EZLA 1NVMB 2HKIA 5G4KA 4R54A 3KLMX 2D4AA 3PHGA 1MC5A 5IZCC 4CLXA 3NT4A 4R1TA 4TKMA 3WXBA 4IQGA 1HDGO 1VRWA 4O5OA 2RBEA 3AUSA 3RJ9A 1P1HA 3RUHA 1EEHA 1LJ8A 3K9QO 4YT8A 3QP9A 2ZTLA 1XU7A 1N5DA 1IL0A 2XF8A 1QYDA 4WNCA 3K31A 3IJRA 1GUZA 3BMQA 3PDUA 3U5TA 3SBOA 3RUAA 1ZZEA 4L4XA 4QFCA 3Q3CA 4MJLA 3CH6A 3GVCA 4RLSA 4PVCA 1UDAA 3W8EA 5JY1A 1E3LA 2BH9A 2I66A 2Y1FA 5DP1A 3NT5A 4CM5A 2Q4BA 3WDSA 1FDWA 3TZQA 4E31A 3MJVA 2ILTA 4BO5A 3V8BA 4BNVA 4C7KA 3OJ0A 2P5YA 4FGSA 1XG5A 1E3WA 4YRDA 1M75A 1V0JA 4LCEA 4J7XA 4ZU3A 1U3TA 4EEXA 1E77A 1DFHA 4JJGA 5U9CA 3UICA 1OMOA 2DFVA 3KLPX 4YAJA 4CQMD 1KC3A 4ZICA 1VJ1A 2VRCD 1Z74A 3C7AA 1R4NB 2HQ1A 1Q2XA 3I3OA 4DL9A 2HJSA 1I33A 2YZ7A 3QLJA 5I9MA 3JV7A 1TI7A 5DCWA 1XKQA 3GFGA 3HHPA 2C82A 1QYWA 2VNAA 1PTJA 1RKXA 2FHSA 2W2KA 2HJRA 3CMMA 4FJ0A 2YQ5A 1LRJA 3NTOA 4JIGA 3C1OA 1B3BA 5A5EA 2X1HA 1SB9A 4ALMA
chains in the Genus database with same CATH superfamily
4DUYB 2YFYA 1C9EA 2AJBA 3BJMA 3FFXA 4N7BA 1COZA 5AKHA 3PKJA 2I34A 4D81A 3NJRA 3K70C 3GFPA 2GPYA 3GLVA 4PXSA 2ECOA 4YP9A 1XXHA 2C99A 3U44B 3I45A 1LVGA 4CPDA 4TWJA 1C14A 1TUBB 3CUEF 1I36A 4RF3A 2OD7A 4D0LB 1ESCA 2M9MA 2WVJA 3A6JA 1CE8A 1QZXA 4J8PA 2PRIA 4UAJA 2BP7B 4EGQA 2VUHB 2Q6VA 2PWBA 3NKVA 1BA3A 1IRXA 4ROSA 1N7IA 1PR3A 4CG0A 2BZ1A 2ZSIA 1XXHE 5F4ZA 2C4NA 1GL7A 3LYAA 4F1KA 5I48A 3VR4H 4DBZA 3HU1A 3U4HA 5IXJA 3CRW1 3NHAA 4WJKB 4C78A 3OQOA 1EFHA 4GR4A 4GMXA 1POWA 3ZCXA 2NIPA 1DLIA 1ZH2A 2I6GA 3EIWA 1OAKA 1C7JA 2WYUA 3H2BA 1GTRA 3AUJB 1XN4A 3QSGA 2X7XA 3U7RA 2O3TA 3H04A 3H2IA 3WYNA 1NYQA 5A0VA 3RYHA 2WSSA 2XADA 3PNSA 1WUTA 3AK4A 1BNCA 1L7DA 2BTQA 4LWQA 1GQSA 4R2XA 3N2LA 5A1TA 3NDIA 5BV2P 3PJRA 3D6MA 3KJZA 1CVLA 4C22A 2OC9A 3ZNNA 4FU0A 3ZCSA 3NC1C 2DQZA 4N3NA 2YDYA 5GINE 4ZYWA 4O1IA 2VCHA 4GXQA 4J4TA 2BT4A 3K1AB 4R1SA 3FG9A 1BXGA 1P4AA 2Q1UA 1PZFA 1K5GA 2EZ8A 3IBSA 1DDIA 1UWLA 4XFJA 2J9RA 1SVOA 2P4EA 1C30B 4JN6B 1XV5A 4JCOA 4ARBA 4JLDA 2V7GA 5E2IA 3H9GA 1DVRA 3TZHA 2YWFA 3DMRA 2ZIUB 3D2LA 2G9RA 4C0XA 3ETCA 4C7XA 2BGWA 4ZYTA 1CJMA 3KDSE 2NNLD 3HN7A 3ZE1B 1FU4A 1JHPA 4RD4A 5T4EA 4RULA 1XTRA 3FWKA 2JKVA 3N3BC 3VAZA 5EJ9A 2G5TA 1U0LA 2BGTA 5CFRA 3L0BA 4MWEA 1TJNA 3ZU4A 3S99A 4MDEA 1L5WA 4GR5A 1QP7A 1SUWA 3LECA 4FFPA 4MUYA 4KOEC 3CINA 1FDVA 1M1NB 1OUMA 3N39C 3Q6IA 3QYAA 4EX7A 3HCEA 5FOTA 5F7XA 3AKYA 1YBVA 3DEYX 3V4VB 4MV8A 3ZX4A 1T0JB 3NI2A 4GKJB 3U60B 5CP8A 1AQYA 2ZG6A 4LYJA 5CCDA 2C7GA 1YOVB 4LMRA 5HKLA 2LNDA 3RBVA 3TGLA 2YVAA 2A9QA 5CA0F 1EE2A 1VLLA 4Z4EA 3UWOA 3NOXA 2OCBA 1U8TA 4MGEA 4I9GA 2Z8XA 1HEIA 1M0WA 4RANA 4FR2A 4WQMA 1QIEA 2O7VA 3P9YA 4XVCA 3VPSA 5HZKA 3HCDA 1OB2A 1J8MF 3JYPA 1IUOA 3SSMA 2Z6UA 3RC9A 5CGQB 1P45A 3VDXA 5SZHB 3W4JA 3GFBA 1HSZA 3Q0IA 2ACKA 1ENYA 1B76A 1ODSA 2C8VA 1UEIA 2XE7A 1XBTA 3GA7A 3LPDA 3PD0A 4LNAA 5CW1A 2XT9A 1IM8A 1KO1A 1Z0UA 4YCSA 2YR0A 4LI0A 3L6CA 3RYIA 2RHMA 4F1JA 1SKAA 2ONYA 1U0NA 1VCNA 1X87A 3TR6A 3VU0A 5JAUA 1XXHB 4Z7NB 4R2HA 1V1RA 4R81A 7REQA 2XTZA 4ENTA 1U99A 2XQIA 4O8CA 1LDGA 3VR5D 4EMUA 1G59A 3Q9LA 2A8YA 1XB2A 1KE1A 4TM8A 4DJ5X 5GV8A 4EYKA 2Z5GA 2G5GX 4R1MA 4YPVA 1AO3A 3BWVA 4F3TA 1BMQA 2AUNA 1DAPA 4DG8A 1RC1A 3AKEA 4R16A 1TCCA 5J2UF 3EIUA 3ND6A 4OF4A 2IS4A 3O3MB 3DXXA 2BR5A 2QZZA 2P9TA 4JQCA 1W9HA 2P2LA 5A7FA 4GE0A 5A02A 1SULA 1W581 5I4BA 5KOHA 3ASUA 2ZQYA 1YB2A 1H94A 4GM4A 3EC7A 1GUFA 2A5GA 1U2ZA 2XD9A 1TC1A 4YJFA 2RH8A 1U02A 3A1DA 4GDMA 4M0LA 3EQ8A 2Q21A 3H8VA 2IBSA 4CXMA 4JUAA 3WAJA 1ZJJA 4MQUA 2HO4A 4KWIA 3FPHA 3JYOA 4YJ3A 1UDCA 2MOKA 5ECDA 1NA5A 4BNDA 5CFLA 1N2CA 3RBXA 2IXTA 1YHYA 4ZYZA 1QIIA 1OT3A 1U8FO 3F3SA 1A76A 4XIYA 3S44A 2M6KA 3VOAA 4IHKA 4EHNA 1NTRA 3BC1A 3FYUB 3LXMA 1YZLA 2JK1A 4YO7A 3U3OA 4ZI3A 3AM4A 1KH2A 3GFTA 4LXXA 1BXGB 1FP4A 2QYTA 1PQWA 2XBUA 2Z8YA 3KUUA 3M70A 5G0WA 5LA6F 1N2CE 1YCHA 4JC0A 4RWZA 4V0QA 4PU0A 2X5JO 4H7DA 1QGAA 1JQEA 3MIIA 2ZIXB 2RKOA 3GFFA 2HDWA 3QI2A 4JQYA 4LBVA 3RIMA 3RUPA 3SC4A 4PYJA 3P2OA 5HF6A 5K6RA 4RVHA 5FCDA 3NIWA 2YJ4A 1MV8A 1AKUA 3HJRA 4AO8A 3E7PA 5GAJA 2X22A 1GGVA 1TC2A 1X80A 2C3PA 2LDBA 3GEEA 4KRXA 1MG5A 5GONF 5DSZA 5H02A 3T34A 4B46A 3LPCA 4E30A 1KIAA 4BX3A 1K98A 3VDQA 4OHBA 3MLAA 4QXQA 4TYMA 5TJHA 1P2GA 4RK6A 5EJAA 4LSZA 1NMEA 2DLDA 3V7UA 1VA4A 2NU8A 3PVZA 4S0ZA 4HYYA 3TVTA 5A5FA 4DF3A 3HKDA 3QU2A 3LXUX 5A4IS 1DXOA 3E27A 2F9MA 2QN6A 3QNWA 4R8VA 4A91A 1Q0LA 1VGQA 2J7PD 2F8LA 4GGMX 1WQ3A 4TV8F 3UTDA 4BMSA 3BHJA 1Y7LA 1Z83A 1VJCA 3MBIA 3U39A 4YROA 3A7EA 2BM0A 2ZCVA 3BAFA 1JS1X 1JG3A 4D43A 2I03A 3LG2A 3LWBA 3UAZA 4I5IA 4YQFA 1PK9A 1FMTA 2G36A 4LNUA 4QARA 5H9WA 3EXG2 1QPZA 4MJ7A 2B6NA 3WO0A 1MNAA 3V1YA 1QU2A 3LXRA 4UVEA 3N5CA 4FBGA 4E4RA 1N6IA 1MRZA 3GDWA 2X6RA 3V9PA 4ZP1A 5BR4A 5I7EA 3CISA 1NVFA 4LYGA 2ZKIA 5HZMA 3IMEA 5KPDA 2JCGA 1QP8A 2PTGA 3L6EA 2H5IA 3MT9A 4L7QA 4Y2XA 7REQB 1V1RB 1WU7A 1U90A 3KU1A 3NHLA 3TLYA 4UJ3A 5DULA 3WGVA 4MEBA 3AETA 3U5ZB 2EF0A 4LRWA 2J0VA 3VBEA 3QYJA 1V5WA 1VL2A 1HQKA 1X7XA 2WWRA 3KRTA 4CF6A 4CLDA 3KQLA 3DOEA 1PJ4A 4JOBA 2JIQA 4LMAA 2IP4A 3KP1A 5E7MA 3T7EA 5K6AC 1A4IA 1K8XB 3GCZA 4P7GA 3FPKA 5ADWA 5KOHB 1V8DA 2I0FA 4F4HA 4LJYA 2V0CA 1A7JA 4D98A 2DETA 2GTHA 5EIAA 2FDCA 1WSWA 2SKEA 4AICA 4I4NA 1UWKA 1TAGA 5CJ2A 1MJGA 1DBWA 2CHQA 4L9WA 3A32A 1E3QA 4QDZA 4UCFA 2R6HA 3KJGA 4BO9A 2CD9A 4ZHQF 3VJMA 3VHQA 2O59A 1LGYA 1ZRSA 4S2EA 4Q9NA 4MYHA 5AKJA 1RI2A 2DPYA 1N2CB 1BE0A 1XLUA 4TQAA 3UCEA 5IZ4A 1KRWA 1NI4A 5E8RA 1UODA 3TRHA 1Z9BA 4GOKA 4O3FA 2PLRA 3UGQA 1YBMA 3I2YX 4RHEA 4QGAA 2AFIA 2GZDA 1W46A 2OXRA 3M9WA 1KQOA 3SXUB 5I4KA 1TMGE 1FP4B 3C5HA 3HRHA 2DWCA 4N7MA 3UXMA 1XA4A 3R5HA 4R9UC 4L73A 2R9VA 5IRCD 3AF4A 2ZSEA 3JU3A 3ZIUA 4C4YA 2JBWA 4GPEA 4CCYA 4DREA 4OB6A 4P98A 1XTSA 4AMVA 5JPCA 2G8NA 5BQXA 3CWZA 3A3NA 1X80B 1XVUA 1L5GB 3OBIA 1L4FA 3Q5DA 2FN3A 4O33A 4P7FA 1MPTA 3IJEB 1OH5A 2AC2A 2R8ZA 5JSZA 3FTNA 1UKCA 2JVJA 5KAMA 3W5CA 3PU6A 3HLTA 4RELA 4UQPA 4L8FA 4F8JA 1A9YA 1XCGB 3FWNA 2NU8B 3ZD6A 2PAAA 1F51E 2PX4A 5K01A 3F5QA 2JASA 3B8EA 1P74A 4BNZA 3W7VA 3VNRA 5FWXB 3ZWBA 2JVKA 5J58A 2ATIA 2F1JA 4PC1A 4MO9A 4D3DA 2B1IA 4Q18A 1HKUA 2JLRA 4PWYA 4KIFA 1GZHB 5E1OA 3HXPA 2NTVA 2QDXA 2Q3DA 3C8DA 3WVNA 3ZOZA 3FPAA 3T7DA 2MDTA 4C05A 2ZT8A 3D3JA 1YBHA 4FMBB 4U3JA 1XYVA 4KQ9A 2WPDA 5HOEA 4Z53A 1M8PA 1Y3FE 1DRUA 2QAGA 5J5VA 1VL8A 2W6ID 2YIVX 4LNUB 1Q1EA 2W2MA 3PSAA 4B80A 4BMOB 3QG5A 4KLRA 1YKSA 1LBSA 4J0JA 4MI1A 4KQFA 1NG1A 4EO9A 1V71A 4O2AF 5EZYA 4C4RA 4S3MA 2UXCB 1SBIA 1ZL2A 3EOZA 5JFTA 5A4AA 4QAQA 5D7NA 3I62A 4YUAA 2EJBA 2XI4A 1JFRA 1YVPA 4R2WA 3EGDA 2CV0A 3R75A 1JWBB 3G0OA 4YQYA 1M6VA 3AHFA 4P3OA 1CVRA 3IC5A 4YIHA 1PBNA 1BTOA 1X7XB 2FWNA 1DI0A 2VZ8A 1S0UA 4F84A 1B4DA 3TNFA 1M2JA 4KK4A 3SHVA 3NBMA 2DR0A 1QRAA 1YQXA 2R85A 2QUAA 4RABA 4C07A 4DR1B 3KXKA 1QG0A 3BGOS 1Q1ZA 4FZ5A 2YUIA 3GGPA 3SX4A 5FL3A 4C4XA 3KB6A 1NY6A 3AOEC 4BEVA 5DN6D 3KUCA 4Q4AA 4EKDA 2I2CA 1IFXA 3ZDBA 4NBWA 2GSWA 1H0RA 1GKLA 1WG8A 2EBWA 4NBTA 1MW9X 4H4CA 1Q0PA 3CH5A 3WMFA 5A6SA 3RABA 5LL6P 5ALYA 2CL6X 2Z43A 4H0FA 2AG5A 5EZ5A 5E6UA 3AERA 2G1UA 3TSWA 1QYCA 4MS1A 3TZLA 2PUVA 2F9LA 1CTQA 3MCUA 2QV0A 3IB3A 4W9NC 2VRWA 2GH1A 4RTQA 4PC6A 3GJ5A 3K9NA 5C80A 3DB1A 5ER6A 4ZN6A 3DKKA 2H2AA 1UJ5A 3CUWA 3N5KA 4MB0A 4ZVSA 5JVDB 3H8SA 3UHOA 1RPZA 4F72A 2FP3A 3RGGA 2HQRA 1XZHA 3GDFA 3KNZA 2GN0A 3LYLA 4OQNA 4WV3A 3VHXA 1T4CB 2Q0HA 1AS3A 2WAMA 2JFNA 2HBYA 3HDJA 5E9QA 1C9YA 3U3KA 2XMSA 2ZBFA 3QX7A 2W6JD 2HSGA 2F8MA 2JIDA 3ICWA 2POQX 5B2FA 4NJMB 1CWUA 4QSMA 2ZREA 1FDOA 1RBQA 2XAUA 1QO0A 5U4XA 2O1SA 1Z8HA 4WINA 1NDUA 2V98A 2CLEB 4JYAB 1YVUA 1WPXA 2PMEA 2BKXA 2HB6A 5JSZB 3JY6A 1IM2A 2JA1A 3NPMA 2P3SA 4UTPA 3ESCA 5L45A 3GQVA 2DT5A 1JLHA 1TPYA 2CFOA 3LQQA 1HE3A 2VXBA 4JOCA 1TNDA 4G1EB 1UJNA 2HU2A 2CUKA 2VI5A 2XWQA 1NBMD 4OATA 3RJ5A 1A4UA 2OAGA 1L7NA 2WOJA 2PJZA 2GXAA 1U3VA 1VLMA 4J03A 3MUNA 3HTXA 2GN4A 5JAZA 2VZ0A 3ZK9A 3G9QA 2NT3A 1FW6A 1Y9AA 5LYJF 4BFSA 3KIPA 4ZQFA 1OHHA 3RF6A 5NULA 3U31A 4ZJUA 2Y0EA 4I8XA 4U3JB 1RAIA 1Q0ZA 3FUWA 1XTQA 4QUIA 3ZH9B 3YASA 3ZTTA 3SNHA 3N8GA 2EHDA 2O3JA 5FJJA 2IZ1A 3L0OA 2QAGB 4M1QA 3LHDA 4AY2A 3NWBA 4PINA 2CUTA 2C0PA 3FNEA 3GAFA 4LF9B 1G6OA 1ZNQO 1VLQA 1XNHA 5CJJA 4CMCA 4MYCA 2C77A 4ARCA 1DG1G 1UJMA 4Q7EA 1NDHA 1ZAKA 3BKWA 4CMIA 2PX8A 4Y2RA 4AKEA 3O1HB 1NZJA 2JJ2A 1E6LA 4BGDA 2Y68A 2HHHB 2PLFA 2R751 3G2QA 3TMAA 4D4LA 3KUXA 4JR2A 5C5DA 3TJZA 4DC0A 1VMDA 2VSFA 2AUTA 5TRTA 1M6VB 2QA5A 1V4VA 2ZIGA 4N1AA 4E5UA 1E7RA 4LDJA 3ROEA 4B82A 4DLAA 1DZIA 4OJQA 2B2NA 2JBAB 3PDCA 2E1RA 4U9HS 2PXHA 3UCXA 1QGYA 2A0KA 5FPPA 3TXXA 1QIDA 3D31A 2C5FA 2EYUA 3LU1A 1ZGZA 2RBGA 3ZN2A 1OH7A 3IIJA 3EFEA 4KHZA 3NCTA 3WLJA 2F43A 1RQGA 4G0ZA 3SJ7A 3VI4B 2RJNA 4QHYA 4PYQA 3LIPA 5FUVA 4B4WA 4QUDA 4BNUA 2WHEA 2WQZA 1PKXA 3QHPA 5IKXA 3L8FA 1EHIA 2C1XA 1JIXA 3CX3A 4JFAA 4Q4AB 3ND8A 2XW6A 4GEKA 2R6FA 3AKCA 5CU7A 3ZDRA 3LVQE 3UPUA 1RYZA 3TLBA 3STWA 1R0RE 5A6SB 2D2XA 1R0YA 1BX3A 1O5TA 2FUCA 1G55A 3R5KA 4NH4A 3LCCA 4ALNA 1Q0RA 4DG9A 3N7UA 1MQ9A 3OM1A 3AERB 3LKVA 4LGVA 5E6UB 1H1DA 4MS1B 1U7ZA 1IIBA 2YJ6A 3M5PA 2ENUA 4MVJI 1X1QA 4JI3B 4BASA 1AQLA 1PE0A 3BJEA 1LDNA 4FTWA 1U9ZA 3DTNA 3I1IA 3AJ9A 1Y5NA 2WYOA 3F97A 4IMIB 3PVSA 5THKA 1UJ4A 5FBLB 5AI0A 3CFYA 3S8EA 1E1KA 3QITA 3G7UA 5FLEX 1M54A 1P7CA 5K3CA 3VHXB 3GOQA 4DIDA 2BH2A 1YZVA 2JG3A 2LIPA 4YRGA 2E4XA 2BW0A 2NG1A 5C34B 1ISJA 2J4DA 1M2FA 4MR8A 1OLSA 3KB1A 4NSNA 3UKDA 4IINA 4Q15A 4QQFA 4HLDA 5BN5A 5JBQA 1SU7A 4GC9A 3C0KA 2Y6UA 1V6SA 4L9AA 4S1TA 5I9TA 2P65A 5JXHA 2VLBA 3UMVA 3CONA 1U0OC 1OFTA 2MJLA 4HNQA 1TMKA 2ZT6A 3NONA 3GLFA 2KW5A 1NYTA 2HNKA 3R8XA 3BMCA 3OPMA 1RCUA 2CFRA 5ALHA 3SYNA 4QT0A 2NADA 1L2TA 5CURA 3D2CA 3IVRA 4TKVB 1VLJA 3W6ZA 3COPA 5BY2A 1NVXQ 2JEZA 4UXJA 3QOYA 4JJ8A 1SKBA 3EQ6A 3A3KA 4AUEA 1J0DA 3N53A 5CFZA 4O4LA 1W94A 5ERGB 2I1QA 1AZSC 3IQFA 1EMDA 4MRPA 3S27A 3FZYA 2XEDA 1TO6A 3G8AA 4GMHA 5G4LA 5TPZA 2C7QA 5AJYA 4LHWA 2ZRHA 3E5NA 2VC2B 3PHBE 1SKUA 2RGDA 5GIPE 1QIGA 2Y1GA 1KYXA 1G3UA 2L69A 3HPRA 1JKFA 3LM8A 2YMPA 3A4IA 4LXQA 1W35A 2J48A 1PWYE 1VKZA 2VO1A 1W5FA 4HVLA 3BIFA 1PCXA 2GXUA 2IHTA 1NJSA 1YQWA 2IZ0A 1X86B 1ZGHA 2VXCA 2P6PA 1Z0JA 3HO1A 4XVQA 1WXQA 2RGNC 1F4PA 2GM5A 3UMBA 4BRUA 4CMIB 5ICEA 2I7CA 3AONB 3K6SA 3GLUA 2XCLA 1LZKA 1TJYA 2B0JA 1Z47A 3JS5A 221PA 3NM5A 4XYMA 4Q3DA 5TNXA 4QEKA 1FDUA 1SU6A 2XE6A 1LPNA 2JGNA 4W5NA 2W22A 4CHTA 1ZLYA 1WXEA 1YZNA 3BMXA 3DE6X 4WSOA 4BWVA 1I94B 3R7WA 4OMUA 3UHPA 2WHPB 3WLRA 3PXEA 1OFVA 1KZYC 3HADA 3QZUA 2UUBB 1K0UA 2NPOA 2QZ4A 1FPQA 1Z6AA 3N70A 3V5NA 2F43B 3PHCA 2QQEA 3LKZA 4KE9A 2E37A 3HEAA 1D5CA 4IVRA 5DGXA 2CMGA 4Y9UA 4U6SA 4LHZA 5A5VA 2IH4A 4NFYA 3D3KA 3T4EA 1O95D 1R15A 1VHLA 1WD5A 2QL7A 3EISA 1A77A 4URYR 4UXIA 1PVOA 5BW6B 1AK2A 2ZJYA 4YMIA 4YUYA 2H1WA 4JI6B 3Q41A 1W49A 1XPRA 1JR6A 2HK6A 2R1TA 1A8SA 5AVVA 3GVHA 3DLIA 1A95A 1RJDA 2J67A 3ZVNA 1X7HA 4A0GA 1TM4E 3CO5A 1YR3A 1WXXA 2O3QA 1PK8A 2IX9A 3OP1A 3TMKA 1DJOA 3VFDA 4NENA 4UARA 1I7QB 1R6AA 1RABA 3ZNQA 3G88A 4IOLA 3WK7A 2BJVA 2IXDA 2QL5A 1UIRA 1D6JA 3L04A 1VJ0A 4MKGA 3VZPA 1TF2A 4BRSA 4F6LA 2B2XA 3ED5A 4ARSA 2X4DA 3EQ2A 3F9RA 2AMVA 1KYQA 4FKZA 3PDWA 1EHYA 3AFOA 3G0DA 4RQTA 2GCGA 1CQIA 3AUXA 3I2FA 2EDCA 3EDRA 3D5TA 1XCLA 3VVCA 1GQFA 1D1PA 2VL7A 3H4TA 4K6GA 3QK7A 5AK0A 3E22A 3LC1O 1VI5A 4RFLA 1U2QA 2PUWA 3R1IA 2DY0A 4XUCA 3AU8A 5F64A 2PYZA 1M34E 4MITA 5A9TA 1CUJA 3DLCA 5HM8A 5CLLA 1DT3A 4YPFA 2Y1OA 3DONA 5EIHA 4QYSA 5KYWA 1AV6A 4CWAA 5HCUA 4PG6A 4OXYA 2LPMA 4LKRA 5IMBA 2YXBA 4F93B 2QMQA 3M3PA 1NXTA 3CZMA 3GLHA 4FGWA 1ZD1A 2EC5A 1QONA 1RM5A 1RYNA 3DV0A 3MWFA 3PC8C 3VC7A 3EGVA 4REQA 3IP5A 4F4JA 2BJHA 1ZGAA 3EIFA 4K8RB 3WIUA 4E1BA 4E4TA 4L16A 1W4ZA 2WT4A 1OU4A 1KDZA 2XZOA 5IDXA 2HU8A 6REQB 3HRKA 2ZITA 4XZ3A 3KVYA 3TI7A 4XW2A 4OAQA 5TARA 3LF1A 3KTDA 1OTHA 1UDWA 2J5RA 3IJPA 5L53A 1JJAA 3EVBA 1XAIA 3CF2A 1GRVA 4DCNA 5CDSA 1CZHA 3H84A 1K5PA 1YIAA 3K73O 4JVNA 3VPFA 3G5LA 3E8SA 3E5RA 4FNMA 1YJQA 2RAVA 3J81k 1HO3A 3ER8A 1JXAA 3DP9A 1ND5A 1M6EX 3HLYA 1CJSA 4U2KA 1I7DA 3K6SB 2CF6A 3PC3A 4HTFA 3QPAA 5LMZA 4AQ7A 1ORHA 2ODTX 3I5XA 2QMYA 5TB5A 5FPTA 3V1KA 3SCZA 4H2DA 4RGVA 3ZW8A 5DYYA 4YJ2F 4CCWA 4XRGA 2LRHA 3N2YA 3GO4A 3OZAA 1R27A 4HUJA 3ABZA 4ILKA 3TIGA 3IOBA 4WUTA 2I87A 2JIBA 5KKCA 4YT5A 1IOZA 1UK8A 2YWRA 3GEIA 3TR5A 1NAHA 3DF9A 4IIFA 4M7OA 4BIIA 4LYEA 2ID7A 3CLVA 4DARA 4QTZA 4AROA 3UHFA 4E2WA 3ORQA 4X7BA 3EG9A 1NBHA 1O95C 3NOOA 3OAAA 4NNOA 3ICEA 3HA7A 5KEIA 5TXGA 2CCGA 1JEEA 1DAKA 1YDEA 3L46A 4PE5B 5HVNA 2GK4A 4D0SA 2BKVA 2JAHA 4UUQA 4C2TA 4CGYA 1IDOA 3F8TA 2CMHA 1NR7A 2KBEA 3FPCA 3PRJA 2P4QA 3JR7A 4KAFA 2FB9A 4ZAYA 3TS1A 3WIEA 1P4HA 4D56A 4COKA 1JDPA 3U7IA 1GNQA 3TR0A 2JLXA 1DKLA 4QUEA 1H8ED 3O31A 3UT6A 1BXRA 1SBCA 1PFGA 2Q8NA 1QTNA 2HCJB 2NXJA 3G1TA 3IPAA 4PZ9A 2X0EA 3WMWA 2AV6A 3DZCA 3A4LA 4OXXA 4GPTA 4GOJA 4PAWA 2APJA 4RY8A 2IOYA 5EL0A 5F9HA 1SVWA 4RTKA 2EFDB 3D0KA 5DE3A 2YHIA 2JLCA 4CFYA 1G8YA 2CUZA 3D64A 3Q3IA 5BSVA 1QB7A 3ZHUA 1UXIA 1YDFA 5CLJA 1M34B 3IT0A 3C6MA 1NQ5A 1ONBA 3EVGA 3ADKA 4F96A 2Q5QA 1CQIB 2QGZA 3OZSA 2RH5A 3OEHD 5H68A 1RPTA 2QSUA 4RFVA 4ED9A 1CDOA 2HIHA 1E1DA 1D4ZA 2X2EA 3L7MA 4V1CI 1KZ1A 2NU7A 3B70A 3UWDA 2J4FA 4ZGWA 3KXLA 3CN7A 5F2EA 2OORA 1OIVA 5KYWB 1OJLA 4OJTA 3HCRA 4NZNA 4UEJA 1PEAA 2NU6B 1X74A 2C2ZA 1MLDA 1QPBA 1EFVB 1TEXA 5KVQA 2OTCA 3DV0B 2C88A 3CNNA 3IRVA 2ZI5A 1PZGA 1QOPB 4MTCA 1VPTA 3PVCA 1IONA 1SMKA 3PD1A 4REQB 2F8TA 3BZBA 5BOVA 2MHCA 2JIZA 2AG6A 2VT6A 2HA5A 4K0RA 3IMGA 3EXFA 3DHVA 3CN9A 5IWAB 2W8BA 1XMVA 5G0SA 4GLJA 2R4QA 1RT9A 1I3MA 3RFXA 3DOIA 3E2IA 4RDCA 5B3LA 2ZZKA 5KAPA 2XNDA 3HJHA 1IXZA 2ZSBA 3NC0C 3OA0A 3PQFA 1TM7E 4JMLA 2QIPA 3ZGYA 1EVJA 1FA9A 1HA3A 2D5LA 4IX1A 1GPJA 3M5WA 4X7RA 3B2NA 5B5SA 1QXSA 1V8PA 1YGPA 4AMYA 5J63A 3P5SA 2IL1A 2JLBA 3HXTA 3O7WA 4R0VA 3RTCA 3A6HA 1Z8NA 2FYTA 1DX4A 2PM8A 3KWJA 4B3SB 4UCXA 3RARA 4NOMA 1CUXA 3VYRB 1PHRA 2IHVA 4ECAA 2DMRA 1TKAA 4ZT7A 3WYGA 4B75A 3AKZA 1XSEA 1Z16A 1HMYA 3O3OB 3CGGA 3OF2A 5BYJA 3HP7A 4HS4A 5JDCC 4PF1A 2FZ4A 1PG5A 3QBTA 2YHBA 4L02A 2JHGA 1UQTA 2GILA 1N1GA 2OO7A 3EMDA 2VEOA 4FGLA 4B6JA 3OPQA 2VHEA 1JJFA 3PQ8A 2QN3A 1RRFA 4B9AA 2XCQA 3EZ9A 2NZJA 4HDRA 2QN7A 4RXUA 4TLCA 4C6HA 4QG3A 4MHTA 3FTDA 1XJQA 1YL6A 3TOCA 2I1WA 3VKWA 1JHMA 1N0VC 2IYSA 4HZUA 4UPEA 3T1HB 3HUEA 3RHTA 5B7PA 4XYEA 1N6HA 3H97A 1U8AA 3GUZA 3B53X 1L8LA 2A88A 4R1PA 4KXWA 3WGNA 4ARAA 5JZBA 4FCCA 5E7IA 3FX2A 1W34A 4UDNA 4ZXPA 4UAGA 3FRJA 3N86A 1ENPA 1AS0A 1NBWB 3OLQA 5JD4A 2E55A 2ERXA 2CNDA 2WIBA 2PA3A 2ADOA 2FSVA 2O2ZA 2YJZA 3B3AA 4MQ6A 3SICE 2GNAA 1IZ0A 2A84A 3Q9SA 5ERYA 3SIPA 2GYWA 4J9UE 2GBCA 4U2GA 4BNHA 1QFSA 2AZTA 2PZLA 4FT2A 1MORA 4CG3A 2XRZA 4C3UA 2VP6A 5I47A 2D54A 5HKAA 1U94A 3O4VA 1J33A 3RLIA 4YQZA 2JIPA 3LUAA 5GV7A 3E2MA 1VHJA 1E3DA 5HF5A 3OX1A 2RKWA 3ZGNA 1FNMA 3O4HA 3BFKA 1ZGCA 3SYKA 3DEZA 1UWVA 2UXBB 1MAAA 1WMDA 2BGRA 1IZZA 1OX4A 3FVTA 2EWWA 3AIIA 3EHEA 3MTGA 4QJ4A 3TYXA 2FZKA 2I4MA 2VSQA 4ND3A 2R87A 3FLEA 5E6SA 3U4DA 4B32A 5JQGF 5JW6A 4OP2A 3NDRA 3CEAA 1DRWA 2WZCA 4RKQA 1O08A 4TRNA 4B83A 5E3HA 5BMVF 1SXHA 4PIVA 4R83A 3BYZA 3KKPA 4C5BA 1N2IA 1RQRA 2LIVA 2Y0BA 4RH3A 5GWXA 1JNXX 2E85A 3MOSA 2GN6A 2NU7B 3WZMA 3KKNA 3FR7A 3M6UA 3KXIA 4EY5A 3OPNA 3QOFA 2OBBA 4C7JA 5F3WB 3D0RA 1V2GA 2PT9A 2XDWA 5EEGA 4JYMA 1TLLA 2ZUBA 3CPHA 3ZU5A 1VHWA 2X8WA 3EF3A 4HS9A 4MIEA 3C3YA 4UTZA 2C9DA 5F7JA 5JQWA 4PBRA 5TQVA 5JTUA 3AOGA 2HHJA 2ZRLA 2QX6A 4TLMB 4QPNA 5ER9A 1EH5A 3F7NA 3TIXB 3TLMA 4I1PA 4KKVA 3UOWA 3CLKA 1ZD4A 3EXFB 3UGKA 5LOVF 4B0OA 1VMAA 2WY2D 3AHDA 5AXAA 2AF3C 4WBXC 5FPYA 3TAXA 1G41A 3C1UA 4PPNA 2BGUA 4U0KA 1LVHA 1MVNA 1CP3A 3TTWA 4PO8A 5EP2A 3NC4A 4BV8A 5D6NA 2PGIA 3BN3A 4FDUA 5FR2A 2F3RA 2PFSA 1AURA 1VE7A 1PLLA 4QHSA 5FO0A 3U16A 1CNMA 2K5UA 3P9IA 4JR1A 1CUAA 4YCMA 3I2JA 4JLOA 4QTTB 4KB5A 3SQOA 3ICQB 1Z4NA 2YQ4A 3Q7QA 5SY6A 3DG9A 5EJ2A 3MN1A 1K4KA 4YCJA 4RO0A 1CUVA 1IUPA 3DCNA 3NTLA 3OM8A 3PFGA 3W77A 5CD1A 3U7HB 5FF9A 1A7UA 1ZRHA 2O0KA 3SR4A 1W5AA 3V4FA 3A6GA 4AF7A 4B33A 3C15C 5H59A 2V4MA 5B57C 5BSTA 2H57A 3EXAA 3VZSA 3OZCA 1QTIA 4HDOB 4HDRB 4CE6A 3H9QA 3FYSA 4FQ8A 3T5DA 1CY2A 2JI7A 3OI7A 1O6CA 5LUBA 2A94A 2XZLA 3O0DA 1I9GA 1H2WA 4HZUB 4EWLA 4NBRA 1B3RA 1PD1A 1RQXA 1STOA 1XQVA 4YV7A 1YHNA 2PR7A 2QJTA 4P58A 3ESBA 2FPSA 4BWYA 5HTOA 2C0CA 1SO8A 2X86A 1Y8AA 4HXEB 2QRNA 1Q3TA 2WD8A 1WSDA 1QWOA 3AF1A 4RVNA 3HKEA 1L5MA 5LDDC 4EHBA 2AN4A 4KQJA 5DTQA 3MS4A 3BSSA 3PQ2A 5FTKA 3UUWA 5HUHA 3FOFC 3I9KA 5AJTA 3TDNA 4FFSA 1UBUS 4IDAA 4KGZA 2EV9A 2VQFB 1RXSA 2ANBA 2GX6A 2WJ6A 2AK3A 5ADHA 3H2KA 2Q99A 4OGWA 3MT0A 1XMJA 1OX4B 3ORRA 4NABA 1VBKA 4HX2A 3WLMA 4I5DA 1JG6A 1DTSA 4A03A 1J0AA 1F9AA 3DFIA 1VG8A 5DYGA 1U6JA 5I01A 3BXFA 4EY3A 1Q0QA 1BIFA 1KQ3A 2GTIA 2BZSA 4PLYA 2GOYA 2NU9A 3TLXA 4KGVA 3ZXYA 5KNDD 3DHYA 3DWGA 1C1HA 3DVQX 5HX7A 1H6CA 4S04A 4K0KB 1CU1A 1Z4LA 2A2ZA 2WSSD 2HBZA 1OIWA 3NXKA 4CEJA 1F9EA 2C3YA 4BXOA 3HA2A 2NTNA 2PX2A 2HYDA 2JLWA 1DAHA 1JA1A 2QRJA 2IT1A 3A4NA 1Y1KE 4NU0A 4B71A 2Y4OA 1DL5A 3MUOA 4NXNB 2JZNA 1RCFA 2XZPA 4Y6SA 3ZJYA 5EZ6B 3GIDA 1XYYA 2AVNA 4LZAA 1VPVA 1YASA 1JDSA 1CCWA 1GGNA 3UJNA 3E1GA 4ZVRA 2ZRGA 5SZJA 4A8HA 4CQLA 4WFKA 4BMDA 1O4WA 3LFTA 4MI6A 4TX1A 2QYSA 1OKKD 1R64A 3JQAA 3KS9A 2WBLC 1SK9A 3BWMA 3KYIB 3P0HA 5BV0A 1G8JA 3U37A 2WTBA 1LBHA 4HQRA 2DH5A 2P6OA 3G6KA 3BGVA 1NV8A 1FU7A 4M9CA 1G63A 1XKXA 2OWEA 2HRBA 1AO0A 1DRJA 1L4LA 1PZNA 1GG8A 1QFZA 3FWZA 3IUSA 1E1YA 1MB0A 3GGJA 1JI3A 4US1R 4RK1A 2QDKA 1NOJA 2GQ0A 1EVLA 1V35A 4MLPA 3ET4A 4XB1A 4QDKA 4BBAA 5JTTA 3KL4A 4QNMA 2Z58A 2IU4A 2YC4C 4MVJA 5C1BA 5JXWA 1CIPA 4E5SA 1EZ1A 1SZCA 2P3LA 4C4TA 3LLVA 1BD4A 5FWDA 2PK3A 1PS9A 1QH0A 3EWSA 1EQ2A 4LX0A 3STVA 4NYIQ 1NT2A 4JVSB 1WLSA 5GQSA 2YZKA 5H81A 1ZXBA 3KR0A 2E6UX 1P1JA 1WUHS 3TNJA 1BVUA 2J08A 1QHFA 1MVLA 3DGFC 1B74A 1H6DA 1R5BA 1J2EA 3K0AB 3OECA 2PZMA 3QU5A 5EN4A 3TQTA 4GF5A 5ES3A 4LBWA 1JR3A 1PTJC 3TRIA 3ES9A 2FI1A 1XUOA 3KVVA 4LISA 5FD8A 3AXTA 3A1FA 5K3FA 1AGXA 2UYCA 1HNWB 4FW9A 4NBVA 3T4PA 3ZV6A 2HCFA 2WABA 2J5QA 3ZZMA 3S8YA 3ZVLA 3OETA 8AT1A 2X7HA 2IDZA 3KQNA 4YASA 3S2FA 4URVR 1RQLA 4J6EA 3SYTA 1M0EA 2FZEA 2E18A 4KFTA 4RPLA 5A03A 3PQEA 2BV3A 4R5HA 2EQAA 3S29A 5L40A 3SYMA 1R9GA 3OQBA 2HRRA 2Q5IA 2WJAA 2HMWA 4TKUB 3TNYA 2WDPA 3EXIB 3LZCA 1F1JA 3QW2A 1GILA 2QQ5A 3N1UA 3USCS 1OWLA 4Z4IA 2VCEA 4FR0A 4JNCA 4HRXA 2BI8A 3BMOA 1FDSA 3PJGA 5JAIA 2I2FA 2ZR7A 4QZVA 3LE8A 1I14A 2C84A 4OQMA 1K89A 2WB2A 3SS7X 5IUKC 4KTTE 2OG1A 2YVUA 1CJCA 4L8VA 4M7WA 2YWJA 4IGIA 4KJZA 2RC5A 5K0ZA 5JFGA 1XRPA 1K9SA 4P38A 3IUYA 4Y98A 4G36A 1IEWA 4C7VA 1I2BA 2PS3A 4D99A 3MJFA 1BWSA 3LQRA 1B8OA 2NU9B 3G82C 3WX0A 1QR6A 4EUEA 5IN5A 4BKQA 1JH8A 4CEHA 3QELB 4NG5A 4UW9A 4B81A 4X8LA 4X1OA 4DA6A 5LU8A 4NYJQ 3I5UA 2NO6A 3DBHA 4JI2B 1ESDA 3AHIA 2VHXA 1FFHA 3PQDA 1CR6A 3QE0A 5J2TF 1HXHA 4WKBA 1X9HA 2AN1A 3TQFA 1WP4A 5D3QA 3KQKA 1I01A 4CMEC 4K9MA 3KOZA 1KFCB 1W0CA 4NQRA 4A8JB 4E5MA 5HSGA 1T13A 5H3HA 1Z13A 2JH9A 3M34A 4WZAA 2VIIA 2JHAA 2V6FA 3H42B 4J75A 1DB3A 3P4YA 1QZUA 4P83A 4K7JA 3KPUA 1SHZA 3CNEA 4OQLA 1MZPA 4XYBA 1AUXA 2UYYA 1PSZA 2ZEJA 1O58A 4KNWA 5LWHA 3BD7A 4FGUA 1C9DB 4B4OA 3LI2A 4WZAE 4F6RB 5EXSA 2DECA 2CLFB 1NF9A 4HPWA 1SKMA 3AGPA 2I67A 1HORA 5L4NA 4CKWA 1CKEA 4RMJA 3QX3A 4K2HA 2JFHA 2YYAA 2PXAA 5TV2A 1CF9A 2ZPTX 2MTBA 3HYNA 3KKQA 3PNBA 4BEJA 3H19A 3K4PA 1JFSA 1GOTA 3EDYA 3AFMA 2QE6A 4OK3A 2XRYA 3SMQA 3MWKA 2MSCB 3S2EA 3PC7A 2ZUTA 3EF0A 2BFWA 4LXTA 4KR0A 3JTMA 1I4DD 4IDNA 3DFMA 1Z5NA 4Z0TA 3HJUA 2R25B 2GZ1A 2ODPA 5J2UB 1X3LA 1WB6A 3NALA 4JROA 1UC4B 2OZLA 3WLEA 2P2CA 2QX9A 4RPIA 4AM8A 1P73A 2WWVD 4F9EA 5FTLA 2WFAA 1EFAA 2CLOB 3AHCA 5HQ3B 3QSYA 1ZM3A 4OM7A 1AHNA 2H2DA 1U4SA 3BIXA 5IJAA 4UBLA 2W7TA 4ZIRA 3BZWA 2XNJA 3GOHA 4CG2A 5AJVB 3LCUA 3ROFA 3I6QA 2FAXA 2QUKA 1IVSA 1G1AA 3SWWA 1F7VA 3MFYA 1KC1A 2D1FA 3JYHA 2G4LA 2NYAA 2VHWA 2A0FA 4KE7A 5D84A 4RY2A 4CDRA 1P62B 4EMTA 1KH1A 3M4ZA 1RHUA 3CURA 1H9AA 3L82B 4ARZA 4Q3NA 1T4MA 3ENNA 4XDHA 1IULA 1KYWA 2A5LA 2EKZA 3KLBA 3TD2A 4DILA 5FBVB 4ZO6A 2WMYA 5DBOA 1W36D 1ENOA 4Q4CA 2A1TR 1TK9A 3ZU3A 3Q9NA 3PXBA 3DSRA 1LPMA 2PVPA 5REQA 2W9XA 4MPRA 3UFBA 1G6KA 3L8MA 3EY4A 4FE3A 4L27A 3FW1A 3QKUA 1G66A 121PA 3BMOB 1NXXA 2BBSA 3GEPA 1T26A 4XKJA 1T9GS 2ZJBA 3VNSA 2FQWA 3DPSA 4H0CA 1E1RD 1NKSA 4QTUB 3P4XA 3WTCA 1YJBA 1PRYA 1GU7A 4LJ7A 3QLUA 1TX4B 2K4MA 4M83A 3EMKA 4HNAA 3T3MB 2UZ0A 3SR0A 5A0TA 1B6RA 1C4XA 1DU4A 2HSJA 2JFOA