4AL4A

Rat ldha in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)3-oxo-propyl)carbamoylamino)ethoxy)phenyl)methylpropanedioic acid
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
330
structure length
330
Chain Sequence
ALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords L-LACTATE DEHYDROGENASE A CHAIN
publication title The Design and Synthesis of Novel Lactate Dehydrogenase a Inhibitors by Fragment-Based Lead Generation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 118
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4al4A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4al4A02
4JBGA 5EJ2A 1DIBA 3HDYA 1WPQA 4FGSA 5COQA 1EE9A 1C0LA 3CE6A 2O3TA 4BKOA 4CQMA 4L75A 2VTEA 3RC7A 2CFCA 3QY9A 2AQHA 1I2ZA 1BXGA 1R66A 3INGA 1Q0QA 3JQ9A 2VHZA 5HWSA 4GBJA 1C0KA 5IF3A 3WICA 4QQRA 1T26A 4NR0A 1MV8A 1U3WA 2E49A 4A26A 4GWKA 2AMFA 1MB4A 1Q7GA 2I3GA 1GY8A 3RFTA 1H5QA 2FMUA 3PWZA 1P1IA 3DAFA 4FOSA 4IS2A 4RVDA 2C2XA 2DC1A 2W2KA 4ZA2A 1HF3A 4EEXA 4JNKA 4MVJA 2SCUA 2HMUA 4E5YA 3OA2A 1T2AA 3FNGA 3H9GA 3HDHA 2POQX 4IPTA 1IUKA 2Y93A 3PJDA 4J91A 4DWVA 2Q2QA 2I5PO 3BMOB 3VTFA 3ICPA 4FFMA 3NT5A 1I10A 2G5CA 4CV1A 4J1SA 4HX5A 5EL0A 1KERA 3JYLA 3PJEA 2P5UA 4FDAA 4DTIA 1ONPA 3GVPA 2WTBA 1ISJA 2EJWA 2Y1OA 2X22A 2QG4A 1B14A 1BGVA 4BQRA 1YXMA 3A14A 2B83A 5KVQA 2FPIA 1LQTA 2Q3EA 4XYLA 3S2IA 5CEJA 4IJUA 1QKIA 4YJGB 2VHYA 1PJ3A 3JQAB 4KWHA 1E7WA 4RORA 2EGGA 1PJTA 5I8ZA 3GZNA 4K6FA 2YW9A 3L6EA 1B2LA 1Z74A 4FCCA 2NU8A 2O4UX 4ZJUA 2PZLA 3R3JA 3U3XA 4BO3A 4F6LA 4BO9A 4NNJA 4TVBA 1HZJA 3B1KA 3K9QO 5ITVA 4MVJF 4JX8A 5IDQA 3BMCA 3TPCA 1UP6A 2JD0A 4BNIA 1RYDA 3ETGA 3T4XA 2HMTA 4XB2A 4BB5A 1M76A 5IZCA 3FRJA 1U7TA 3BIOA 1V35A 3AFNA 1PEDA 2WYVA 3TL2A 4XCVA 2VCYA 3ZNPA 1TT5B 4Y6PA 2PK3A 1WDLA 3JD4A 1ONNA 5BT9A 4CM1A 1MG5A 2Y1GA 2Y1EA 4EUEA 2V6BA 1DJQA 1CQJA 2FPGA 4G2NA 2PFGA 1QSGA 2EKPA 2ET6A 1K89A 2J5RA 2O3QA 3NX4A 4Z0TA 4BNNA 1DSSG 2BLLA 5AOVA 2B4TO 5FI5A 1C0IA 2HO5A 3RWBA 1WWKA 3Q2IA 4BL5A 1PR3A 3GUCA 3PP8A 2GGSA 3NT2A 4YCAA 3M1AA 3ZWPA 4BS9A 2GSDA 3FR7A 3NGLA 5KVVA 2CF5A 1GTMA 4OKIA 2AE1A 2D5CA 3G49A 5THQA 1Q1NA 2XPCA 3WB9A 3GNTA 1XIVA 1Z73A 4NK4A 5K6AA 3LLVA 1T2DA 3CZMA 3ZU4A 2W4QA 1V0JA 3VPGA 2DPHA 4J4HA 4E5NA 1S6YA 1UP7A 4BNKA 2GZ1A 1H94A 2QRKA 1XA0A 4OGWA 4IY1A 1RYEA 3DMYA 2NVBA 3L07A 2HDHA 3PLRA 3PWKA 1HDXA 5ER9A 5G4KB 3T7EA 4E2WA 3JD2A 2EEZA 2ZYDA 1UAGA 4WKGA 2VOEA 4UAGA 1JAXA 2AHRA 4ZRNA 4DPKA 3DBLA 4WEOA 4IQ0A 2VYND 4ZGWA 1KIFA 1AUPA 3GVXA 1ZK4A 3E18A 3QVWA 1U4SA 3I9OA 4EJMA 3LC2O 3LQFA 2R00C 2Q46A 2EGHA 5AXAA 4ALLA 1VPDA 3PVZA 1DIHA 2J5KA 1U28A 4PLVA 3GA0A 1KVSA 1YQGA 2NVWA 3WGTA 1JU9A 5THKA 3WGHA 3H3FA 2NU6A 1GQ2A 1T1RA 1ZXBA 4RL6A 4QFDA 5A05A 3ANMA 3O8QA 4NMHA 4XYGA 2JCXA 1E1MA 3BXXA 1KC1A 3FI9A 4WK6A 1HXHA 4R68A 2QQ5A 5B12A 4J7XA 5JAIA 1R0SA 3DFZA 4DYDA 3QWFA 5BSEA 3ETEA 5A02A 3FPCA 2UDPA 2W90A 1N7GA 4IDGA 1ONOA 4BNJA 2GZ2A 1NQOA 1YBAA 5T5QA 1V9LA 2P9CA 2X9GA 2X23A 3CINA 1HYGA 1RM5A 4HV4A 4G65A 3V5NA 3U49A 5HBRA 4G81A 2GDZA 1HYEA 1B7GO 3OMLA 5BNIA 2JCYA 1DIGA 1NAHA 3BHIA 4UEOA 2YQ4A 1UR5A 2PR2A 2ZQZA 4RPJA 3WLEA 3P19A 1QYDA 2A92A 4HFRA 1GV1A 3TL3A 2D3TA 5A1TA 2P4HX 3E9QA 3WTCA 5HRUA 3BTVA 5JNLA 1LDNA 4NBRA 4TKMA 4YJFB 3FBGA 4RZIA 4P8RA 1F8GA 4ROSA 2JHGA 4IBOA 5JLAA 4EJ6A 2B5WA 3I9MA 1IPEA 3EK2A 2GD1O 1T1SA 3JQAA 4OMUA 4YJGA 2FSSA 5B1YA 1LC0A 2GLXA 1ZEJA 1H6DA 3WGIA 2IDZA 2C59A 2WD7B 3AY7A 5COAA 2NU7A 2C20A 2YHIB 4GAEA 4CMEC 3AJRA 4BO4A 3AOEC 1BVUA 4DIBA 3GGOA 4WCFA 3CIFA 2CF6A 2RBEA 4CR8A 1WDKA 3NDJA 2X9NA 4N7RA 4Y9DA 5DCUA 1LEHA 1W0CA 4AJPA 5DZSA 2CSUA 3GFBA 3QV1A 2Y05A 4CQMD 2RIRA 1BDMA 3KBOA 4I5GA 4RF3A 3OFSA 4BV8A 8LDHA 5EN4A 1XDWA 3WBBA 1NWHA 3E48A 4FFRA 1G0NA 3ZH2A 1FDSA 1ENZA 3EMKA 3PXXA 1JVSA 3PWSA 4KMSA 5G2OA 3WQQA 3E5MA 3ZWCA 4ND1A 3PHGA 3D5TA 4RVSA 5G0UA 5TSDA 3VPFA 3DR3A 1WAMA 3QIVA 4OH1A 1M67A 1MG0A 2EG9A 2PGDA 4JJGA 3OQBA 1L7EA 1M6WA 1KEUA 3PJGA 4MVJD 5C7IO 2A94A 1Z45A 1NR7A 4IS3A 2QRJA 4XR9A 3AY3A 3A28A 3W4KA 9LDBA 2DUWA 4I5DA 3OJLA 1XQ1A 5MGBA 1D3AA 1I3NA 4RV9A 1K0UA 1LSSA 2EXXA 5JPIA 1XQ6A 2GN8A 3EGOA 3R1IA 4ND2A 3OBBA 1I2BA 5T8KC 3UFXA 2OORA 4HBGA 3B6ZA 4GX2A 2IZ0A 5EINA 1OAAA 3W4IA 2YV1A 1ZSVA 5H82A 3SEFA 1VRWA 3QA9A 5KIAA 3AM3A 3E9MA 2NTNA 3GK3A 3FPLA 3WNQA 1V3UA 2YDYA 4FFOA 5JFOA 3TNLA 4PLTA 1E3WB 4F46A 3CUKA 4OYRA 2ZTMA 4HADA 4K1LA 3SLKA 4R16A 3UOGA 2NTVA 3ZWYA 5ILOA 1WP4A 5EQDA 3F4BA 2CNBA 3GOHA 4ZVVA 3WGZA 5H83A 2ZCVA 4WLNA 1DHRA 1I33A 1HTBA 2H5LA 2ILTA 1XEAA 3H9EO 4R41A 3ADOA 4XDYA 1I3LA 3JYPA 2W8ZA 3P2OA 4KUGA 1EVZA 1PWZA 4GX5A 8ADHA 1YDEA 4Y8VA 4DIFA 2QRLA 1IZ9A 3LSYA 4ZD6A 1VJ0A 1MA0A 1I2CA 1Q0HA 2CUKA 4QXMA 5BSGA 3PGXA 3DHEA 1M66A 5A3JA 4CM9A 1LSOA 2EF1A 2OBNA 1ADCA 1W6UA 1S7CA 1OFGA 2X6TA 4XQCA 4P4NA 3MZ0A 2X4GA 1GCUA 2Q1UA 1MFZA 4XIJA 4RVFA 5KOIA 4IJWA 3ROKA 4PG6A 4DUPA 4TRJA 2HQ1A 4XKJA 2CMDA 4UVGA 3GEMA 5JAQA 4QO8A 4NBVA 3U4HA 3DBHB 4R1UA 4OQZA 2OZPA 4TZTA 1KY5A 2PZKA 1K2WA 1C1XA 1X0XA 5F1PA 1XKQA 2AG5A 2FHSA 1A9ZA 3Q3CA 4CM5A 4J6FA 4PLYA 4EBFA 2LDBA 4OAQA 4CM3A 3RU9A 5G0SA 4ZQBA 1IL0A 2Q50A 2FR0A 3IUSA 4PRKA 1B8UA 3OICA 4BNYA 3G0OA 2GPTA 4MVJI 2I76A 1HE4A 4K6CA 2IYOA 3F46A 3VDQA 4CR7A 4DBZA 3ON5A 2ZJ0A 1NPTO 2DPGA 3D1LA 2AE2A 3H4VA 4DLLA 3ICCA 4EUFA 5FYDA 3V2HA 3PTZA 4FBGA 4QX6A 1UXHA 3GVCA 1UDAA 4E2ZA 4YB8A 1EUZA 4O59O 5A03A 3PFWO 1E3EA 1P0CA 4UEKA 1JKJA 4NK5A 2YYYA 2QHXA 1CERA 4TVOA 3FCOA 2GUGA 2H63A 3HB4X 4FC7A 5CDUA 5TJ9A 4EYEA 3C8MA 3WOHA 1EQUA 1ZCJA 4R01A 2J3JA 2P91A 3I4FA 1EVIA 1PWXA 1T2FA 3KTDA 3GH3A 4YT8A 1E6WA 5ADHA 2O3RA 4KQWA 1VKNA 4CV0A 4R69A 3IP1A 4NU6A 2DKNA 1QV6A 1QYWA 4A0SA 3LU1A 3GHHA 4FN4A 2DTDA 4MVJP 1P9LA 2FN7A 1UP4A 4R5MA 4WLUA 4D44A 3FN4A 1GZ4A 2PH5A 1E7SA 1P1HA 1YB1A 4MKRA 5LDHA 2RH4A 4Y6SA 1LI4A 2CDCA 4YDRA 1U3TA 3AU9A 4HXYA 5IAAA 2PLAA 1U8FO 2B4RO 4BNHA 5MDHA 3ANLA 2VRCD 2OP0A 1TLTA 3IS3A 3Q2KA 2QZ9A 3VDRA 4IIUA 1PGOA 4C7KA 3CTMA 3FD8A 4GVLA 4PG8A 1TVEA 2DBVO 2VT3A 1X14A 2JD1A 3PHLA 4L4SA 4GLLA 4PFJA 1K3TA 3KRTA 3LT1A 2OL4A 4ZQGA 3ZV5A 1X1EA 4BQPA 2VUSA 4JN6B 1LUAA 4LMPA 1R0LA 1E1KA 3F3SA 4UEJA 4B8ZA 1EBFA 3K73O 2I3AA 3JQAD 4B4VA 4K9DA 1LA2A 3EVNA 4MKXA 4J0FA 4Z9FA 3S2EA 3B1FA 4XX0A 4ZICA 5G0TA 2FR1A 3GN1A 4RF5A 3RC1A 1F8FA 5JS6A 1O0SA 4R54A 4GI2A 3VPSA 1XSEA 4YAIA 3GPIA 4J90A 1O9BA 3FHLA 3NKLA 4J9VA 5CEEA 2JD2A 2AXQA 4PLZA 1U4OA 3JQCA 3H5AA 3DL2A 3D4PA 4WJZA 2AW5A 2EJVA 5DP2A 3GG9A 3K5PA 3I5MA 1NQAO 2JAPA 3HFSA 3AI1A 1HYHA 1LLQA 2VYNA 3F1KA 4EW6A 2UVDA 1NXQA 3F4LA 2NLOA 4DQUA 4A73A 4IDFA 3E8XA 2WD8A 3F47A 4MVJH 3ZHZA 2BF7A 1DBVO 3ZW9A 4TQGA 3NAQA 4S3MA 4LISA 1X7GA 2YJZA 4XYBA 4BNVA 3JQ8A 2GN4A 1Z6ZA 2C7GA 4J1TA 3QSGA 3L6OO 3V1YA 3I1JA 1Z7EA 4FJ0A 3PYMA 3OIFA 1WLYA 3K92A 2D4AA 1ZK2A 3WGOA 4C7JA 3N58A 3ZU5A 4D45A 2GN6A 2B5VA 3AI3A 4EJ0A 4BHTA 3WSWA 2NQTA 1KEVA 3KYDA 4B7CA 4KWIA 2B35A 1ZSYA 3C1TA 1LLCA 3DBHA 2Q1SA 5CG2A 4NFHA 1YJ8A 5TF4A 4CLXA 2J5QA 2X5OA 2Q1WA 3IL2A 2C5AA 3O9ZA 3GUYA 1HDZA 2J6IA 3NUGA 3EC7A 1HSZA 4UVDA 1U3VA 2V7PA 1B26A 1Z82A 3DBVO 3MTJA 4XD2A 4BB6A 4M49A 1M6HA 4CPDA 1GEEA 5KTKA 4LCEA 1N8KA 3L0DA 4CUJA 1NHWA 5T57A 4IGEA 3WWYA 3GR6A 3WBFA 4J4BA 1YB5A 3ST7A 5KJFA 3JQFC 3PHJA 3I3OA 3PI7A 1B15A 1YS4A 2O23A 3DAPA 4E0BA 2Y67A 2HKIA 3RFVA 3AM4A 3A4VA 3U5TA 1N1EA 2V6FA 5EIOA 2JJYA 5DNAA 1H9BA 3G17A 2YY7A 1VL8A 2FZEA 4RVGA 1L7DA 2BH9A 3OH8A 2IZ1A 1PGPA 3QVSA 4CLEA 1ID1A 3N74A 1DFHA 1PS8A 3GRPA 2AA3A 5TT0A 1FMCA 1XU9A 2P4QA 1XWFA 4PLGA 1BSVA 3ENNA 3GT0A 1GPJA 3AUAA 4CM9D 2H9IA 1TB4A 2RHCA 4B3IA 4YT4A 2Q2WA 3GDGA 3EW7A 3WSVA 3HUDA 4M89A 3V2GA 3GC6A 1J5PA 4E2YA 1SB8A 1AE1A 2DM6A 2FR8A 2XXBA 1N9GA 1HSOA 3AUTA 3JQEA 4B3JA 1CIVA 3BYZA 1KVRA 3C3XA 3VH4A 3DBRB 4TZKA 2E37A 4W4TA 9LDTA 1P77A 3RC9A 3VC7A 3EYWA 3JSAA 2DQ4A 3H9JA 3HADA 2Y0EA 2FY8A 1E1LA 3D0OA 4BGIA 4YRAA 1HKUA 4MKZA 4MIOA 1P1FA 2HLPA 4UVIA 3CPSA 4PZEA 5A3VA 3NDRA 2BI8A 3PHHA 3BTOA 1ADBA 1PZHA 3Q1LA 3GMDA 5DOZA 1JLLA 2WEKA 4U8GA 2DLDA 5KJ6A 1QR6A 3ANNA 4GGPA 1EEHA 4J7UA 4NG5A 3FTNA 3VVCA 2EIHA 4W82A 4CMEA 5I9LA 5IZ4A 4LVCA 1H9AA 1ULUA 1JVBA 3M2TA 1SO8A 3NGXA 1JKFA 4IDAA 6ADHA 3RUFA 2O3SA 2OO5A 3RI3A 1VJTA 4B7XA 1DEHA 2O7SA 1Y5RA 4UVHA 4CMBA 4JK3A 3ZZNA 4GL4A 4DREA 1LRKA 3U9LA 1NTOA 3STHA 2CVQA 3VAZA 1MP0A 3AW9A 2GCGA 3ZWAA 4U5QA 3VH3A 2CD9A 3FBTA 3GEDA 4FOOA 1A7KA 1PU2A 1GU7A 1DB3A 1YOVB 3DZIA 3K2EA 4PGFA 1QG6A 3ZWNA 1HDCA 2I6TA 4XYMA 5HS4A 2LDXA 1UJMA 2ZB8A 4YXFA 4FIZA 4E5KA 4E6PA 1HDRA 1Y6JA 3UAGA 2OHXA 5L7TA 2HRZA 3WQSB 2ZYAA 4NZ9A 5DT9A 3TZQA 1AN9A 1W73A 2JFFA 4RZHA 5TJHA 3WJ7A 2Q2VA 3I9KA 3BHJA 5GY7A 1DLJA 1I32A 3QRWA 1GUFA 3ZV3A 3WQRA 3K6JA 2I65A 7MDHA 3L77A 4ID9A 2VT2A 4O1MA 4E2XA 2YZ7A 1PSDA 4Q3AA 3DHNA 4UUOA 4A10A 1PGJA 4PLHA 2ZB3A 5T8KA 1C1DA 3WR5A 1SOWA 4DMMA 3ZW8A 4EEZA 2P9EA 3O03A 4P38A 1IY8A 2HUNA 4TRNA 1UXKA 4YAEA 3MJCA 4ALMA 4GPD1 5JCJD 3JQGA 1VSUA 1BW9B 3RSHA 3I83A 4L0QA 1U9JA 3RAJA 2X0IA 1U7HA 3VTZA 4FJ2A 5JDIC 4RPHA 4RF4A 4WLVA 3G1TA 1Y8RA 2F1KA 3IJPA 1BVRA 1QLHA 3IKVA 3PGJA 1HRDA 4Q3BA 5EMHA 4CJXA 4DQVA 1EZ4A 5IFLA 5KNLA 2IE0A 3OA0A 3HJAA 2JL1A 2YV3A 1BMDA 3KEOA 3QLJA 3RBVA 3IUPA 5CP8A 3OQ1A 4E3ZA 1I36A 1LXCA 4YVFA 3LDHA 1GQYA 3C7CB 4J7CA 4E33A 1KETA 3KV3O 2P2SA 3QVOA 3DZJA 1PX0A 3BMNB 1Y9AA 3ZU2A 4OOFA 5KJCA 3B1JA 3VPXA 3IKTA 4INAA 1VKOA 5L7YA 1HEUA 4JXKA 2PD6A 3C24A 4WNCA 3W4JA 4MP3A 4CL8A 3ASUA 2VWPA 4XQ9A 4WE3A 4A27A 4I9NA 4DL9A 4L8VA 3UUWA 3CXRA 3UN1A 4CM8B 2E82A 4L4XA 1KY4A 2I66A 1Q0LA 4Q9NA 3RUHA 3DZFA 3MWEB 4JP3A 2EKQA 1Y8QB 2JHFA 4BOYA 3TSCA 4GH5A 5A5EA 3IJRA 4IZHA 4LCJA 1QLJA 5BR7A 4ESOA 2GR9A 4L76A 3S2GA 3NJ4A 4HP8A 3DZHA 2NQ8A 1YQDA 1X7HA 3RC2A 3D3EA 5CDSA 1GYPA 4MDHA 5TX7A 4R3WA 4CL3A 3E82A 4DGSA 3GAFA 2YFHA 3X2FA 4B4OA 4GSLA 4BGUA 4WPGA 1O95A 1O6ZA 2BFOA 3WGQA 2WYUA 3DBRA 4YR9A 5IN4A 1DJNA 5EESA 4M8SA 4M54A 1LSJA 5CPBA 3T7CA 3ZDFA 3HDQA 3UF0A 1G0OA 2BMAA 5B4UA 3RJ9A 4N5MA 3DDNA 3JCZA 3VZQA 1YRLA 1CDOA 1K6JA 2VRCA 3F5SA 5CDTA 1LSUA 3D3WB 1E6UA 3R6DA 4YAJA 5CFZA 3OEWA 3WDSA 3BMOA 4BMVA 1A72A 3H3JA 2D0IA 1ISFA 1ISIA 4Y98A 3E9NA 1UH5A 3GLQA 4BNXA 5A9TA 2HU2A 2G82A 1NQ5A 1CQIA 1N92A 3DMTC 3HE3A 2NNLD 4OIMA 3FF4A 1XELA 4NHEA 2HK7A 3A9WA 2ZTLA 1EUDA 1XG5A 4Q3CA 4XGNA 1KOLA 3IP3A 1BXKA 2E6UX 5LCXA 2Y66A 4BNTA 4ZN6A 2PA3A 1ADGA 1SBYA 2D8AA 2Z1NA 2AEFA 1G1AA 3BMQB 5COBA 4BNWA 5JYEA 3IIEA 3V2UA 1LBEA 3FWZA 4FD3A 2C82A 1AHIA 4O63O 1YOVA 1E5QA 3A1NA 2Y1CA 1AHHA 4CMJA 2WE7A 3I9JA 2DT5A 4AJ1A 3UGKA 3VVBA 5JAMA 4PZCA 5BQFA 2VNAA 4YYZA 2WSBA 3VH1A 1ZKMA 1HL3A 4BUCA 3AOGA 3F5QA 3JD3A 3C7AA 4UULA 2DBZA 4IJVA 4RVHA 4ND5A 4TMFA 3PK0A 4AJNA 2DTEA 3TF5A 3I6QA 1TT5A 1CF2O 3LLSA 4LN1A 4U0KA 3NV9A 3JV7A 4WLOA 4F6CA 1NQTA 1A27A 1YJQA 3GFGA 4MO2A 4UUMA 2CVZA 2IEBA 3NT4A 2AQIA 1JKIA 1PGNA 4YJHB 1HDYA 3G3EA 3KXDA 1FJHA 4M55A 4TWRA 1FDTA 4D3FA 3UXYA 1P3DA 3ZWWA 1DC3A 4C4OA 2WYWA 4P4LA 5ICMA 1X1TA 1LRJA 2EW8A 4ILKA 4JLWA 3ZCXA 2ZJ1A 3LT4A 1PJQA 1QORA 4CMHA 4OO3A 2GO1A 3GRKA 3RUEA 2Q1TA 3WJAA 1R4MB 5CDYA 3UVEA 3MJVA 3I6IA 3CKYA 3JQBA 1WDMA 1AGNA 2VWQA 4BO7A 2OFPA 1GCOA 3FNFA 4IDDA 2G1UA 1XYGA 2FSVA 1GFSA 4OJNA 1PR9A 3HWRA 4J3FA 2VTDA 1E6EA 2PKQO 2O48X 1I5RA 5JDCC 1UUFA 4YRBA 1DAPA 4FFLA 4URFA 2EWMA 5G4KA 4Z3KA 2ZIZA 3LVFO 3TZ6A 1TT7A 4CM4B 4NJMB 2VWHA 4WASA 5GZ6A 4A7PA 4IMPA 3RIHA 3ASVA 1A9YA 3H2ZA 5AYVA 1U5AA 2AQ8A 3HZZA 2IEDA 1DC4A 1NP3A 1NVTA 4CR6A 5F1KA 3PYXA 5HS6A 3H9UA 1MUUA 4FJ1A 1VC2A 3RCBA 1GZ3A 4LRSB 4QSMA 3RKRA 1PS0A 1PJ4A 2VHXA 1Y8QA 2Q45A 3K30A 3S1LA 1M2WA 4YJDA 3GGPA 3W8DA 4E5PA 3FR8A 1P45A 3AI2A 3AU8A 3P5SA 4Z0HO 3W8FA 1EFLA 2Z5LA 3E03A 2V6MA 1RM0A 4JGBA 4TSKA 4BO1A 1PL6A 5DN9A 5CG1A 5JE8A 1G6KA 4HFJA 4CLRB 2W2LA 2TMGA 3SC4A 1ISGA 3WX0A 3ZNOA 1J49A 1YBVA 2FRDA 1GEGA 2JKVA 2NVUB 3H9QA 3PZBA 1E7MA 3I23A 3RKUA 1QP8A 2ZB7A 3ZNNA 4CUKA 4AJIA 4N5NA 3MJSA 2DU8A 2Y1DA 5JY1A 3ZWBA 2IXAA 3LT2A 4AJ4A 1NNUA 1Z75A 3L9WA 4D79A 1OC4A 4IJKA 4PLPA 4XRGA 4MIYA 1Z7BA 5DBIA 3D3WA 1YH3A 1ZMOA 2O2SA 2OP1A 3OJ0A 4XYEA 3ZN2A 4CUZA 4KP7A 1NR1A 4FQ8A 1BWSA 1F06A 4KTVE 3Q0EA 5CPFA 3VZPA 4XR4A 4CLOB 3ROPA 3EZLA 1HE2A 4HY3A 4ALIA 3S8MA 3WIDA 3ABIA 3DB2A 3HQ4O 3HG7A 2HMWA 3K31A 5F21A 2VQ3A 4MIEA 1E3JA 3ENKA 4YJFA 1VM6A 3PYLA 2PGLA 2DFDA 4JQCA 1W8DA 2P9GA 1OI7A 1GUYA 3SBOA 1SOVA 2Q4BA 3C1AA 1GZ6A 1RKXA 3O26A 1GYRA 3W6ZA 1LTHR 1R15A 2WD7A 3DONA 1M75A 1YL6A 2YHIA 4L73A 3AY6A 3WYBA 3WYCA 2BGLA 3DZGA 4XZ3A 1E92A 4ZQFA 4DXHA 2PD3A 4O6VA 1W4ZA 3PQFA 4AJ2A 2AG8A 1OC2A 2C07A 1QMGA 1IOLA 1Y9EA 2WMDA 3RU7A 4QEDA 4CMAA 5I7SA 4LK3A 3CEAA 2I9PA 3JTMA 1T2EA 2EERA 3DZKA 5JW6A 3SXPA 5IXSA 1C0PA 1SPXA 1XCBA 1ZUD1 3EAGA 3E5RA 5F1OA 4RQTA 1EDZA 2ZTUA 4CQLB 4XQEA 2BGKA 2H6EA 1GAEO 3DOJA 3MTGA 1C3VA 3RD5A 4MPDA 2UYYA 4FW8A 2O3JA 4N18A 4Q3DA 4A2CA 3ONDA 3S2FA 3VZSA 1IZ0A 1LDGA 2Y68A 3GG2A 3UKOA 3UCEA 3DQPA 2DBQA 1IPFA 1IB6A 3RASA 3DXFA 3E6AA 4IINA 3U4IA 2OBYA 2HMSA 4EGFA 5C7OO 5JCJA 4Q3EA 1BXGB 3P7MA 3H2SA 1R16A 5DULA 1FDUA 2IZZA 3WGYA 5L95A 3F1LA 2PV7A 4HKTA 2X0JA 4RVUA 1DFIA 4XQGA 5U9CA 5I7FA 1P0FA 1X0VA 4WNIA 1DAOA 1E77A 2TMDA 1J6UA 4LSWA 1E3WA 2QYTA 1LRLA 3TOZA 3WXBA 2W2KB 3DOOA 2HJRA 1B3RA 2IRWA 3QQPA 3I9NA 3KSDO 2YUTA 5U1PA 3R3SA 4NJMA 3WLFA 4QTZA 3GNSA 3G1UA 3TZHA 5TGDA 4IIVA 4O5OA 4AJEA 5DP1A 2QW8A 4HUJA 2VHWA 1DXYA 1UXIA 2VN8A 4OXNA 2X7HA 2B37A 1HETA 2P68A 4RF2A 4GKVA 3V1UA 5LDGA 3GNQA 3ZGYA 1NVMB 4JJFA 2FP4A 4B79A 4D42A 3KYCB 1R6DA 2UAGA 1CWUA 1UXGA 2Q4EA 4W7HA 4ZU3A 1UZLA 4R4JA 1XLTA 1E7RA 2PH3A 1CJCA 5F3RA 3DFUA 2OMEA 4W9NC 3D64A 5AXBA 3AK4A 3Q9UA 3GZNB 4D7AA 2NVUA 1ZK3A 4FFPA 5KKCA 1LLUA 3TDKA 1ZSNA 4W7IA 3X2EA 3AFMA 1UZMA 1LDMA 3RUAA 3KLMX 4J49A 1NWCA 2HK8A 4EZBA 1R0KA 1KEWA 1KEPA 2HK9A 4X54A 3IDSA 3BMCB 5IDXA 4XRRA 1LNQA 4NPCA 3LF1A 1LDYA 5TC4A 5KKAA 3ZWMA 1E7YA 4QECA 1UZNA 1LJ8A 2HAEA 1PTJA 1U3UA 1ZIDA 2CY0A 3C7DB 2GF2A 5I9MA 1EK6A 4WGGA 4OL9A 4YQYA 3RQSA 1I0ZA 5J23A 1SEVA 3GF4A 4CLOA 4DQXA 3O4RA 4I5FA 1YKFA 4Z0PA 4EITA 4MVJM 4ITUA 3KUXA 3PHIA 5GMOA 1UXJA 5KCZA 3ONFA 2Z1MA 5DBGA 2D1YA 1KBZA 4ZQEA 4CLDA 5EPOA 1XHLA 3JYNA 5CEFA 5AXDA 4L4RA 3D5QA 4TROA 2R00A 1U5CA 2P5YA 1GR0A 5A5FA 5B4TA 1KVQA 1MC5A 1GL3A 2NTJA 1N5DA 1OZAA 3DOCA 2NACA 5HTOA 5KJ1A 3S55A 5JY6A 4FS3A 2BFMA 4XJTA 1XU7A 3DAGA 2VNSA 4DMLA 2G0TA 5F5LA 2V65A 3WTBA 1ZJZA 1RJWA 1TXGA 1KYQA 4AJJA 2XOXA 5ENDA 3U4CA 4AG3A 3RVDA 4DPMA 4ZRMA 1MXHA 2ZQYA 1P33A 3LT0A 3M6IA 4Z3DA 1RWBA 3BTSA 2B69A 3TFQA 4J1QA 2W2LD 1I3KA 2UUPA 5L9AA 1F17A 2G76A 3OP4A 4YBZA 5T67A 4U7WA 2BHLA 4PCVA 1LQUA 2D5AA 1H93A 3RUCA 1KS9A 4KTTE 5C3MA 4YT2A 3D4NA 2VUUA 2BFPA 4I5EA 2NSDA 4R1TA 1EK5A 2PWZA 4IXWA 3Q6IA 1GUZA 1C14A 1PJBA 3WIEA 3HB5X 5B37A 3AUUA 1D4FA 4WCDA 4KOAA 1WW8A 1XGKA 2BGMA 4R3NA 1WMAA 1PJCA 1K5HA 4NU5A 3DMTA 2VYVD 2EV9A 2HSDA 3O8QB 2ZATA 4LMRA 4P4GA 3BTUA 5BNTA 1WZIA 5AVOA 3NTRA 1NFFA 5DBFA 2R2GA 2B0JA 1I8TA 3OF2A 2X0RA 2Y0CA 4R1SA 4IQ8A 1NBOA 3RUDA 4CMGA 4D0RA 1EQ2A 3MWDB 3GDFA 2XXJA 3PRJA 4BIIA 5L4NA 2AEJA 2VHVA 1NAIA 1KVUA 4WOKA 4PLFA 3AOEA 1OMOA 4ND4A 1E3SA 5IDWA 3MOIA 4RDHA 2BKAA 2X86A 2C5EA 3AWDA 4AL4A 3KZVA 4KDFA 5A9RA 1LX6A 4FGWA 3ZV6A 4BNGA 3H5NA 2HRBA 3MJ4A 4I9UA 2UUOA 3ZNQA 1GQQA 3H8VA 4U0JA 2O3UA 4N5LA 3W6UA 3C1OA 6LDHA 3UICA 1E5LA 3D7LA 4II3A 4LRTB 3PZRA 3TZCA 1PZGA 4XWYA 5JBIA 3KVOA 1X15A 2HCTA 4ALKA 2BI7A 5DCYA 4H3VA 1YWGO 5L4LA 3KYCA 2WJPA 4FC6A 2PKQP 4FR5A 3OETA 1BG6A 4XIYA 1ZEMA 4NDNE 4BNMA 2CDBA 4I1IA 4BMSA 4E13A 5B4VA 1BXZA 1FK8A 5FFFA 3ONEA 3KSZO 2PY6A 3NYWA 1ADFA 2BFAA 1QYXA 4QT0A 4JBIA 4N54A 4YTEA 4I9HA 3ZU3A 1TEHA 5DF1A 4CMIB 5BNFA 3HFGA 3HNPA 3JQ6A 1CYDA 2BRUA 3PQDA 1H6BA 2VZ8A 2B36A 4Z9YA 3UW3A 4DPLA 2J3IA 2J3KA 2YHUA 1NASA 3WWZA 4OHUA 4WCFB 5A06A 1SMKA 4IQGA 3DWFA 2GZ3A 1JTVA 5JC1A 1AXGA 1A71A 1R4NB 1GV0A 4XJSA 4DC0A 4DLAA 1O5IA 1VJ1A 1YB4A 3OSUA 4XDZA 4CM7A 1V8BA 4UVEA 2FOIA 4AVYA 3FNEA 4NQZA 1HZZA 2R6JA 4OSOA 4PG7A 4PG5A 2ZKLA 5FEUA 2VZ0A 1F14A 5JDCA 4W99A 1L1FA 3LC7O 3LC1O 3UHAA 3U62A 3KOUA 4IDEA 1SC6A 3OECA 4YA6A 3L4BC 4MOWA 4M1QA 1LC3A 2X5KO 3CZRA 4J43A 3I52A 1H2HA 4OOEA 3ZV4A 3FNHA 4WLFA 1CEQA 3QVTA 4D3SA 3RUIA 2Y99A 4JBHA 3NTQA 3ZWVA 2Y1FA 1I01A 2VUTA 2JFHA 4PG4A 5L51A 1WMBA 3PIDA 1H0KA 2QX7A 3GGGA 4ONEA 3JYOA 4BKPA 4OKNA 3ULKA 2QIOA 3RBXA 2VZ9A 2RH8A 3INTA 5CAEA 1EE2A 3FSRA 4RO0A 4RJTA 1NHGA 2CDAA 3JQDA 3ORFA 4MP8A 5HA5A 4BNFA 3LZ6A 4CMCA 1ZBQA 2C2YA 4F3YA 1VI2A 2X0NA 3I4CA 2ZCUA 4IUYA 1YDWA 5BSHA 2C54A 5F5NA 1DRUA 3EUWA 1D1SA 5G4LA 3VHRA 1OBFO 4RPKA 5ITWA 4YRDA 3PIIA 2NWQA 1DC6A 4BO2A 1E3LA 4G5HA 4H16A 4KZPA 2X8LA 4D41A 2GN9A 1SZJG 4XB1A 4LSMA 1PJLA 3WNVA 3HHPA 1ENYA 5JCXA 1SEPA 3NDIA 1T4DA 5KJEA 1WXDA 4LVUA 4GMFA 4DC1A 1YL7A 1PQUA 3JD0A 3N7UA 4D46A 4TRRA 3KM0A 3MCVA 2FPPA 1MGOA 3NJ8A 1V3TA 1YGYA 3V8BA 1VSVA 1HDGO 3QWIA 5TT1A 4RDIA 4BKQA 2VRBA 4O0LA 3SLGA 4JROA 4E4YA 4IDBA 1BTOA 3ZI0A 4DA9A 5I9NA 3SVTA 4MINA 1HWYA 5BSFA 2RHRA 2CZCA 2PGJA 2DAPA 3P2YA 4PVDA 3HSKA 4JP2A 1HLPA 5EERA 4OM8A 1NVGA 1V6AA 1ULSA 1RPNA 1VE9A 2UV8A 4WECA 5G0WA 5C37A 1SB9A 5KVSA 3BZUA 1ZNQO 3TRIA 1P74A 4HNHA 3ZWOA 3AUSA 5K9ZA 4B3HA 2WE8A 1PQPA 3MEQA 2JCVA 4BO6A 3TFOA 1NFRA 2Q49A 2GASA 3JQ9C 4KUEA 1DLIA 2A4KA 1C1XB 1PL8A 1T24A 3B20A 2F00A 3INRA 1E3IA 1Y1PA 3TJRA 3WMWA 5JMWA 3GAZA 3DEYX 3CH6A 3ZHBA 1PS9A 5IJZA 1J0XO 4II2A 4BO5A 1HLDA 1CETA 1PGQA 1NX6A 2PTGA 3OEYA 3QP9A 4IZIA 4IXTA 2X5JO 1B0AA 4D3DA 4GSKA 3IAHA 3GDOA 5JXWA 1YBMA 5JO9A 2W98A 2B4QA 3T4EA 5GZ3A 1E1NA 3H5RA 3ZHYA 1ISMA 4YACA 4B4UA 4CMIA 1K6IA 1RM4A 3GPDG 1PZFA 1JAYA 2PZMA 4YAGA 3FTPA 3OHSX 3ITKA 4J0EA 1R37A 3GVIA 5A04A 1QV7A 2NADA 2BD0A 1XR3A 1PQWA 1R4NA 2IYPA 3VOSA 3KO8A 4WOJA 2Z95A 1ZH8A 2NU9A 2EP5A 4E21A 4NFSA 5ES3A 3M1LA 2PKRA 1AXEA 1BW9A 2C7VA 4ALNA 5TQVA 4R51A 3WGGA 1Q2XA 3PFFA 1HE3A 3ZHXA 3A06A 3VKVA 5L4SA 4Q39A 4MJLA 1FDWA 3KEQA 4DYVA 2GYYA 2XF8A 3LYLA 4ZHSA 4F45A 4NH4A 4RGBA 1MLDA 2ZK7A 1HE5A 3MOGA 1U8XX 2WWRA 5FWNA 4BMNA 1DC5A 3OM9A 3KSUA 5IZCC 3M2PA 5IDYA 1IULA 1WZEA 4P22A 1RM3A 2E48A 2H1SA 4J4TA 5DCWA 3BMNA 5IN5A 4NIMA 4CM6A 3EVTA 3WFJA 4H15A 4OXYA 5HM8A 4PIVA 1A7AA 3Q11A 4J2OA 2GRAA 1GD1O 1U2GA 2ZTVA 4UREA 4Z6KA 4CODB 4PVCA 4CV2A 1IHXA 4TRMA 4W9NA 3U0BA 1NPDA 4WLEA 5ICSA 4CM8A 2DFVA 1MX3A 1DDOA 1LLDA 1VL0A 3CMCO 1KVTA 3I9LA 1D1TA 3O38A 2O50A 4KUHA 4Y67A 1DRWA 2A35A 2WDZA 4XA8A 5IG2A 4FPXA 1SCUA 4BVAA 2C0CA 4NJOA 3JQ7B 4HWKA 3BHMA 5TIIA 4BV9A 5GZ1A 5I8WA 5G0VA 4Z9XA 3UCFA 1B8PA 5K6AC 1ZFNA 4RPLA 1K6XA 2OXIA 1QXSA 2QYSA 5C5IA 4I8XA 5ENVA 1I30A 1TI7A 1EBUA 3TN7A 5L7WA 1ZJYA 1EFKA 1ZVMA 2YQ5A 1DOHA 4H7PA 7ADHA 5JO0A 5CHEA 1UDCA 3JQFA 3EZYA 1FDVA 4CV3A 1DHTA 4E30A 1V3VA 3JD1A 3JQ8B 4MVJE 3KB6A 3OJOA 3DTTA 4E5MA 1B8VA 4CLHA 1IYZA 5TLSA 3WMXA 2VYVA 2PZJA 4MP6A 4R5HA 4PLCA 4R9RA 4U6SA 3SC6A 3TQHA 5A9SB 5JYDA 1NM5A 3KHUA 4YPOA 1JWBB 1B16A 3UCXA 3DO5A 3OIDA 1O8CA 4GKBA 1EUCA 1LDBA 3ITDA 1PJSA 1ZO8A 3KYDB 1F12A 2O4CA 3GY0A 3H6KA 5L40A 3B70A 4GX1A 2PD4A 1GYQA 3PDUA 3NRCA 3RBZA 2X1HA 3W8EA 3BMQA 4W6ZA 5I7VA 1YL5A 3BAZA 2GNAA 4BKRA 1DIAA 2EKLA 3C85A 4K26A 4UUPA 1T2CA 2HJSA 1ZW1A 3QWBA 1X7DA 2EW2A 3ROMA 1O94A 1R12A 2D2IA 3PDJA 4AICA 4NFYA 2ZYGA 3MJEA 3DHYA 1EMDA 3AM5A 4U6QA 1MFPA 2X58A 2I67A 4PRLA 2OUIA 3PEFA 1HDOA 4ALJA 4AJKA 4Q3NA 3H65A 3FWNA 2G17A 2J3HA 4IMRA 4LW8A 1PZEA 2FWMX 3F6YA 3GEGA 3L4SO 3ADPA 3OJFA 4FSHA 4OSPA 3IC5A 4DVJA 5JSFA 4WUVA 4DIOA 3PJFA 3IOYA 3KETA 2I99A 2AQKA 4A5OA 5DDIP 2ZB4A 1JDJA 4M87A 2BELA 4OQYA 3HDJA 4FB5A 4YT5A 4BGEA 4E32A 1DRVA 4XGIA 4YJHA 1DPGA 3VKUA 4E31A 1ENPA 2Q99A 3PLNA 4GGOA 3HN2A 4BO0A 4E12A 2J8ZA 3QHAA 4B4WA 1IHYA 2A9FA 3EY4A 4QFCA 4S1VA 3SX2A 2NV6A 3F9IA 4RCVA 5H81A 5C7LO 4YAKA 4IM7A 3QJ5A 4HFNA 4J1NA 1GPDG 1U2DA 1H2BA 5AQ1A 1TA4A 2RCYA 4WCFC 3SJUA 4CMKA 4CQMB 3G79A 1A5ZA 5ER6A 5FI3A 4YWJA 1P1JA 5IXYA 5A4DA 5KVCA 4EI2A 1H6AA 4DRYA 1R4MA 2Y0DA 4PN3A 1ZK0A 1ZZEA 4JJIA 4WEQA 5I7EA 1BHSA 1QRRA 3DZBA 3ETDA 4IDCA 1N9GB 4AFNA 1P1RA 1MXFA 3QW2A 4BGVA 4DLBA 2NM0A 4NBTA 3DC2A 3ROQA 1N7HA 1YONA 3H7AA 3OIGA 3WG9A 3BA1A 1PIWA 3IMFA 1YQXA 2AEMA 5U4QA 4RPGA 2WM3A 5T6BA 2O2YA 3Q9NA 1ZK1A 3L9XA 1ML3A 4BNZA 4CM4A 1YO6A 4GWGA 2DTXA 3EDMA 1EDOA 4YEDA 5AXCA 1Q7BA 2EP7A 4XGKA 4ZQHA 5L3ZA 5EQFA 2CVOA 3VZRA 1O89A 1ORRA 2O7QA 4RLSA 1D7OA 4GLOA 1Q7CA 4J2HA 3CMMA 1B3BA 4JCOA 3PQEA 1ZMTA 4R9SA 2DVMA 1F0YA 1I3MA 1Y81A 1FF9A 4L9RA 3KYBA 3NTOA 3GZ4A 1SNYA 2JAHA 3JQ7A 5TNXA 3W1VA 1MC4A 4QUKA 4I08A 1FXSA 4B7UA 1E7QA 4CLRA 4NBWA 1ISHA 4GMGA 3OJEA 4FFNA 4Y6RA 2IODA 3JQBC 2FZWA 1ZXLA 3COSA 4IGFA 1EVJA 1A4IA 4BKUA 2V6GA 1U1IA 1P1KA 2YFQA 3RJ5A 4BO8A 4GQAA 1OOEA 2D59A 4NBUA 1I24A 2C29D 5JDIA 1WNTA 5K0ZA 4J16A 3L4BA 3GHYA 2EHDA 3QWAA 1ARZA 1BDBA 4BNLA 4L74A 3V1TC 3SJ7A 4NI5A 2OOSA 3GN2A 4HNGA 1P44A 3DTYA 3WS7A 1NPYA 1VLLA 3CSDA 3MJTA 3TZKA 3R0IA 2YV2A 5LC1A 2RAFA 1DFGA 5TRTA 1Y5MA 4EUHA 5JAZA 2XAAA 4M86A 4UUNA 5A9SA 5DOVA 4YQZA 3VPHA 1DO8A 1N1GA 3K8ZA 4TKLA 2YDXA 3U09A 2DUUA 2E4AA 2GERA 3KLPX 4BNUA 3TWOA 1C1DB 3PPIA 1DIRA 1QYVA 1QYCA 4B8WA 1WVGA 4QO7A 2VOJA 4EDFA 4GX0A 5JC8A 1JQBA 1SAYA 2VWGA 1UDBA 2JFGA 4LGVA 4RQUA 3L6DA 3UH1A 1NFQA 3JQGB 4RLHA 1PL7A 4KDEA 3K96A 5JMPA 1YVEI 4XEHA 3VH2A 4AJHA 4DBVO 4PZDA 4KQXA 4D43A 4PLWA 1HT0A 5FF9A 1ENOA 3K2BA 1JA9A 3LK7A 1GADO 1T25A 4OXKA 1Y8RB 3RROA 1GDHA 2DBRA 4ND3A 3U4DA 3WFIA 5ILGA 3ZWXA 4AJLA 3QE3A 4GVXA 4MVJG 4R1NA 5KWEA 4HFMA 1H6CA 3OQ6A 1YE3A 1JN0A 1JWAB 2QZZA 1LU9A 3D4OA 4JIGA 1P31A 1UAYA 3QVXA 2X9VA 1VL6A 3TOXA 5CDGA 5T64A 1IE3A 1BRMA 1E0DA 2PNFA 1T4BA 3GVHA 1A4UA 3EHEA 2HMVA 5L53A 3HN7A 1LDEA 4J9UE 1Y7TA 3QWHA 4AJOA 1EVYA 3DBLB 3NEPX 3WYEA 4CQLA 1N2SA 3GMSA 2OGUA 1JW9B 3RFXA 3JYQA 5L45A 1KC3A 2IXBA 5TS3A 2NUAA 3LF2A 1CRWG 1NYTA 1J4AA 4A03A 1PJ2A 4K28A 4D0SA 3IQDB 3GQVA 3E1KA 1D8AA 1X13A
chains in the Genus database with same CATH superfamily
1NI3A 1QGZA 1GGJA 2A0WA 4CKYA 5HHTA 1JSCA 3GJ0A 3VPCA 2C7QA 1YZUA 1WPQA 1EE9A 4JB3A 1FTSA 2DY0A 4P2BA 3CE6A 2JDID 4V0ME 1U8UA 2K7ZA 5KNDH 2CFCA 4GU5A 2QMHA 1Q0QA 1NYLA 1R6XA 1YD7A 2VHZA 2ZS7A 1C0KA 3NAZA 4QQRA 1T26A 5AI6A 3KHKA 1U3WA 3DULA 4ESEA 1ZGAA 2R68A 3AHFA 2FH5B 1RAAA 1IAQA 4Q9HA 1Z25A 3W06A 1TAGA 2P4EA 2YFKA 3CU5A 1GY8A 3RFTA 2PANA 3CW2A 2ZI7A 3WGKA 4RVDA 4IS2A 2W5UA 2E4YA 1QGUA 2DC1A 2QRHA 3OJCA 1XPJA 4MVJA 4AZSA 2HMUA 1E2MA 2X42A 1LK0A 1T0BA 3A1VA 1M5UA 3OA2A 3H9GA 4Y2SA 1E59A 1T0PA 4UAVA 5TPZA 1IUKA 4KQKA 4PAWA 2HO4A 2JLBA 5JATA 4MH0R 1RMQA 4Z1OA 4AWBA 1X77A 1V48A 2Y1XA 4EJSA 2HQSA 3IP7A 3NT5A 2G5CA 4CV1A 3JYLA 1WB4A 3DGEC 3LX8A 1AZWA 2ATEA 3HB1A 4KVFA 3VC1A 1EXWA 4BFXA 5L3RA 1BN6A 1Y1RA 1CQIB 2EJWA 1QHXA 1A77A 1F4LA 2FI1A 4WESB 2QG4A 3URMA 4CFYA 3I0MA 3ET5A 5TGTA 4D9IA 2E5FA 3G2HA 3U7EB 3O2QB 4DT1B 3KZNA 3ZJUA 2J46A 3C15C 1SVLA 1BDJA 4MHSA 1EUDB 1LQTA 3S2IA 3DMGA 1A8UA 1TKRA 3JU3A 3OTOB 2VHYA 1E5TA 3MVEA 4KWHA 1FUEA 1GNLA 1PK9A 3DKKA 4JI7B 5ESXA 3SYRA 1QBKC 3L6EA 2E4VA 4WKNA 4M9RA 1YA6A 3OF3A 2IU4A 1E99A 3NXSA 1U9IC 2F8LA 4ZJUA 4B7ZA 4QXOA 1L5KA 2XE8A 5M2QA 1AHPA 3E2IA 1YHNA 4F6LA 2BEWB 3EIOA 3NBKA 1F1JA 5BSVA 1HZJA 3B1KA 3BVPA 4MVJF 3V00A 1KY3A 1DKOA 4EPYA 4FIDA 4CN9A 3F6CA 4JD5A 2CHVA 3L18A 4BNIA 4GXQA 3T4XA 5L8VA 2A1TS 1HO3A 4XB2A 4BB5A 1M76A 4JLBA 5IZCA 4G0PA 2LV8A 4AYXA 1U7TA 2BGGA 1T5HX 3AFNA 2WYVA 1XVTA 2XSZA 2VTBB 5F2KA 4MEAA 4ZZIA 3ZYZA 1Y7HA 2ZPUA 2AOTA 4ON9A 1YUBA 2BFFA 2FX5A 1RLMA 2WZQA 1XRPA 1W4CA 1S9HA 2FWIA 4CU2A 3FTEA 4CM1A 4PZAA 1JI3A 1MG5A 2GNPA 9MHTA 4KQMA 3ND7A 2Y1EA 4YS6A 2WUFA 2ZUVA 3NM5A 4UHDA 4JQSA 5CJJA 4BNDB 1DJQA 5EKSA 1JIXA 1D4ZA 1EJ2A 3I6YA 2JEOA 2O3QA 2J5RA 3L40A 4G2NA 5FL7A 2E2WA 2OVBA 3FZQA 4NU0A 3PDIA 4TV9B 1QGYA 3ZGNA 2B4TO 5DXJA 5FKJA 2FUKA 5GQSA 3I37X 1Z26A 3GT4A 3HP4A 3FAKA 2QI9C 4URHA 5JADA 4LF8B 3ERCA 2ZXUA 1O2DA 1P0MA 1WOMA 2ZWPA 4YCAA 3KVYA 3LDUA 3VYWA 3NGLA 3EIEA 1GARA 2WAAA 2AE1A 1EBBA 3N2YA 4H7DA 1M3SA 3ZGLA 5ALDA 5TQJA 1RQ2A 2GHIA 3GNTA 1XIVA 1M34B 2QVGA 1N6LA 1Z5PA 4X60A 1YRWA 2W4QA 3I58A 2YN4A 3PG5A 4J4HA 3FVQA 2QRKA 3K8OE 4B83A 3AF6A 3AJEA 1ICIA 1Z83A 4IY1A 3EDCA 2JBHA 1JFFB 3PWKA 1L5LA 4UAUA 1A9RA 5FJIA 2XCUA 4P1ZA 2R11A 4X6XA 3COJA 4BVJA 2XOKD 3LCMA 4O29A 3OU2A 2AHRA 4DPKA 4X93A 4ZGWA 3RLIA 4GBGA 5E9WA 4OUKX 1DXQA 1SUBA 3B5IA 2J9GA 1JPNA 1P8AA 3DKRA 3I9OA 3LC2O 3LQFA 1BX3A 1K5DA 4N3AA 4YCMA 5BN3B 5F9HA 1G2OA 3THXB 1K0FA 2EZ8A 3GBVA 3HJNA 1UCFA 4OFZA 1VRCA 5JBNA 1ABEA 1TCBA 1O4WA 1V1MB 2BMEA 1T3HA 2NVOA 2OM2A 2NVWA 4HEA6 3WGTA 5THKA 1UJ4A 5ITZA 3NHJA 1GQ2A 2XODA 1WULS 4QFDA 1I6MA 4M2LA 5DK6A 4A23A 1RJFA 2WUEA 1GGEA 2WHYA 2OLKA 4C3UA 1E63A 2XUOA 3BXXA 4I99A 4FNOA 1KC1A 1VXRA 4CU5A 2MYTA 3CLTC 1V2HE 2WT8A 3OOHA 1NI5A 3CRNA 3EWAA 4HH3C 2YIVX 4R68A 3D0QA 3EH1A 1P9RA 1WZ2A 4I8DA 4UC0A 3DAOA 1AX9A 3B52X 3UK6A 3AHHA 4G9BA 2HQRA 4RPIA 3RWOA 1JRLA 3D8UA 4ZHQB 2J31A 1YR3A 3LHSA 3ETCA 4S0XA 3GD5A 3AFGA 4G0VA 2J87A 4QJIA 3ZIDA 4BFVA 1N7GA 4O4HA 2I0FA 2IUUA 3PE3A 4D4MA 2C2OA 2OHIA 3O21A 3C1UA 3DDHA 4OM7A 4BUZA 1SA0A 4L0DA 4Q7LA 5DHAA 2B82A 1Z0IA 1XTJA 1HQKA 3P0FA 2AZTA 3AVQA 3NQ41 1RM5A 3LPNA 2JJMA 4QD3A 3TIGA 2XCSB 3V5NA 1JJBA 3QELB 3U49A 4MXDA 1BGWA 3NU1A 3NHSA 1HYEA 5I4CA 3SZGA 2FR8C 4HQFA 5ALUA 1LKZA 4DMHA 5I45A 1LD3A 2GARA 2MT9A 3ORQA 4IL5A 3GLGE 3WFZA 1DIGA 1NAHA 2BEVB 4UEOA 1JVNA 3HZRA 1E69A 1ZYUA 2IYEA 5FTMA 4E70A 1W52X 2PG3A 5KTSA 4Q4DA 3VSDA 4BDTA 3THWB 3QFCA 2WI8A 4HFRA 1GV1A 3TL3A 2D3TA 3E22A 2QQ0A 3DAYA 4PONA 4XCXA 4OYLA 2BGRA 3AB8A 3ITEA 3MB5A 3K1AB 5JNLA 1PK8A 3HJTA 2VDJA 2HHCA 4FFDA 3FBGA 2H4JA 4TKMA 4FMBB 4YJFB 5E38A 4EJ6A 3C3MA 4FHDA 2VP2A 2AJTA 3EK2A 3NGMA 3EVCA 2QUZA 4BMXA 3V48A 5DX0A 5BUZA 5IWAB 1C7JA 4J2TA 5AW0A 1WTCA 4AZWA 3TR0A 3L82B 4UDXX 3WIVA 1V8OA 2ZSKA 4G0XA 1S2DA 3R24A 1Z38A 3DKIA 4K2AA 5LP6C 4O4HF 2ZI4A 3Q41A 2XNDA 4MAFA 5C81A 3MTQA 1I2MA 3IXQA 1MABA 1GNSA 2V7TA 3GGOA 1KSJA 4TLLB 2W6OA 4QVKA 3CIFA 4WCFA 2XHZA 2C88A 1XMIA 1WDKA 3T5DA 2V03A 2DWOA 4Q4JB 5J47A 4A36A 1T1IA 2AFHA 3DVRX 1W0CA 2BY4A 4JH0A 5E9JA 5DZSA 4NE7A 4JP8A 1R8SA 2ISSD 3V4FA 2DFTA 5HF6A 2PZFA 2RHTA 5H3CA 4W63A 3D6UA 3OFSA 1S3IA 4BV8A 1RAIA 3BS4A 2RAUA 1HTWA 2H92A 4BEVA 2A9JA 4KLCA 5DN6A 4FFRA 3WBBA 2AJ8A 2PU7A 1FDSA 1VFPA 3S70A 3A3NA 1P60A 1ENZA 3T0IA 3PXXA 5DISB 1KI4A 3D5TA 4RVSA 1OTXA 1FYXA 5TSDA 1QNLA 1EFTA 3VPFA 1XE3A 2I1VB 1M67A 1ZONA 2EG9A 3HBLA 4OUDA 3WK8A 3HVRA 4DCPA 3IEPA 3EQ8A 3KQMA 3PJGA 1KEUA 4MVJD 4FMCF 5LMNB 5C7IO 4OX9B 1NE7A 5KO2A 3DWIA 2X3UA 3OZIA 2XCOA 3A28A 2PXCA 3F6SA 4QGGA 9LDBA 4QDUA 2J7PA 2VJKA 3OJLA 2RE8A 3OKPA 1B00A 1D3AA 1YSCA 4Y2PA 4RV9A 3V8VA 4HCJA 4UCXA 2MSKA 2YW2A 4J0DA 3FPSA 5HFAA 4B5KA 4ND2A 4UQPA 5T8KC 3BSYA 2OORA 3K3PA 3VISA 5BWNA 4RIFA 3KJQA 5JSZA 3LKZA 3MWFA 2PX3A 4Y0VA 1RLOA 5EWMA 1U0EA 1RQPA 4Q15A 3WB0A 3EHDA 8ABPA 4H08A 2AC4A 2VTKA 3E9MA 2NTNA 3KDAA 1N5LA 3KOMA 4HL6A 2ZI9A 3GK3A 4PX5A 2F59A 2QLFA 3R76A 3KR2A 4Y2XA 2OCIA 5CVUA 1RNLA 4EUNA 1V3UA 3PB3A 1ZVQA 1WRBA 2GXQA 1TZKA 1UT6A 5DWVA 4OXIA 2GCEA 3UHJA 3RYHB 4BC0A 2ZTMA 4RHEA 3SQNA 4K1LA 3ZWYA 2DR0A 2EZTA 4R16A 3UOGA 1WP4A 4Z7QB 3P0IA 3VAAA 2CNBA 2EYQA 3DPIA 4LG1A 3K6SB 3UMVA 4TMZA 2H0QA 5H83A 1HT3A 1H4TA 1Z2EA 1IN4A 2FE4A 3H9EO 2GETA 4RSRA 1MPTA 2XZOA 2COEA 2W8ZA 3P2OA 5ECGC 4K9MA 4ZOLA 5CLLA 2F3TA 1PWZA 3BL6A 1AK2A 1YDEA 2FP4B 2J45A 4Y8VA 4P32A 4B5LA 4DIFA 4GSYA 1SKMA 3BD6A 2GJKA 1XROA 2Q5JA 1OT3A 4ZD6A 2XSZD 1T9GR 3VM6A 1K1EA 5BSGA 2O2GA 1TCVA 5CIQA 3L93A 4B7AA 4HN9A 4C43A 3DHEA 1M66A 2G3YA 4BTLA 5A3JA 3BXEA 4F4IA 3RBAA 1RXIA 2ONCA 1LSOA 2OBNA 3D2LA 1SIUA 2XV1A 3FY4A 4QARA 1Y5LA 2KMLA 2HPZA 1OFGA 2PMEA 4Q82A 2AN9A 3ID6C 3H19A 4GS5A 1G17A 1GCUA 1L4UA 1MFZA 1NRXA 2GWRA 2G6BA 3HN6A 4X6LA 5H80A 1QO0A 5JXHA 3ETHA 3HR7A 4QVIA 4PG6A 1R00A 4UUQA 5TEVA 2XTJA 4I4IA 3CLSC 4C4YA 4OB6A 3GPCA 3RB8A 4D82A 5CB0A 4OQZA 2NYUA 5P21A 4UTNA 2V7UA 5DM0A 2PZKA 5F9FA 2ZCJA 3LT5A 3TD2A 3LPCA 3DAHA 1EWTA 1JT2A 1M2HA 2W9XA 5GONA 5IX8A 2XADA 4ZOLF 5TR9A 4AT1A 1FW6A 4PINA 1NJFA 4PAQA 3IQEA 1X7XB 4OAQA 4X1YA 6AT1A 3FFBA 2H1WA 2RB4A 1LPMA 5G0SA 3LBFA 1IL0A 1VMDA 4REQB 4ZQBA 2C4MA 5NULA 4BWGA 4MDEA 1XDZA 1G6Q1 2QOEA 4V2IA 2E21A 2WT9A 1C4OA 1CPYA 4P83A 3ZXIA 2GPTA 3PX3A 2I76A 2XUGA 3C7TA 4MVJI 3F46A 2ZSBA 4TLEA 2B1GA 4I9FA 3ZWQA 4EOGA 4DUZB 1ZI8A 3NCTA 4UMFA 2B30A 1SQ6A 1VFNA 2B1RA 2A9PA 4B48A 3FYHA 1ID8A 1QG2A 5H9VA 4Z7NB 2VSXA 1J33A 3EQ2A 1J25A 1SK9A 1L5OA 2D4HA 2P9QA 3EXAA 3KOZA 4EG3A 3JPYA 2QAJA 4QX6A 1UDAA 1XDGA 3E1GA 3ZDZB 4BUJA 2IL1A 1SIBE 3UMSA 3R9WA 2XKBA 1IOZA 3TW0A 4AJ9A 5C8VA 4UEKA 5LP1A 4NK5A 2YYYA 4FNMA 2BM9A 2ZJAA 4RBNA 4EI9A 2MSNA 4W5NA 1B6RA 3N9IA 3D54D 2HA3A 1Y1LA 1DKNA 2WABA 2ZRJA 4F38A 3C5EA 3WOHA 5C1BA 2OHFA 4A3SA 2J3JA 3SQMA 1OJ7A 1M1UA 4IIDA 5GONF 1EVIA 1PWXA 1T2FA 3KTDA 5T4FA 2Z83A 4YT8A 1E4EA 2VHQA 2G67A 3ACCA 3B6EA 1SUCA 5EMMA 4NU6A 3RM3A 1GPUA 4B43A 1N0WA 4NCIA 3WGVA 2FMHA 4A0SA 1PNOA 3GHHA 4JKIA 2YXLA 4MVJP 2WMNB 4R5MA 4BLVA 4FVTA 1NKSA 2P6NA 4E07A 1IN5A 1P1HA 1A9TA 2BF4A 2R60A 4MJ7A 4CCWA 1ZOSA 1NKTA 2D2FA 4MQFB 4QDTA 3Q8LA 2YRXA 5F98A 2V4MA 1NXWA 2HYIC 2AWNA 3HHEA 4P4TA 2VZEA 5MDHA 5IAAA 3UB3A 5J1SB 1PJRA 2QTVB 2C5GA 3ANLA 3NW9A 4KXVA 4RAQA 5JS1A 2C4UA 2OXCA 2VRCD 1D8TA 3EB9A 4II7A 2F2TA 5F76A 3WBKA 2CLHB 4TS1A 2QZ9A 1JHUA 4IIUA 1SXGA 4C7KA 3IQWA 4V0LA 3L1UA 3FD8A 5G1OA 3OZDA 3M33A 3U81A 1UL1X 1V8ZA 5IJ0A 1TVEA 1ZJ4A 3CISA 1PAUA 4Z2YA 3ZKAA 3STVA 1G20A 5HMLA 4QU9A 2BP7B 1Z34A 3OFJA 2ZRAA 4S24A 1P7ZA 1QG4A 2Z4RA 1GFIA 3PHLA 2XBLA 3C39A 4X91A 4P4UA 1X1EA 2Z08A 2MSWA 2B1JA 4E09A 1QB8A 1L4BA 4PXSA 3OZ7A 2AMVA 2YS7A 1PEAA 1UKVY 2WWHA 4G2TA 1HOTA 5EJGA 3K73O 2I3AA 2R85A 3MAJA 5GJCA 2OBLA 1Z5NA 3UATA 1ND5A 4GQIA 4EFMA 2FE1A 4HDKB 3PPVA 4JC8A 1N3YA 3DBIA 4J0FA 4Z9FA 1XWWA 4K87A 4AY3A 1RWKA 1P3Y1 2GA8A 3DW3X 4ZICA 1PD1A 2WZBA 3CQ9A 5DGXA 3F74A 5G41A 3OG9A 4IOLA 5J5CA 4KXLA 4ZYTA 1F8FA 1K7SN 2P77A 2PX8A 4JWTA 1XKTA 2XNDD 4GI2A 2O5VA 1XSEA 3N3AC 4ZVUA 3ISJA 4J90A 5IC5A 2G28A 3FHLA 2DUJA 4J9VA 3EF1A 3WGHA 4RK6A 1NBMA 1R9NA 3ZR4B 4CBVA 5CEEA 5ISMA 5IXJA 4YMVA 2RGDA 1AD2A 2G83A 3QEOA 4FCWA 3VJMA 3D4PA 3CCCA 3NLLA 3NG1A 3OCYA 3K5PA 2FFJA 4M0EA 4PY2A 3PA6A 4EGSA 2P2CA 3E7XA 1FJ2A 2EP8A 2VYNA 3O94A 2EARA 2A0KA 4DMGA 3AJ9A 3F1KA 2UVDA 4EW6A 3ADCA 5BSRA 1RRCA 2NLOA 3KDSE 4A73A 1MAUA 1ZA1A 2C0QA 5ALIA 4DG5A 3DT9A 2WD8A 3E8XA 3F47A 5BVHA 3ER9A 4DV1B 2IUYA 2BF7A 3CRMA 2XB2A 3NAQA 5B3KA 4AUMA 3E8MA 4LISA 4EVRA 1X7GA 4XYBA 1WCWA 3THOA 1VKJA 4PU0A 3QSGA 3BQMB 3O90A 3M6AA 1NI4A 1Z7EA 2NZ8A 4FJ0A 3PYMA 1VBKA 1XZKA 2HMAA 3G59A 5JU6A 2XVMA 5EMKA 2VEOA 1NQWA 3IVCA 3OQIB 4BTVA 4EKNB 3ZLUA 2ZOSA 1I2DA 1XJ5A 2B5VA 1G8HA 1TEXA 2FMKA 2NQTA 2IVFA 3H1BA 1QE3A 4B7CA 1VRVA 3RSQA 1OYYA 4DM7A 2OCGA 2B35A 5C5CA 1JPUA 3DBHA 5CG2A 4NFHA 5BV8A 5TF4A 4L6AA 3FUCA 2J5QA 4FHEA 4LF9B 5A1JA 2VBFA 2H57A 3M5PA 4OGFA 1HDZA 3NUGA 3V4ZA 3O2JA 4JV5B 4NMLA 3EC7A 2ZM6B 1Z82A 1DADA 3DBVO 4XD2A 4BB6A 1QOQB 1GEEA 4KXQA 1BROA 4U39A 1UC8A 3L0DA 1FP1D 3UMCA 2J7KA 1O87A 1NHWA 4BZZA 2Q4RA 1YMQA 3EOZA 5AM1A 3FROA 1VKZA 3ST7A 4RWEA 1HFEL 1DAEA 1ZOOA 1P19A 4RKFA 1O96A 2D5IA 4KIUA 3HO1A 2IZ5A 3UENA 3IHKA 3VU1A 2YZKA 4Q1FA 3ZKWA 1R6VA 1YJBA 4OAPA 3HBNA 1RHMA 721PA 1XVIA 1F48A 4QOIA 4KWCA 4UMVA 3RFVA 4LDNA 1A2BA 3A4VA 3IQZA 2YHSA 4LMBA 2G1JA 2B9EA 2V6FA 4V24A 1KJIA 3VBEA 1PVDA 5DNAA 3EXFA 1F2TB 3G17A 3SMVA 3M1IA 5CYFA 4Z4GA 2XUQA 2H0RA 1RACA 1L7DA 2C98A 3ZDQA 2IZ1A 1ZVVA 4CGZA 1IEXA 2AKYA 3WV5A 2D62A 2P8SA 4L16A 4MK4A 1XMOB 5D7BA 4QGBA 4ZVRA 1XEWX 2DYKA 1ZD4A 1FMCA 2PRKA 4P93A 5LKRA 5LR6A 1Y0BA 4MRRA 1O97D 4HQKA 3RAGA 3FPKA 4PLGA 4C6TA 1BSVA 2ZBUA 5FQOA 2VDRB 4L72A 1M33A 1KQNA 5K3BA 3OI7A 3ZJVA 1TB4A 3F4KA 5HIKA 1O94C 4B3IA 3T7KA 5KWJA 3NNNA 2AXEA 3T4PA 2AR7A 2XVAA 3EW7A 4JOQA 4YASA 1RYFA 4DKXA 3SBEA 4M89A 2QEQA 4ZDJA 5KTYA 1T3ZA 2ZSEA 3FLAA 4E2YA 2F1RA 3QMMA 5FV4A 3QLVA 3VHXA 1MNQA 2BKLA 1DTWA 3EEFA 1HSOA 2QAIA 3AUTA 3JQEA 4BFLA 4V39A 4GHWA 4ENVA 1GHTA 2I2DA 1N25A 3P4UA 3C3XA 1QAQA 5DM2A 4BQSA 1RYYA 1D5WA 4JFRA 1RHRA 1JJ7A 5KWVA 4QFMA 4XASA 4CIBA 2E37A 4W4TA 5B2FA 9LDTA 3A70A 4NZYA 5IKOA 1MORA 2OB1A 1R5BA 1MTZA 3RC9A 1SCQA 2NAPA 5P8WA 2YMMA 4I50A 3FUTA 4X41A 3TNYA 1L4MA 4DDMA 1Z3IX 2Y0EA 2YJ6A 3O0TA 5D5QA 2FY8A 1E1LA 3D0OA 3D6TB 2WFLB 4YRAA 5A62A 2ZFUA 1OE0A 5B2ZA 4PO8A 4KMRA 2HLPA 4NOKA 4OK6A 4ZVVA 3NDRA 3L43A 2QRNA 2GILA 3PHHA 1CIPA 1GN8A 2V0GA 3GMDA 3UBMA 3F7MA 5DOZA 1JLLA 2A0XA 3PD1A 1ETHA 1ICEA 3BF7A 5LMCA 3ZXXA 5KJ6A 1FFYA 2PUGA 4GGPA 1EEHA 2REQA 2VF2A 2VDMB 3FTNA 1G6OA 3GRYA 3VVCA 4CMEA 5I9LA 1G5RA 2HSEA 4WBSA 2CLKB 4A0GA 3FCXA 4LVCA 2WZDA 3NGXA 1JVBA 3M2TA 1SO8A 3MQFA 4PIPA 3RUFA 4FINA 4X71A 3K2IA 5AH0A 4V2UA 2BM0A 2XUPA 1JXMA 1VJTA 5DHRA 1DEHA 2O7SA 5DGDA 3UXMA 3EEOA 4JK3A 5KOYA 5IHXA 1TZ2A 2WBLC 1NTOA 1ZD2P 3U44A 2PT7A 1G63A 3STHA 2FAXA 3ZQ6A 1IEVA 1BRTA 1EHIA 4AF6A 1MP0A 2QX9A 3ZWAA 3QKSA 4YUYA 1CJTC 1ZX1A 1AKQA 2CD9A 3F97A 1UEIA 3AF1A 2R8ZA 4FOOA 1NIJA 1PU2A 1IWOA 3NBMA 4QBGB 2QJRA 1L9XA 4FKBA 4ZAGA 4EB8A 1RAGA 3DZIA 2C0PA 2ZYHA 4I50F 4PGFA 1HDCA 121PA 1MPXA 2ID4A 3FVWA 4XFJA 9GPBA 4RZ3A 2QK4A 2WJ6A 4B46A 4YXFA 3SQOA 4LXTA 4FIZA 4RU1A 2RJOA 1Y5IA 5HKAA 1ND6A 1A8SA 1DJOA 3IUMA 2HRZA 3FOFC 1GAXA 4FZVA 4E1BA 1LF0A 2PQMA 5DT9A 4ZGGA 4XJVA 4MWGA 3TZQA 2BDUA 2ZBDA 3WJ7A 3EBOA 4E88A 4EJ2A 3HRKA 4MQEA 1EB8A 1XN4A 2RGNA 4YCCA 1U2SA 3RVQA 5K3CA 5D51S 2ENWA 4OHOA 1FX0B 4LY6A 1DLJA 3RNLA 1CUUA 1MH9A 2CXXA 3GJRA 4AX4A 3K6JA 1VI6A 2WD9A 1ADJA 1DCMA 5IH7A 3UHFA 3EZ7A 3R7BA 5B3LA 4HEQA 2F9FA 2ZB3A 1DMSA 3FMGA 2JEYA 1THZA 1OUMA 3NS7A 4PLHA 4RV5A 3AEKB 4KX3A 4V0KA 1Z0ZA 2NUPA 2WVAA 9ABPA 1UBMS 3H6GA 1IN7A 4G56A 3J7AC 4PYIA 2HUNA 3QXXA 3P9SA 3QNUA 4YAEA 1ZINA 2KQUA 2H9YA 5JCJD 3T9DA 1BW9B 3W5BA 1T4CA 1L6IA 3L8GA 4JP5A 1Y37A 1U9JA 2YVKA 4WWHA 2QPTA 1PT6A 1W93A 2XKJE 3NHAA 3SJZA 2CHUA 3ORRA 4BWYA 4NBKA 4RPHA 1YHZA 4KQEA 3GLIB 1BXRA 1GZUA 2F1KA 2NSLA 1BVRA 3IKVA 3PGJA 4RIHA 4RMGA 5BSMA 4CJXA 3FZEA 5IFLA 3AVVA 3AERB 1BMDA 2P1ZA 1J8QA 4U3JB 2ZUFA 1PNVA 4N3CA 1DT5A 1I36A 1JSRA 1W87A 1E8MA 1CUIA 2XYPA 5A2QA 4G97A 4KQ6A 1CJKC 5I48A 4OH7A 5LZ9A 1MEJA 3KB8A 4Q66C 1KETA 5E9AA 3KV3O 2R6HA 2XCRB 2CMKA 3F3KA 4MV1A 3MTEA 1IWPB 4YJ2A 1NBMD 4UHBA 1M10A 1A5AB 1YNSA 1Y9AA 4QYSA 1JIUA 5EVJA 3ZU2A 4Q4CA 1H05A 2XYGA 3ZGVA 4INAA 1Q21A 1E58A 1JR4A 1HEUA 3NOOA 4JXKA 2NGRA 3C24A 4ZAVA 3IAEA 5LMZA 2Y3IA 4ARUA 4H7JA 2FWBA 2G07A 2PUWA 1BIFA 2VWPA 3MB8A 1F8XA 4XPIB 3K71B 4A27A 2ZBRA 3WOVA 4DLNA 1KNQA 1W25A 4DL9A 2BZSA 2ZDGA 1LPBB 1FFEA 4ZEVA 5GJBA 1Y6RA 4K9LA 2RDMA 2ZE8A 2VJNA 3B6IA 3DG9A 3D4LA 2YWDA 1A9XB 2TS1A 3LO5A 3SR3A 3MELA 5ERXA 1K98A 3WWDA 3S27A 4OU4A 3NXKA 3QSYA 2OWEA 1JALA 1M6VB 3MWEB 4NNOA 1K7CA 2EKQA 4FFBB 3TSCA 4GH5A 4ADSG 4BOYA 5BUQA 1UBJS 3FPGA 2WUVA 1X70A 3D4BA 4TUYB 2OOKA 4K6OA 4V38A 1YMUA 3N1UA 4K9SA 3HDVA 4O4LB 5BR7A 4EFNA 1DKRA 2GR9A 4L76A 3LY5A 1SCUB 1U2PA 2W2XA 4MR7A 3S6JA 5IZCC 1KZHA 2ID7A 3EZFA 5HF9A 2NQ8A 4YHBA 4B76A 5EJ5A 4ZCMA 1X7HA 2RGYA 4HDOB 3A4LA 1WB9A 5CDSA 4MDHA 4A6DA 2GJ8A 5TX7A 1IH8A 3GARA 4R3WA 2Y9PB 2BFEA 4CL3A 5K0TA 4N4AA 4DV0B 1CKEA 1H3NA 1ULTA 3SHFA 1RWPA 3GAFA 2AC7A 2EWWA 2W93A 4TTPA 3GJ3A 5EL0A 4BGUA 4DIMA 2QJWA 1JEDA 3WGQA 2WYUA 1ZD8A 1E4VA 1JYSA 2AG6A 4HAVA 2VYFA 1AKMA 2XX3A 1DJNA 4YJ2F 5ALGA 4M54A 5EESA 5FCDA 3VSBA 5CPBA 1JI0A 1UINA 3ANTA 3SNHA 5L3QA 3HDQA 3UF0A 2BMAA 2RKWA 3UAOA 1AZLA 4YRPA 4I6JA 5C0OE 4YX9A 1RJGA 3T7IA 1KSFX 2CLMB 3E5NA 4CKCB 3CNNA 1YRLA 1XF1A 4DA7A 4S2EA 4WFKA 1CDOA 3F5SA 3T41A 3D3WB 3SVZA 3HMKA 5AVZA 3WDSA 1JHPA 4QU5A 4BX8A 2ZRMA 5B1DA 4BMVA 4XX1A 4HQ0A 2ANBA 5E95A 3V7FA 3ZD8A 1VMIA 2OUKA 3SAJA 4WY5A 1BQ4A 1EVQA 5EWJA 2IOFK 2Z4SA 2QM8A 3T3HA 1A98A 2UXDB 2G82A 2R7KA 2QA5A 3HUFA 4YO8A 4DILA 1NQ5A 3N75A 3ESBA 1L4LA 3OZRA 3PNSA 3G2QA 3HE3A 5FTJA 2C92A 1LJUA 1XELA 3PHBE 2VH1A 5BP7A 4BAUA 1DAHA 1DWPA 1CLEA 3KJGA 4KIJA 5TMDA 3Q3EA 1FYEA 4X24A 1XV5A 4JU9A 3E7WA 3P1JA 4QJ4A 4AZVA 2D2VA 4Q1BA 3IP3A 3WL5A 4YMTA 4BNTA 4ZN6A 3X1YA 1K6MA 2PA3A 1SBYA 1RDFA 2ZBVA 3W3AH 2GM3A 2P65A 1SXHA 3CH4B 3WLHA 1NXSA 1JU4A 1Z4MA 3EGXB 4EF4A 1EDDA 4P4SA 3GOQA 1LBEA 1Z6XA 4F4CA 4OGLA 2P78A 4O63O 5ADUS 3W6NA 1E5QA 1YS1X 4JLKA 1B2RA 2F7SA 1XRLA 3L46A 1M83A 5F52A 4CMJA 4AJ1A 3VVBA 3SR0A 1TQHA 5JAMA 1DO2A 4HS9A 4PZCA 2DHDA 5JZSA 3FTDA 4KAFA 3WDMA 3F5QA 1QPBA 2A9QA 3O82A 4MPPA 5FUYA 2HLDA 3OEEA 1QWOA 4GP9A 4TMFA 3PK0A 1I4EB 3E4DA 2DTEA 3TQTA 2GXUA 3O4VA 1USIA 4QWMA 3I6QA 1TT5A 3E9EA 1TLFA 5LUAA 3NV9A 4TWAA 3JV7A 3OT4A 1GQSA 3QQ5A 1A27A 1SN7A 1ZRSA 2ATXA 3GFGA 4ZT2A 3UV7A 4M60A 2CVZA 4LDJA 4UUMA 2FXVA 2BBOA 3UAZA 2BGUA 1W44A 3AVPA 4YJHB 2JJQA 1D1PA 3GLHB 3IUBA 3DS8A 3KXDA 1Y3AA 3RFFA 3RYFB 3T1VA 1HE1C 3V8QA 4TWRA 1AOXA 3LKBA 1X3LA 3R0ZA 3C3PA 4ZOBA 4JJEA 2WYWA 4P4LA 2JH8A 2NQ2C 4X85A 5GJVC 1RJDA 3UJDA 4DBLC 1GZDA 1KEZA 3B7PA 2EW8A 3ZCXA 2ZJ1A 3TVYA 1XDDA 3LT4A 1GCAA 3QUSA 1LZLA 4KN8A 2JFOA 3ANSA 4CETA 1BFKA 3SFVA 3R44A 5FTWA 2J0QA 4H59A 1H9CA 2Q8QA 3R23A 4ETIA 2Q1TA 5LUBA 4MR8B 1SZPA 5CNJA 1R4MB 1TA0A 1XDUA 1XZ8A 4JYBA 1AGXA 5CDYA 4PYNA 5KPDA 3I6IA 3JQBA 3OTIA 5LWQA 3BJIC 4ES6A 1Z5GA 1RHUA 2GBCA 3IP5A 4E03A 1TO1E 5FBLB 4IDDA 2FWPA 2R751 4MRMB 4WD3A 3PPWA 4TYYA 3EPKA 3FFTA 3HWRA 4KRFA 4J3FA 2I2BA 4YO7A 2PKQO 5JDCC 1KYYA 1PNTA 1MQ8B 3RADC 3UC5A 4OLHA 4YJ3A 4DR5B 4CIXA 1YIAA 2NMVA 3TZ6A 1W581 5A2GA 1RTKA 1T91A 3CNHA 4TKUA 2GBPA 2FFHA 3CPEA 1EFVA 1OV4A 1A9YA 3H2ZA 5AYVA 1M6NA 1WO8A 3L8FA 3RIHA 3UQZA 3X0DA 4PQEA 3ND8A 1DC4A 1NVTA 4CR6A 4MYDA 3JYHA 2HBYA 2VPXA 3JWEA 5FI1B 1V41E 3RCBA 1GZ3A 1JR3E 2EBHX 4QSMA 3R4CA 2PKEA 2ZRHA 4R9NA 3A7EA 3K30A 4EP1A 4YV2A 1WHSA 4XPZA 4YJDA 5E7JA 4ENQA 5A4KA 4MMXB 5BWBA 3IAS6 1YI8A 4TLCA 3FR8A 4JBYA 4PHCA 5FBWB 1INLA 1P45A 5EEGA 2OENG 3UOWA 1S2IA 3E03A 4MWCA 1RM0A 4FB4A 1QK3A 1PL6A 1U6KA 1Z37A 3WLMA 5CG1A 3DUFB 3CRW1 5JQGF 2F8SA 4MUNA 5FUXA 1QOZA 2AYZA 2CWWA 3WX0A 4BWVA 2G8NA 3T94A 3ZNOA 2UZ4A 1J49A 1TZMA 5K0FA 3J81A 1WVMA 2C2ZA 4HAYA 3GUHA 3RKUA 1UF9A 4KXMA 2ZB7A 2R5NA 5HIIA 5KZMB 4RA6A 1HC7A 4RK7A 3TTUA 3D0RA 4IXNA 1CIJA 5LD2C 1TJYA 1FBNA 1FTNA 3GAMA 4YJ3F 3A3YA 4RYLA 3FGOA 3W1WA 2UUBB 2IV2X 3G6WA 4P35A 5CBPB 3U37A 1H1LB 1KFEB 1KI6B 3JAWB 4L8GA 1FQKA 1XEXB 1PFVA 1P5RA 1QFZA 1YR7A 1XZIA 2J6HA 2R8XA 3KBBA 1I4WA 4MIYA 3I92A 3CM0A 3LFTA 4HHEA 5AKJA 1E5XA 5FBHA 1O6CA 2O2SA 3ZD9A 4CUZA 4F5WA 4M0UA 1IHUA 5F9MA 1HBJA 4MICA 2EGUA 3T35A 5KYUB 1NR1A 5E6RB 3ND6A 5BXQC 1C7FA 5EQTA 3U3RA 2RGEA 3KT3A 3EJ6A 1Q0PA 3JY6A 3ROPA 1CW2B 3WKCA 4JI4B 1E2HA 4YROA 4AXBA 4JDUA 2ZITA 2G5GX 2GZDA 4P0TA 3ABIA 3DB2A 4AX8A 3HG7A 2OYRA 2QE7A 4MIEA 2GK7A 4AROA 4PAOA 3FRIA 2CK3D 4WUTA 3DM9B 4LWQA 2I6XA 5A5VA 1A0OA 2PGLA 1QS0B 1N8TA 1X1QA 1VMKA 2CFRA 2PQ6A 2YJ4A 3DEHA 4CDNA 2WJ4A 1W8DA 2P9GA 2LE0A 4Z0NA 1DRJA 1NP7A 1QTRA 3ECSA 3SBOA 3GFRA 1KTVA 3K9FC 1RKXA 4GYJA 5DXAA 5KNDD 3O26A 1QYRA 1Z16A 4DV3B 5LOVB 4TSFA 5E4JA 4HEA1 2W58A 5EE0A 3A4IA 5CT5A 1L7OA 4PX3A 1CY0A 2GD0A 2WP8J 2ZJ8A 3D7SA 2J3EA 5FWDA 3GU3A 1K8XB 2QRPA 2JATA 3EVDA 4O2RA 1EAYA 2Z2ZA 4BQOA 4J0KA 5C8YF 4ZVSA 4XZ3A 3P71T 4PQYA 1NOKA 2VPYA 3QW4B 4DSNA 5BV7A 1TTPB 3KJXA 1OFTA 1A9PA 2VJOA 1N0UA 1QMGA 1Y9EA 2WMDA 3CO0S 4TGLA 5EZQA 4D9EA 2XY4A 3TRFA 2EHJA 1CD5A 3HJBA 4JENA 2M2IA 4MWEA 4C2UA 1HMYA 2V3VA 4LJAA 3F98A 1KRWA 5IXSA 1W36D 1L4KA 1ZUD1 2L69A 3EIXA 4QYTA 4RQTA 1CUDA 1EDZA 2VAVA 4KQCA 1KYIA 3NASA 3KV1A 2IOQA 2BGKA 2D00A 2C1XA 1JEOA 2Y2VA 3FYUB 2Q0QA 3DOJA 1U2RA 5HIJA 1TUBB 3JAKA 3KU1A 3A6DA 5E4TA 4G4SP 3QVJA 2CC2A 3DZDA 4YCDA 3VZSA 5E2AA 2XCQA 1HQYE 4DEXA 1JG1A 3SF0A 3GFOA 2DBQA 2X8WA 3A4TA 4BC1A 2WJVA 2ZJ4A 2G5PA 3QKRB 4IINA 5A5GA 1B4DA 1R10A 3U4IA 4CHTA 4G5SA 2OBYA 3RTDA 4UHHA 4EGFA 3UNXA 4QASA 4Q3EA 3N86A 5G1NA 3TGWA 3H2SA 2P67A 1FDUA 4I5IA 4Y2JA 5AUQA 5L95A 3HV0A 2FSHA 4XUEA 4UMDA 1DFIA 4XQGA 5DTMA 3B9PA 3SICE 4CM4B 2J0UB 1P0FA 3KWLA 3KQUA 1E2NA 4NCNA 4B73A 2WIKA 4M7WA 1E77A 2TMDA 1J6UA 1NW8A 1U3DA 3AUKA 4LSWA 3C6BA 4YONB 4KOEC 3EGEA 1LRLA 3T38A 3TOZA 1MO6A 1QGUB 1B3RA 2HJRA 2IRWA 2W11A 1SCAA 3BH7A 3FHOA 3VTAA 4EB6A 1EX1A 4KO4S 5EJ4A 3R3SA 3WLFA 1DAIA 2DH5A 4IHQA 2DECA 2DUMA 1U2EA 3G1UA 3TZHA 4IIVA 1B73A 1L5GB 3CC8A 5DP1A 4HUJA 4G8BA 2QR3A 3CX4A 2VHWA 1V26A 2FUEA 2VN8A 1QIGA 1RSZA 1L4GA 2X7HA 2C8VA 4F6RB 3K2QA 3K1ZA 4NP6A 1G8SA 3ZH9B 3OLVA 4U1RA 4Z49A 1IZ8A 4GOND 3L7MA 4ZEMA 3D2BA 3CEHA 2P68A 1RBZA 3D7RA 4L1KA 4RF2A 4G4IA 4KWTA 1G3RA 4P6VF 1TA9A 4DADA 5HG0A 4EX6A 5JJBA 1XZGA 5T4BA 2JIDA 2BFDA 4HB4A 2HXYA 3KYCB 3MHPA 5I7UA 1MVOA 1R6DA 2UAGA 3DEJA 4MUIA 1IHOA 4WHMA 2ZBEA 1JEAA 4DANA 1UZLA 2H5EA 4ZAXA 5F35A 4O4IA 2YXPX 4M21A 1ZJJA 2PH3A 2XZPA 3ICOA 3X1JA 3T1TA 5F3RA 3JVEA 3ZZUA 2QPLA 4PZLA 2GI4A 2I1WA 3H0EA 3I2FA 1P4RA 2IDJA 3H5TA 4W9NC 1AUQA 2F48A 2YYAA 3BHNA 3R7NA 1A1VA 1ZK3A 4FFPA 2C3YA 4DR7B 3IT3A 4MWZA 4GR4A 2VDQB 4MW1A 1LDMA 4OQDA 1VG8A 3JW8A 3ELBA 4P3NA 3RUAA 4F21A 2HK8A 2HBRA 1TVCA 3CYFA 4AMZA 2FPLA 4HPWA 1GXSA 2ZJ5A 3M6UA 1KEPA 2VF4X 5IDXA 1JIIA 2BJVA 4MR9A 5GP1A 3BK2A 3Q87B 5T6MA 3QH4A 4UZSA 5IYZA 4HUQA 1TMYA 4HGYA 1FXWA 3B5EA 1JG2A 5EAIA 3FPEA 4WKPA 5B30A 4BP9A 1UZNA 2HAEA 1PTJA 1WM1A 4MS4A 4JEUA 3HP7A 2YIJA 2J6BA 3DPSA 4C5CA 2GF2A 2PZ8A 2HRCA 1DZ3A 2WA2A 4WGGA 2CVFA 3RQSA 1U3CA 3T99A 4TKZA 3TBKA 2Q3BA 3GF4A 5J23A 2AOTB 2OQVA 4BRZA 2BFFB 1K97A 1NBAA 4I5FA 1YKFA 4KVGA 4EITA 1XRJA 2PO7A 1NC1A 3KUXA 5KCZA 1CUHA 1KI2A