4B7UA

Plasmodium falciparum l-lactate dehydrogenase complexed with bicine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
316
structure length
316
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
publication title The Crystal Structure of Plasmodium Falciparum L- Lactate Dehydrogenase in Complex with a Novel Bicine Ligand
rcsb
source organism Plasmodium falciparum
total genus 118
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b7uA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4b7uA02
3EDMA 4ZVVA 4R1SA 1GR0A 2I65A 3PZBA 4WLUA 3RUAA 3FF4A 1RYDA 4AJ1A 1CF2O 1ISIA 4IIUA 1QP8A 1GZ4A 3UAGA 1DIGA 1JAXA 4OYRA 1GUFA 3RKRA 2W8ZA 4A7PA 3I9MA 1E5LA 1LBEA 2FSVA 4XCVA 1SEVA 1X7GA 3DC2A 1W6UA 4WE3A 2ZQYA 3D4OA 2QRLA 4LVUA 3EZYA 1P77A 1V0JA 4BL5A 1QXSA 2ZTMA 5MDHA 5CPBA 4OSOA 1DPGA 1I24A 1PX0A 3GFGA 4LRSB 2YDYA 3NEPX 1O8CA 4MKRA 4OOFA 4UEJA 4PLVA 2W2KB 3PLRA 2CY0A 2CMDA 4NMHA 1YGYA 4J1SA 3BMQA 1LRLA 1ZMOA 1EE9A 3DB2A 4ZA2A 5B4VA 3QLJA 4UAGA 2Q1WA 1QLJA 4HFMA 4BHTA 4OGWA 4G81A 1ZVMA 3KM0A 4I9NA 5CDYA 3G3EA 4DLLA 1K6XA 4F45A 2G1UA 5T8KC 2YY7A 3RC7A 3PZRA 5B37A 2PLAA 4IM7A 4NK5A 4EJMA 1BVRA 3OA0A 1H6AA 3DMTC 4L4RA 1YQXA 5KVSA 4EBFA 3U4IA 2AG8A 1M6WA 5B4TA 1I3LA 3BIOA 1PJ3A 5ER6A 1V8BA 2GR9A 2GN8A 3PHJA 4NH4A 3RD5A 4M54A 1SB8A 3JYQA 1IE3A 5DULA 4ZHSA 1V35A 4GGOA 4KQWA 3AK4A 2BELA 3NV9A 3ZWWA 2B5VA 1GYRA 4J1NA 4KWIA 2VWQA 5BSHA 3RKUA 1A9ZA 1AXEA 1YO6A 3OEYA 1LNQA 1R37A 3A14A 3P7MA 2NVWA 2JAPA 3DZFA 3IKVA 4II3A 4LN1A 4Y6PA 4GSKA 4UREA 1QLHA 4R9SA 5JCJA 3B1JA 4J90A 1YVEI 4AL4A 2DUWA 1KVQA 3CZRA 3PVZA 3K6JA 4D3FA 2WDZA 5TRTA 3ZWMA 4GX5A 4WNCA 4BO5A 1LXCA 4W7HA 1T1SA 2BGLA 2TMDA 4H7PA 5HA5A 4CPDA 3SX2A 3SLGA 3PFWO 4J7UA 4YRAA 5EPOA 5I9LA 3PIIA 4OXNA 2WWRA 3WGQA 4RLHA 3EK2A 1BHSA 4IDGA 3ONDA 1BXZA 2GRAA 3I9LA 4D0SA 1OAAA 1TT5B 2IYOA 3PDJA 3RU7A 3WJAA 5A9TA 1E3WB 2FMUA 1PR3A 4W9NC 4NJMB 2BRUA 1P3DA 3K31A 1YB5A 4BV9A 1I2ZA 5CDTA 3BMOA 1YDEA 3I52A 3JQ7B 3IAHA 1JDJA 4Q9NA 3K30A 3LZ6A 5KTKA 3I4CA 2NWQA 1E6EA 1KS9A 2X0RA 4DWVA 2EJWA 5C5IA 4ALMA 2HJRA 1ZKMA 2PD4A 4GX0A 2PD6A 3BXXA 4YAJA 2NTJA 4CMAA 2HQ1A 4Y9DA 4J2HA 4DXHA 3QWAA 1XG5A 2Y1CA 3TOZA 4NG5A 2Y1EA 1N1GA 3GHYA 3KEQA 5TJHA 1U3WA 1LA2A 2DU8A 2Z1NA 3DZKA 2WYVA 4E31A 4OXKA 1ENYA 1GZ6A 2BMAA 3WYEA 1VJTA 4CV3A 3Q11A 1P31A 4S1VA 4ALNA 2UUOA 1NNUA 3ZU4A 1LU9A 1BXGA 2B83A 3AUUA 4R01A 3H2ZA 1PGPA 1T4BA 3PLNA 3HB5X 3WMXA 3GPDG 1CQJA 1VSUA 4TVBA 1ZUD1 4NQZA 4BMVA 4LW8A 1M6HA 3W8EA 2JFHA 1B3RA 2VRCD 4BO6A 4BNHA 4CMKA 4B4UA 3H4VA 1JAYA 3DZHA 4GQAA 3KZVA 4E13A 4UEOA 1EFLA 5CDSA 3RBVA 1YBVA 4O63O 4YDRA 3PK0A 4XRRA 1H6DA 2OUIA 3U3XA 1ZNQO 2VYNA 1J6UA 3ZZNA 1I3NA 1YB1A 2GYYA 2DPHA 2Q1SA 4IDAA 1C1XA 2VZ9A 3QV1A 3PYXA 4PRKA 3CE6A 4YAEA 2WYWA 3DAFA 1D8AA 3GVCA 3HB4X 4XYBA 1BW9A 2FZEA 2VT2A 4BNIA 3NGXA 1PZFA 2X4GA 1L1FA 1K2WA 2GCGA 4YJFA 5JCXA 1B15A 1LDMA 1T24A 4DLAA 3FTNA 1E7QA 2O3TA 5EJ2A 2Y1DA 3BMNA 1I30A 1WLYA 4J91A 1K6IA 3SBOA 1GD1O 1YOVB 3VDQA 4BNGA 5DT9A 5EN4A 4XZ3A 3OICA 3QWBA 3TFQA 1Q7GA 2DBVO 1R0LA 4QSMA 2OMEA 3QVWA 3BTSA 3FN4A 3UHAA 1MFPA 3ZWPA 1X1TA 3Q3CA 3U09A 5HM8A 4N7RA 1I33A 4WASA 1DFHA 1Y5MA 3DBVO 2DBRA 3PQFA 4HFNA 1UR5A 3PGJA 4FC6A 4BKPA 3G49A 3LU1A 1HDRA 2VWHA 4YVFA 3ANMA 4ONEA 4MVJA 1HKUA 2JCXA 3BTVA 3BMCA 3G1UA 1DFIA 2QYTA 3E1KA 4FR5A 3RC9A 4OJNA 2G76A 4XDZA 3K2EA 5FI5A 3PYLA 1XIVA 4U0KA 1OOEA 1Y5RA 1RWBA 4PLCA 5CPFA 5ENVA 5TLSA 2FSSA 3WMWA 2EKPA 1A72A 1DDOA 3IQDB 3VC7A 3AFNA 2ZJ0A 5THQA 2VUTA 3WWZA 1OBFO 1RKXA 4J9VA 2BLLA 3OBBA 4IDBA 4YQYA 2YHIA 1ML3A 3WIDA 3HDQA 4FFLA 4L9RA 4XWYA 4UUPA 2HAEA 5L53A 2PKQO 2ZTUA 4BKOA 5JE8A 1LSOA 1GPDG 5DOVA 4U6SA 5A04A 2WM3A 3N58A 5L9AA 5THKA 4K1LA 1GCUA 4C7JA 3JQBC 2JAHA 3NJ4A 4GGPA 3QWIA 3JQFC 1UZNA 4CV1A 3TL3A 3GC6A 4R68A 2PD3A 4G5HA 2ET6A 1KVSA 4WOJA 2ZQZA 3JQ9C 4XB1A 3AOGA 3O03A 2OBNA 3UGKA 3EYWA 2Z1MA 4CM8B 3OH8A 4DA9A 2AMFA 3AI3A 3C7CB 3FSRA 1E3WA 1Y8QB 1HF3A 4H15A 4D41A 2O3RA 2RH4A 4NJMA 4ZRMA 4DPKA 5JCJD 5T57A 2X1HA 3GH3A 3I9JA 3KSUA 4K26A 2V7PA 5EL0A 5L45A 1ULUA 4IS3A 4CR7A 1HE5A 3DEYX 4NDNE 1P9LA 2AXQA 4GX1A 3M2TA 5BNIA 2QW8A 7ADHA 5H82A 1ZK2A 5HTOA 2BI8A 3F1KA 2I5PO 5GZ6A 1SMKA 1U3VA 3RFXA 4J4TA 4BNWA 6ADHA 2WSBA 4KTTE 3GGGA 3WS7A 1VPDA 3AOEA 1LC0A 3GT0A 4DC0A 2P5YA 5K6AA 1VL8A 3GNSA 4OOEA 4YRBA 3GK3A 3U5TA 2VUSA 4Y98A 4GMFA 4BNTA 4W4TA 3ZWXA 3ZWAA 1HDZA 4KDFA 3KHUA 4DQUA 3GGOA 3DAGA 1NWCA 3M2PA 4BQRA 5KNLA 3ORFA 1JVBA 1U2GA 3AFMA 1NFQA 1PL7A 5AXCA 1KERA 4OKNA 3BTUA 2BD0A 1H6BA 4RZHA 4ND5A 4UUMA 4TWRA 2ZCUA 1NQOA 3SEFA 2V6MA 4J7CA 4MP6A 3PHGA 5G4LA 2C07A 5CFZA 3ETEA 1ZZEA 1PJLA 2NTVA 4B7XA 3DFUA 3WR5A 5BR7A 3PQEA 2HMSA 2EWMA 5CDGA 4E32A 2HK9A 4XQEA 1E6UA 3ZHBA 1B16A 5CP8A 2EEZA 4ESOA 4A27A 1N8KA 3BHJA 4QECA 2GNAA 1XQ6A 4R69A 3U4CA 3QE3A 4FQ8A 2V6GA 2OP0A 3OF2A 3KRTA 1PS8A 3DOCA 1SPXA 3KTDA 2VN8A 3GA0A 4WNIA 2Q4EA 4D7AA 4Z0TA 4PG5A 4TSKA 3QY9A 5IDQA 5IF3A 1Z45A 3S2IA 1EBFA 2WE8A 1KEWA 1XGKA 2JD0A 1EDOA 1EK5A 2W2LA 4NZ9A 4ZD6A 3L4BA 1N1EA 1E5QA 2VYND 2VZ0A 2VT3A 1NM5A 2J3KA 3AM5A 4MP3A 2PWZA 5L3ZA 2YHUA 3D3EA 4W99A 4DYDA 3IKTA 3JTMA 2C82A 5IZ4A 3IP3A 1U3TA 4K6CA 4IMPA 3F3SA 4E5MA 3OQ6A 4RPJA 3RJ9A 1J4AA 4LSMA 1Q0QA 5CEEA 2JHGA 2VHYA 3DZIA 5IJZA 2I66A 3WYCA 1Q1NA 1QKIA 4HWKA 2Q1UA 5JDCC 1DRVA 4DPMA 1HT0A 1Z7EA 3BHIA 5DCUA 3HSKA 3RUCA 3DHNA 2NLOA 4II2A 3HHPA 4E5KA 2C7GA 1FK8A 3TPCA 3B70A 1UDCA 1KEUA 1C0LA 3LT4A 1QYDA 4I8XA 4PVDA 3HZZA 3RFVA 5C7LO 1U7TA 3IP1A 3FWNA 3E9QA 1WW8A 2QRKA 3ANNA 2E48A 3IC5A 4WLNA 3T4EA 3ZV6A 5FF9A 1R66A 2AEJA 2IODA 4BGIA 4BNXA 1YL5A 4MVJD 4RF5A 2Y05A 1M76A 3S2EA 2YV2A 3LC1O 3FNHA 3DAPA 1ZK4A 1A27A 3R1IA 4MVJF 4F3YA 3JD0A 4GSLA 1MP0A 3NX4A 4ZQEA 4Q39A 3ASVA 3WQQA 1ZK0A 1ZH8A 3ZGYA 1JTVA 5T67A 4GLOA 4KWHA 1N7HA 4ZICA 3RJ5A 1ZIDA 5KJEA 4JP2A 1KY5A 2AW5A 2I6TA 4WCDA 3U49A 4AJJA 4ZQHA 3TZKA 3FD8A 4AJIA 5EQFA 4L74A 5JDIC 2PFGA 1X0XA 3NJ8A 3L9WA 4CM8A 2DKNA 3UOGA 4WLFA 4IBOA 1DC5A 1Q7CA 1MXHA 1Y8QA 3ANLA 3HNPA 5GY7A 1R4NB 4EJ0A 4MVJM 3NDIA 5TQVA 3FHLA 4MVJI 3DONA 2C59A 4IGEA 1V3TA 4DIBA 4OIMA 4PG6A 2JJYA 1NR1A 2Q2QA 3K92A 1A7KA 2Q4BA 2B37A 2VWGA 4EZBA 4MVJH 3GMSA 1DFGA 2BFOA 1K0UA 1ADCA 3EAGA 3WYBA 3BZUA 3HDYA 3E9MA 2RH8A 1JN0A 1LDNA 2XXBA 3W6UA 4Z3KA 3UW3A 4Z0HO 2WD7A 4HBGA 1IB6A 3AY6A 3LYLA 4DIOA 4TZKA 5T6BA 1GFSA 3EC7A 1MB4A 2DBZA 4ALJA 2CVOA 3LT1A 3I4FA 3WJ7A 4CMHA 3JQAB 4Y8VA 3AM3A 3GVIA 5TS3A 2GZ2A 3B1KA 3DBHB 4DQXA 1CETA 3MEQA 4ITUA 3OHSX 3WNVA 1E1MA 3FI9A 4B3JA 1LLDA 3FNEA 2OO5A 4RVSA 2ZB4A 1UAYA 4LSWA 5C7IO 2C0CA 4QT0A 2EG9A 1H93A 3STHA 3IJRA 3AUAA 4EEXA 1M67A 1PWZA 3MJ4A 9LDBA 2J5KA 3LF1A 2ZTLA 3JQ8A 2FPPA 5TGDA 1D1TA 1BSVA 3PHLA 5TF4A 3QSGA 2VQ3A 2P9CA 5IZCA 3RBZA 2ZKLA 5IN5A 4QFCA 2BGMA 4BNJA 4GI2A 5A9SA 3FTPA 1X1EA 4XGNA 1B8PA 1F0YA 1P0FA 2EW2A 2UAGA 1WP4A 1H5QA 4OSPA 4WCFA 3WBFA 1KC3A 1DOHA 3U4DA 4K28A 3P19A 1XU7A 2AQHA 4WEQA 4YT5A 1W8DA 1WMBA 1E7MA 1MG5A 1U1IA 2DTEA 3C3XA 2VRCA 1B3BA 2A92A 5IFLA 4RVHA 1LTHR 5L7YA 3AW9A 3H65A 5JSFA 2WEKA 3ETDA 1EMDA 2Q2WA 3OIGA 1NHWA 4O59O 1JQBA 4QO7A 3GHHA 2EP5A 3GMDA 4J9UE 4B4OA 4M1QA 1QRRA 1G6KA 1QYCA 3WGHA 1A71A 2QIOA 5JBIA 1T1RA 3ZI0A 5A05A 1HYEA 3F47A 4WEOA 1PU2A 1HZZA 3L6EA 4W82A 3K73O 4WGGA 5EERA 4BO0A 1R15A 4ROSA 2Q3EA 1U9JA 3FR7A 1U28A 4KDEA 4LVCA 2XOXA 4DTIA 4YJHB 5B1YA 2ZYAA 3CZMA 2W2LD 1E7SA 1EZ4A 2IZZA 3WLFA 2J3HA 4F6LA 3N7UA 1IOLA 5EINA 3TWOA 1U3UA 2CZCA 5A1TA 1KOLA 5L51A 1EVIA 4K6FA 2PH5A 1JW9B 3PPIA 2OL4A 2YW9A 4AJ2A 2OZPA 3O8QB 4JNKA 4NNJA 3I83A 4FPXA 3EVNA 1TXGA 2ZB7A 1IULA 1T2DA 2GO1A 4LGVA 2X5KO 3BHMA 3D5QA 2O48X 2BF7A 2HMVA 3ZWOA 1F8FA 1ENOA 1H9BA 4U0JA 4PCVA 3V1TC 1VLLA 1YQDA 5I7EA 4YCAA 1LLCA 4CMEA 3EGOA 3E5RA 4IJVA 3ICCA 4FW8A 3PI7A 3H8VA 1KBZA 1NQAO 4J0EA 4Q3AA 4DREA 7MDHA 1GV0A 2UYYA 4TMFA 5BNTA 2O2SA 1XA0A 2W90A 1DHTA 1CWUA 1N2SA 3T7CA 1GUYA 5JY6A 1N7GA 3S55A 4M55A 2NVUA 4XYEA 1C1DB 4BS9A 3INGA 3HFGA 3ITDA 2B69A 3OA2A 4EJ6A 1VRWA 1ISJA 2O7SA 1E7RA 4YR9A 3C1OA 2GN4A 4BOYA 2B0JA 3AUSA 3VZSA 3OP4A 2CF6A 1F14A 1SOVA 4B79A 4CQLB 5T5QA 1R4MA 3MJEA 5KOIA 1XELA 2X9VA 4NU5A 1FDUA 1DRWA 3LT2A 3OMLA 1JA9A 1P1FA 4BB5A 1DSSG 1R4NA 4GVXA 1EDZA 1DAOA 4Q3EA 5TT0A 3ZV5A 4Z6KA 4UEKA 1W0CA 5JPIA 1ADGA 1A9YA 3IMFA 4LCEA 1XR3A 3WQRA 3S2FA 5KJ6A 3OIFA 4RO0A 2QZ9A 3EVTA 5F3RA 4YEDA 3ZDFA 1NFFA 5A4DA 4BMNA 1LI4A 4BNMA 1HZJA 2ZYDA 1YH3A 4BMSA 4Y6RA 2X5OA 4XA8A 1YBMA 3CTMA 2JCVA 4E12A 3E5MA 1UDAA 1HE4A 3T7EA 2O3SA 4IMRA 1V9LA 3QVTA 2BFPA 4PG7A 1KC1A 1WDKA 4E2YA 4EDFA 3JQAA 5LDHA 1EQUA 4D42A 4PIVA 4ALKA 4PZDA 3CPSA 4DBZA 3KV3O 2C5EA 4KOAA 4QQRA 1HL3A 2NQTA 2YV3A 5JY1A 2X0IA 3W8FA 1CERA 2VHXA 1R0KA 3FRJA 2BGKA 1MGOA 3KLPX 3FBGA 4N5NA 1ZO8A 2Q46A 4RQUA 2J6IA 3KBOA 4RPGA 1Z82A 3W8DA 4BO7A 2VWPA 1G1AA 4OHUA 1BGVA 4P38A 4FFPA 4N5LA 3E6AA 4YAKA 4ND1A 1QYVA 3TZ6A 3ZNOA 4JBHA 1NYTA 3PHIA 5DDIP 4NHEA 3SVTA 2NUAA 3UICA 1GEGA 4FB5A 2GDZA 3KETA 4BO4A 4OO3A 3M6IA 4FFOA 4U5QA 4JX8A 2RBEA 1L7DA 3L0DA 2I3AA 3JSAA 4PRLA 4E33A 5I8WA 1T2CA 1XWFA 5U4QA 3GVPA 2CVQA 1Y1PA 1NVTA 1CDOA 4HUJA 4LMPA 3DFZA 3DWFA 2VCYA 2NTNA 1LSSA 2CNBA 2QHXA 4FOSA 1AXGA 3JCZA 3IJPA 2UV8A 4UVIA 2B4TO 2YFQA 3AI1A 3L9XA 3HE3A 4AJ4A 1JWBB 2VYVD 2Y68A 1SAYA 1TT7A 3WGOA 3BAZA 4FDAA 4OMUA 3RUEA 4BNLA 2CUKA 5IDWA 4R3NA 5T8KA 3VKUA 1QG6A 3DL2A 3GZNB 2OFPA 1ZMTA 4TKLA 3DMTA 3I6IA 1EBUA 4IGFA 3PXXA 4PG8A 3GG9A 4L8VA 1VJ1A 1A7AA 2B36A 4CMBA 3B1FA 2J5QA 3GOHA 1OZAA 3H9GA 4X54A 5EESA 5FI3A 2VUUA 1WXDA 3QRWA 3ROQA 4M89A 2X0NA 4RDIA 3ZNNA 4JJFA 4IQGA 3INTA 1SC6A 4L4XA 3ZV3A 5ES3A 1AHIA 2HJSA 1JVSA 2CFCA 4PLHA 1C0KA 5A06A 4JCOA 5JFOA 1JLLA 3RI3A 3ENKA 5KJCA 4HFJA 3PJGA 1F06A 4LRTB 5H83A 1H0KA 4PLTA 5EQDA 3B20A 4E2XA 1Z74A 4Q3BA 2NV6A 1MG0A 1ZJZA 3JYLA 1PZHA 3QA9A 4R9RA 2EKQA 2DAPA 3ONEA 4OL9A 2PZKA 2AQ8A 3DO5A 2RCYA 3EUWA 3TZCA 5COAA 2ZIZA 1GL3A 3IDSA 1BDMA 1YWGO 2W2KA 2D1YA 2J3IA 3ITKA 1GPJA 1ID1A 3F4LA 4DMMA 5I7VA 1RYEA 1E3SA 4W9NA 2WTBA 2OOSA 3ZHYA 4GKBA 4GMGA 3OEWA 3JD2A 3ZU5A 5KVVA 2OORA 1UZLA 3I5MA 4CMGA 5HS6A 1PJBA 2HSDA 3ZN2A 4JJGA 3WGTA 1MFZA 3GG2A 1Q0LA 2D5AA 3JQGB 3O9ZA 3F1LA 3UCFA 4EEZA 4XDYA 3S2GA 3LC7O 1RM0A 3S8MA 2C5AA 3BA1A 4R4JA 3WXBA 2R2GA 4CL3A 1EE2A 2C2XA 1B7GO 1ADFA 3GFBA 5G0UA 2NQ8A 3MZ0A 4RLSA 1NR7A 3OETA 3VPXA 4P4NA 5DNAA 2X5JO 1XLTA 3ZW9A 5TC4A 1I10A 1P0CA 5JAZA 2XF8A 3HN2A 2Q50A 4QUKA 3H9UA 4FFNA 2XPCA 1EQ2A 1NHGA 1GZ3A 1PR9A 4Q3CA 3U9LA 3BYZA 2R6JA 2WD8A 4P4LA 4XJTA 3G79A 4FN4A 3CSDA 4AJOA 1VKOA 4NFYA 3FR8A 3C8MA 1T26A 4N54A 1NPYA 5AXAA 2HMTA 1Y9EA 3D7LA 3ZWCA 3C7AA 4YWJA 4E5NA 4ALLA 3LF2A 3WSWA 3PGXA 3FBTA 2BI7A 1F8GA 4IDDA 1TT5A 2Y1FA 5G4KB 5GZ3A 2EF1A 4J0FA 4NBUA 1KEVA 4A5OA 3DTYA 2G0TA 2JFFA 1LQUA 2UDPA 3E03A 3JQAD 4FIZA 4RPKA 2VHWA 5I7FA 3IL2A 2J3JA 1LLQA 1O5IA 1NQTA 3JQ7A 3VZRA 1SNYA 2LDBA 5F21A 3VOSA 1DLIA 1GEEA 3V1UA 3HG7A 4Y67A 3H6KA 2VRBA 4AJKA 5F1PA 5G2OA 1DLJA 2Y67A 3AY7A 4IDFA 4UVDA 3RU9A 5IN4A 4IQ8A 2YFHA 3JD1A 4BNFA 2V6FA 2Y0DA 2NNLD 5IXSA 3K9QO 1UXKA 4R51A 3O26A 2EKLA 2GERA 4NFSA 1EUCA 2X7HA 6LDHA 4C4OA 3GAFA 3NAQA 3DBRB 3QWHA 2DTXA 2GN6A 1WWKA 2E6UX 3X2FA 5CEJA 1LDBA 2Q45A 2Y1OA 3WOHA 2VNAA 3VDRA 1TA4A 2VNSA 3PDUA 2DFVA 4XIJA 4ND4A 3PWZA 3TFOA 1BMDA 1N92A 2AHRA 3ULKA 1J5PA 4FCCA 4Z9YA 5T64A 3QJ5A 5C7OO 3QW2A 4CR6A 1ONPA 2DUUA 2Y0EA 4HY3A 1XHLA 2YDXA 3AU8A 3ZCXA 2WYUA 3A9WA 5C37A 3VHRA 2P9GA 1AHHA 2IYPA 2VTEA 3UN1A 4BUCA 1I2CA 1QV6A 3IS3A 4D46A 3MJTA 3GZNA 1J49A 2R00C 3WX0A 5HRUA 4EW6A 3K2BA 3NRCA 3ZNQA 1DIAA 1PQUA 1VM6A 2XAAA 5I9MA 1OC4A 4NBTA 3H2SA 2PKQP 3MJCA 3EZLA 1PGNA 1GV1A 4EI2A 2X86A 2CDCA 4YTEA 4N5MA 2VHZA 4M87A 1GQ2A 3PEFA 3Q2IA 3CEAA 1NAHA 4I08A 1S7CA 4JROA 3WB9A 2X58A 1PGOA 2ZJ1A 3RAJA 2B4QA 2FPIA 4JK3A 1QSGA 5DCYA 3W4KA 4UVEA 2SCUA 3D0OA 3AJRA 2IXBA 1U5CA 1AGNA 4GWKA 2UVDA 2PV7A 1GUZA 3OFSA 2AE2A 3JQBA 4I5DA 1YOVA 2XXJA 1LRKA 3JQFA 1HETA 5DOZA 1B26A 5BSGA 2Q99A 2YQ4A 3H7AA 2YZ7A 4O0LA 4CM9A 2C2YA 1WPQA 1GYQA 3Q1LA 3JQ9A 3ASUA 1GDHA 1HWYA 5HWSA 3OJ0A 1MLDA 4PZCA 4XQ9A 4D79A 2DM6A 4NBVA 4WOKA 4GPD1 3I3OA 3NTQA 4CMJA 1T2EA 2PGDA 4ID9A 1NAIA 4QEDA 1T2FA 2ZATA 3BTOA 3RBXA 4E3ZA 3ZU2A 2QRJA 3Q0EA 2NSDA 3NKLA 3DZBA 2CD9A 3JQCA 3JQGA 2D8AA 4E2WA 4DQVA 2RIRA 4YACA 5L7WA 3OSUA 4QXMA 3T4XA 1CQIA 1UJMA 2HLPA 3RVDA 3NT4A 2O7QA 4I9HA 4CM5A 4CLXA 1XCBA 1ZSYA 4XYMA 4B4WA 2QYSA 2HKIA 1U5AA 3W1VA 1YONA 2I99A 2G82A 3VZQA 2H9IA 1GQQA 3VKVA 2Y1GA 3D5TA 4C7KA 1B2LA 4J49A 1EVJA 4UUOA 5TX7A 5DBGA 2HK8A 4J7XA 1QYXA 2DLDA 2POQX 1EK6A 2G5CA 1Y6JA 1DB3A 1TI7A 3RC2A 4DPLA 4KZPA 1YRLA 4BO8A 3QQPA 3VAZA 3ON5A 1HLDA 2H1SA 3VH1A 1PWXA 1QR6A 3MWDB 2PGJA 3KB6A 4E6PA 3S1LA 2EXXA 2H63A 3PQDA 3L07A 2DQ4A 3EY4A 3KYCB 1Y81A 4IDEA 4URFA 3ROKA 3DMYA 1ZK3A 1ZJYA 5CEFA 5ILOA 4FJ1A 3CMCO 5KVCA 4OH1A 3LK7A 3W4IA 2NACA 1NPTO 3M1LA 4XR9A 4BGVA 3OJEA 1ENZA 1XYGA 3CH6A 2Q2VA 4XGKA 3H9QA 4NBRA 3N74A 1E3IA 1P1HA 4J1TA 2D5CA 1D4FA 1IPFA 4YBZA 3WWYA 2FHSA 3HDHA 3DBLB 4IJKA 1IUKA 4J16A 3RUHA 2VZ8A 4W7IA 2FN7A 4XQCA 4MVJE 1W73A 3PIDA 1U4OA 2BFAA 3H9EO 2Z95A 1K6JA 4DRYA 3NTRA 1CIVA 1HDOA 1U7HA 1M75A 1M66A 3WFIA 4YJGB 4CM7A 3P2OA 4FC7A 4A0SA 3GRKA 1HSOA 1P1JA 3MWEB 4TRMA 1IZ0A 5EMHA 2NU8A 2HRZA 1HDCA 3DBRA 1GTMA 1YBAA 2PGLA 4ILKA 3CUKA 1I36A 1C3VA 2FPGA 1MUUA 2JCYA 5CG2A 3SXPA 3GUCA 2GF2A 4BNKA 2B35A 4L4SA 1WZIA 5JLAA 4HFRA 4I5EA 3ZWYA 1D7OA 4U8GA 3AWDA 1ONOA 5A9RA 5AVOA 3A4VA 1PJSA 4RCVA 4FJ2A 4F6CA 1MV8A 1ZEJA 1MX3A 2O4CA 5JDCA 1GCOA 3NGLA 1PJ4A 4D3DA 1LUAA 4XYLA 1DC4A 5G0VA 1RPNA 2C29D 3C24A 1Z6ZA 1HSZA 2ILTA 3MJSA 4J1QA 3WLEA 1MXFA 4CR8A 1SB9A 2JHFA 4I9UA 1TEHA 1IYZA 2GASA 1MA0A 3DDNA 4FBGA 3OJFA 4RL6A 2AEMA 4JN6B 1PIWA 4OXYA 4CQMB 4RF2A 3ZH2A 2VYVA 4E2ZA 5TT1A 4P4GA 1UP4A 3DXFA 8LDHA 1O94A 4ZQGA 3V2HA 1PL8A 4MPDA 1YQGA 1EVZA 5I7SA 2HUNA 4MVJG 3DHYA 3D64A 4KTVE 3BMOB 1PS9A 3PWSA 1AN9A 4BV8A 2D59A 2ZB3A 2EERA 3G0OA 5EIOA 3NDRA 3GF4A 1KVRA 5JDIA 3FNGA 1RM5A 2D4AA 2TMGA 1KETA 2HK7A 3LVFO 3IOYA 4XD2A 3TSCA 1DO8A 2YJZA 1ISFA 2IZ0A 3C85A 3RROA 2E82A 5COBA 1LDEA 3EMKA 1B14A 4GLLA 1IPEA 1PS0A 4PLYA 4YYZA 1C14A 2D2IA 5IAAA 3HDJA 3OM9A 5AXBA 1DXYA 2QX7A 3TZQA 4XKJA 5ICMA 4YAGA 4CL8A 2P4HX 1YB4A 5IDYA 3VH2A 3VPSA 5JO0A 1NFRA 4MOWA 1UP6A 1X13A 4GH5A 4EUHA 1YDWA 2UUPA 4CM9D 1E7WA 3LC2O 4W6ZA 5KJFA 1C0IA 4OQZA 4JGBA 4YA6A 1D3AA 5ILGA 2W4QA 4NK4A 2J5RA 4J43A 3ROMA 4Z3DA 2P5UA 4M8SA 3OECA 4M49A 2H6EA 2EHDA 3GDFA 4DYVA 1H6CA 2AQIA 5CHEA 4HKTA 4JQCA 4Q3DA 2CF5A 2CDAA 3SC6A 4ZGWA 3RUFA 4JJIA 1Y8RB 3KSZO 2VOEA 1CRWG 4N18A 4O6VA 1CJCA 4WUVA 5L4SA 1BWSA 1BW9B 1E77A 1O89A 2Y99A 4RVFA 3ST7A 1ZXLA 2GGSA 1IY8A 1NTOA 1FJHA 1Y9AA 4YJFB 2PZMA 3U4HA 3VPHA 3KYCA 1DAPA 1O9BA 3JYNA 4FFMA 3WG9A 3OQBA 3PJDA 1P1KA 3F5QA 3BMNB 3HADA 2IEBA 3PFFA 4LMRA 2X9NA 4DBVO 4ZRNA 4HV4A 2NU7A 3E9NA 3W6ZA 4BIIA 2AEFA 2D3TA 4L0QA 2E4AA 4G65A 4R1UA 2OHXA 5B12A 1ORRA 4KUEA 1OFGA 4CUZA 1NQ5A 4JP3A 1D1SA 4CODB 3DBLA 3UKOA 4D0RA 2OBYA 1NWHA 3QVSA 5KWEA 2AE1A 4GAEA 4LCJA 2BH9A 4CLHA 1KEPA 1FXSA 1XEAA 1P1IA 4UULA 1EVYA 4YJGA 1U4SA 1R16A 3V8BA 2GZ3A 1O95A 5F1KA 2A94A 3BMCB 1FMCA 2CSUA 2GUGA 3I1JA 1WDMA 1V3UA 5BNFA 3SLKA 5U1PA 4IS2A 1UZMA 4RQTA 2G17A 4PG4A 4JBGA 1N9GB 1ISGA 4XGIA 3I6QA 4E21A 5KIAA 5J23A 1E3JA 3UXYA 2P4QA 3I23A 3U62A 4WKGA 3COSA 1QV7A 1LDGA 3DBHA 1E1LA 1VKNA 3C1TA 2GSDA 2X6TA 4NI5A 1Q2XA 4CUKA 2YUTA 2RAFA 3IUSA 1UUFA 3CINA 5F5NA 1IHYA 1PZGA 4R5HA 4IZIA 2YHIB 1A5ZA 1NXQA 3KYDB 5G0WA 1UH5A 2C7VA 1DC3A 1I2BA 4H3VA 3OQ1A 2FWMX 1PEDA 1T2AA 1HXHA 1DHRA 1R0SA 2HRBA 2CVZA 4YPOA 4HX5A 3F6YA 2NVBA 1NASA 3KUXA 1MC4A 3AI2A 2C54A 3E8XA 5DP1A 3A28A 3Q9NA 4Z9FA 1A4IA 1BG6A 3ZWBA 5HS4A 3HQ4O 3GDGA 4EITA 1AE1A 3RUIA 3AY3A 4NR0A 4Z9XA 1DJNA 1N5DA 2JL1A 4BQPA 1Z75A 1C0PA 4CQMA 2JKVA 3L6DA 1ZSNA 1P33A 5IXYA 1B8VA 4BB6A 1I0ZA 2EP7A 1G0OA 2I76A 4CMCA 4CLRB 3H5NA 1HYGA 5A03A 1HRDA 2A9FA 5DF1A 1YL7A 4PLPA 2FZWA 4CV2A 3WGYA 4YT4A 3GN1A 3ZW8A 5JNLA 4ZQFA 2EJVA 4XRGA 5COQA 4IXWA 5FYDA 4UUNA 1VE9A 1IZ9A 2Y93A 4XR4A 1XKQA 3ICPA 2DPGA 1UXHA 4XJSA 2YV1A 1HYHA 4EGFA 3ETGA 3UCEA 3IUPA 2IDZA 1GYPA 4YJHA 4DVJA 4ALIA 1UP7A 3FNFA 4WLVA 3F4BA 1P44A 1X7DA 4RV9A 3E18A 3DQPA 1ENPA 3H3FA 1IHXA 1K3TA 1ZFNA 4L76A 5HBRA 3DOJA 5FFFA 4MINA 5KVQA 4A2CA 4FJ0A 4TROA 3P5SA 4WLEA 4BNVA 4RF4A 4A03A 1QORA 2O23A 1H2BA 4OM8A 3EW7A 1F12A 2X0JA 4MO2A 4QX6A 3O8QA 4AJLA 3GEGA 4YT2A 2FOIA 3VH4A 3VH3A 4HXYA 1LC3A 3WQSB 2FY8A 4CM3A 4CMIB 1ISHA 4DL9A 1AUPA 4CLOB 3FPCA 4FS3A 4O1MA 5AOVA 3LLVA 4LK3A 4CLDA 4J2OA 4IINA 2HCTA 4P22A 4XIYA 3JQ6A 3V1YA 4B7UA 2F1KA 1LSJA 2EW8A 1E3EA 1Y8RA 3NDJA 4RVDA 3WFJA 5JS6A 4RF3A 3L6OO 4MJLA 4PLWA 3UCXA 2OP1A 2JFGA 3RFTA 1SZJG 4O5OA 4WLOA 1I5RA 3MOGA 1LSUA 2NADA 1C1DA 2B5WA 3F46A 3OJOA 3WNQA 1K5HA 4IZHA 3MTGA 3PP8A 5A5FA 2FR0A 1EUDA 1SOWA 4IJUA 4XQGA 4CQLA 5LC1A 3WBBA 3AOEC 5K6AC 5AQ1A 1XQ1A 4FGSA 4J6FA 3KOUA 4Y6SA 1E6WA 4RVGA 4CM1A 1GU7A 2WJPA 3MCVA 4PFJA 1HEUA 2PR2A 4YRDA 2BKAA 1ONNA 4BO3A 1EUZA 5DN9A 1V3VA 3O4RA 1O6ZA 1LRJA 3K8ZA 3NUGA 3TDKA 2E37A 1PJTA 4I5GA 4Q3NA 3WDSA 4RPLA 4GL4A 4QFDA 4ND2A 4B7CA 3ZWNA 3VVCA 1ZXBA 1E1NA 1FDWA 4AVYA 2PTGA 3FWZA 3TRIA 1UAGA 2O4UX 5F1OA 4E5PA 2A4KA 3DTTA 3NT2A 3Q2KA 3V2GA 5JW6A 5JYDA 1HDXA 2EV9A 3GUYA 4UVGA 1N9GA 3UF0A 4FGWA 4R16A 4PLGA 2HU2A 4OAQA 4AG3A 4D45A 2DVMA 4IY1A 3ADOA 5JXWA 2RHRA 2LDXA 1I01A 4YJDA 1F17A 3GPIA 2RHCA 4B4VA 1GAEO 2ZB8A 1I8TA 3R3JA 1I3MA 2Y66A 3CMMA 3V2UA 2I3GA 2YYYA 1JKFA 5B4UA 1Y7TA 1YXMA 3KYDA 4P8RA 4OKIA 2PK3A 1XU9A 5DCWA 3RQSA 1SCUA 3VVBA 1PGJA 1H94A 3QIVA 4PLFA 5CDUA 4TQGA 2IZ1A 4R54A 3FPLA 3PTZA 4CLEA 3UVEA 2X23A 1FDTA 3L77A 1X0VA 3R6DA 3L4BC 3O38A 3KLMX 3V5NA 1A4UA 1WDLA 4HNGA 1VI2A 4J3FA 2W98A 4RDHA 1KVTA 3JYOA 1U8FO 4ZU3A 3R0IA 3ONFA 4ZJUA 4KQXA 4DLBA 1TB4A 4I5FA 1O0SA 4DGSA 1BDBA 3G1TA 1E0DA 1NX6A 1U8XX 5KJ1A 2X22A 1M2WA 1ZSVA 1P1RA 3AM4A 4UVHA 5K9ZA 1VJ0A 2HO5A 1RM4A 4CLRA 5K0ZA 2PZLA 1G0NA 1LLUA 4OQYA 3QP9A 1I32A 3RC1A 4BGUA 1U2DA 2ZCVA 3E82A 4MKZA 4RJTA 4AFNA 1W4ZA 2WMDA 1B0AA 5KKCA 4RVUA 4HNHA 1SEPA 2PNFA 1DIRA 4AICA 4LISA 3DZJA 1PTJA 5ITVA 1PSDA 1YJ8A 1Z7BA 1VL6A 8ADHA 1WVGA 2D0IA 5U9CA 4U7WA 4R3WA 4CQMD 2WD7B 1DIBA 3KEOA 3X2EA 1E92A 3K5PA 2JD2A 2VOJA 4D3SA 4IPTA 2OXIA 4WPGA 5I8ZA 3FCOA 5I9NA 3WGGA 2DTDA 3KXDA 4NFHA 2C20A 5TJ9A 5F5LA 1DJQA 3PJFA 1E3LA 1X14A 4TKMA 5TIIA 1XDWA 2IXAA 2ZTVA 3GZ4A 4QO8A 2EIHA 1PGQA 4B8WA 1DIHA 1WAMA 3SJUA 1EEHA 3OIDA 1ULSA 4BVAA 1NP3A 5BQFA 4CMIA 1DEHA 2O2YA 3RWBA 3D4PA 4EUFA 1K89A 4CLOA 5FEUA 1T4DA 2B4RO 4DIFA 2GZ1A 4RGBA 1KIFA 2NU6A 3D3WB 3R3SA 3VZPA 3TL2A 2JD1A 2PY6A 3JQ8B 4ZN6A 5MGBA 3ZHXA 1V6AA 4R41A 5L4LA 5JO9A 2VHVA 1H2HA 2GD1O 3GAZA 4BGEA 1P45A 4MIOA 5A9SB 5CAEA 1GADO 3GLQA 4E0BA 1GY8A 1LDYA 1PZEA 1LJ8A 2PA3A 5A02A 4JXKA 3LT0A 2E49A 2PKRA 4HADA 1DC6A 4WCFB 4YAIA 4BO9A 2DC1A 1JWAB 4E30A 5BSEA 2O3JA 4PGFA 1KY4A 1WNTA 2HMUA 3WICA 4KUHA 4AJEA 2O3UA 4DUPA 2DFDA 5AXDA 1LX6A 3VTZA 3CKYA 1Z73A 3ZNPA 5DP2A 1S6YA 3KVOA 4BKUA 5G0SA 3DOOA 2AA3A 1UXIA 3HN7A 4KP7A 1CEQA 4I1IA 5CG1A 2V6BA 3GQVA 3GVHA 4JLWA 5A3VA 1Q0HA 3D1LA 2FP4A 4KUGA 3RUDA 5L40A 4R1NA 2NM0A 4PN3A 3JD3A 1ISMA 4NPCA 4CM4B 5BSFA 1OC2A 2IEDA 3TJRA 2FR1A 1CYDA 1HE2A 3LQFA 1UDBA 1RJWA 4YXFA 1EFKA 1E7YA 3C7DB 2Z5LA 2VTDA 2Q1TA 2EGHA 3TQHA 1SBYA 1R6DA 3ZHZA 3F5SA 5TNXA 1JU9A 3H3JA 4INAA 2AG5A 4JBIA 1YS4A 4GBJA 9LDTA 3PJEA 5JAIA 3TN7A 5L95A 4DMLA 3I9KA 1YE3A 5A3JA 1PQWA 4Z0PA 5IZCC 1HDGO 1RM3A 4CM6A 4L75A 3I9NA 4ND3A 2GN9A 4NU6A 5ER9A 4J4BA 1LEHA 3INRA 3MOIA 4HP8A 1NBOA 5JMPA 2PZJA 1WZEA 4RZIA 1SO8A 3A06A 4YB8A 1J0XO 5LCXA 3TZHA 4CUJA 2QQ5A 3JYPA 5H81A 5L7TA 2J8ZA 4WCFC 3F9IA 4D43A 4G2NA 1DRUA 1MC5A 4S3MA 2IRWA 3WGZA 1LQTA 3M1AA 2DT5A 1KVUA 5KCZA 3Q6IA 4H16A 2A35A 2R00A 5G4KA 1QMGA 1FDSA 1BRMA 3AUTA 3GEDA 3GN2A 4IXTA 3TNLA 3A1NA 3PRJA 4CJXA 5JC1A 1I3KA 4MKXA 5JAMA 1OI7A 4BO1A 3GGPA 1HLPA 1NPDA 2NVUB 2NU9A 5TSDA 2ZYGA 4GKVA 3B6ZA 5LDGA 3ROPA 1FF9A 2P9EA 3RIHA 3GDOA 3HWRA 3ENNA 4BNZA 4TZTA 1HDYA 1VC2A 2HDHA 3TF5A 1T25A 3ABIA 3BMQB 3ZU3A 4BKRA 4U6QA 5JYEA 1R4MB 4TVOA 4E5YA 1IL0A 3UFXA 3VPGA 5GZ1A 3RSHA 2CDBA 4MP8A 3SJ7A 4AJHA 5ITWA 3MTJA 3I9OA 3VPFA 4GWGA 4MIYA 2P68A 4YQZA 4BNUA 1ZCJA 1R12A 2O50A 4A10A 4KMSA 2EGGA 2F00A 3NT5A 3QWFA 5C3MA 2OGUA 5JMWA 1GQYA 4EYEA 4XEHA 4MIEA 4BO2A 3SC4A 1P74A 3KO8A 2V65A 2X9GA 3MJVA 3D4NA 3RCBA 3H5AA 1KYQA 4IUYA 3EHEA 3WSVA 1FDVA 1TVEA 2FR8A 4FD3A 1WMAA 1VL0A 3L4SO 4WECA 4B3IA 3NTOA 1H9AA 3JQEA 4NBWA 3DZGA 3JD4A 4CMEC 2P91A 2Q49A 5IG2A 4R1TA 5DZSA 3UH1A 4J4HA 1PJQA 1UXJA 3LLSA 4XYGA 1B8UA 5ENDA 3ZV4A 2YQ5A 3PYMA 4RPHA 5ICSA 4XX0A 1PQPA 1Q7BA 1HTBA 4MVJP 3Q9UA 4IIVA 1ZK1A 3PHHA 3HUDA 1ARZA 3D3WA 1YKFA 2HMWA 3KYBA 1QYWA 1VSVA 1E1KA 1ADBA 3W4JA 4DC1A 2FRDA 1BTOA 4B8ZA 2ZK7A 4EUEA 2IE0A 4GX2A 5AYVA 1NVMB 4IJWA 2O3QA 4NJOA 4B3HA 4WK6A 1HE3A 4A26A 4QTZA 4E4YA 4PLZA 1XSEA 3GY0A 1DBVO 4FOOA 3AU9A 3E48A 2AQKA 3QVOA 2DBQA 4FFRA 4MDHA 5KKAA 2BHLA 1YJQA 1ZEMA 3TOXA 4XB2A 4ZQBA 5IDXA 3IIEA 3H9JA 1OMOA 3QVXA 4TRNA 3U0BA 4AJNA 5A5EA 4M86A 3K96A 3HJAA 2I67A 4FSHA 3JQDA 2GLXA 1TLTA 3WTCA 4GVLA 5FWNA 3OJLA 2WE7A 3LSYA 1BXKA 1ZBQA 3ADPA 3CXRA 2H5LA 5ADHA 2QZZA 1L7EA 1NVGA 2Y0CA 3GNQA 4L73A 3HFSA 3GR6A 5JAQA 4A73A 5JC8A 4NIMA 4PVCA 1UXGA 4WJZA 3WIEA 4R5MA 3VTFA 4IDCA 1BVUA 4CM4A 1BXGB 4D44A 3GEMA 1JKJA 3DR3A 4K9DA 4RORA 2GPTA 4BNYA 5DBFA 1PJ2A 2X8LA 4TRJA 1PL6A 3CIFA 3JV7A 4PZEA 4CV0A 3GNTA 3KSDO 4YT8A 3LDHA 4BNNA 5L4NA 4IQ0A 5BT9A 3DHEA 3QHAA 4JIGA 3WTBA 2P2SA 1PJCA 3NYWA 4TRRA 5G0TA 3G17A 1JKIA 3PWKA 2PH3A 1C1XB 3WGIA 3RASA 3C1AA 3UUWA 2QG4A 3GRPA 1X7HA 3GVXA 4BKQA 4F46A 1X15A 1ZW1A 2BFMA 3ZWVA 5DBIA 4AJPA 5GMOA 3P2YA 3H5RA 2I9PA 1YL6A
chains in the Genus database with same CATH superfamily
5JS2A 5ABPA 2XRZA 4QXAA 3ZE6A 3FF4A 3IAUA 1Z0AA 1DMRA 3CO5A 1QP8A 5D00A 4C22A 1GZ4A 3A1WA 3UAGA 1GKYA 2WFZA 3JWHA 2BL4A 3DM5A 4OYRA 5TS2A 3UHOA 4BB0A 4JYBA 1CVIA 5F2OA 2PSSA 1TF5A 3DFFA 1YJAA 4A7PA 1GTRA 1E5LA 1I1NA 4URWR 1X7GA 4WE3A 1F51E 1K63A 4M3NA 2RC6A 5ALPA 3OTGA 3FTEA 2CXHA 1Z5NA 4Z2YA 1QXSA 4UU1A 1K7FB 1U7OA 3NEPX 1OX4B 1ZGJA 4FBLA 4MKRA 4OOFA 2XB2A 4C0KA 4FEGA 4ZAWA 5F4BA 3LCMA 3DW3X 2W2KB 4PBTA 4FYYA 5AVVA 1EGQA 2CY0A 1LTKA 1YGYA 3BMQA 1VXRA 4PSKA 1EE9A 1S4MA 3ILYA 4ZA2A 3UB4A 3QLJA 1MF7A 1XCLA 3SNKA 1QP4A 2Q1WA 1TU0A 1QLJA 1NJ2A 3WWDA 4BTLA 1Y4AE 2NZUG 3K70C 4DR3B 3KM0A 3DF9A 1OAKA 3A2KA 4RIFA 2BEJA 1NLMA 1V37A 3LXXA 3SPXA 4BX0A 3AVUA 4MW0A 4LF8B 4DSTA 2ZJ8A 2R96A 4Q12A 5C8YA 5T8KC 5KAMA 1EBBA 5EMKA 5B37A 5BN4A 2YIVX 2PLAA 1L7PA 1TK2A 2RK3A 3I30X 4NK5A 1BVRA 2M6LA 1H6AA 4L4RA 5CHYA 5IJ0A 5KVSA 1K6EA 3U4IA 3TI9A 1NVEA 1M6WA 2O14A 3ID6C 5B4TA 1BD3A 1FNCA 3PFHA 2XYQA 1GN9A 1V8BA 2GR9A 5H9WA 3RD5A 2BZSA 1SB8A 1DMSA 3JYQA 4M54A 4MLDA 3T3DA 3U19A 5DULA 1WETA 1QVVA 4ZHSA 4W5NA 1AN0A 1NKVA 5DX0A 2O1SA 3HJNA 1NXTA 1ZD2P 2OHFA 4FZRA 1GYRA 3KB8A 2XVZA 1BN7A 1PJRA 2RHLA 3BGDA 4ZVLA 1A9ZA 1AXEA 1R37A 1KF0A 2C9DA 3A14A 2OZKA 1DKPA 3FOAA 3IKVA 3DZFA 3Q3JB 4NX2A 3B60A 4Y6PA 4GSKA 4HEHA 4CTKA 5HF6A 1E4EA 3N28A 4WXEA 3KHSA 1YVEI 4IH9A 4EG1A 3UUFA 3RIXA 3CRW1 3VNRA 1W5TA 4AZ3B 2I4RA 1QQ6A 2BY4A 2GHTA 3ZVRA 4HLNA 4WNCA 4BO5A 3PD0A 1LXCA 1T1SA 2BGLA 3BB3A 2EZ4A 1I4DD 2IGTA 2PX2A 4J7UA 5CFMA 2PUBA 5EPOA 2GESA 1Y5IA 5LB2A 4OXNA 2WWRA 2Q3BA 3WGQA 2NXNA 3EYAA 3ZGOA 4EGAA 2IUYA 3I9LA 3L04A 4D0SA 1Z88A 3BBPA 1TT5B 5I4IA 4GS5A 2OZLA 5DK4A 1E3WB 1FYWA 5A9TA 3NTLA 1JEQA 1PR3A 2GJ8A 2W2PA 2ZDHA 3MCUA 1YD7A 1C9MA 3PU6A 4RANA 4RZ2A 1P3DA 2ZRJA 4I50A 4ZYUA 4BV9A 5CDTA 1YDEA 2F6RA 3I52A 3IAHA 3OLQA 4Q9NA 3T1NA 1LVUA 3LZ6A 2GBLC 3MB8A 4IDPA 5CNIA 3U44B 2XBMA 5F12A 4QHSA 2BONA 2X0RA 4G8DA 2XXAB 4IXDA 4ALMA 3AQ4A 3PDCA 3U3JA 1QFXA 1WSAA 1I2MA 4G41A 4HN9A 3BH7A 3ZBQA 2DRIA 4JFAA 2E4ZA 4R2MA 4E4RA 5C8DA 3HU2A 2H5IA 4Y9DA 2R25B 4Q9JA 3GFTA 3HFRA 1UANA 2R4TA 4CXMA 5KTPA 2Y1CA 1CV2A 4Y9SA 3WWOA 4AK9A 3TOZA 5HF8A 4LZPA 3U37A 3KZKA 5CFPA 4BZWA 3VYUB 1XTVA 2RB5A 1XZGA 1N1GA 2VHQA 3QNMA 5ALKA 5TJHA 3UT5B 2DU8A 1JA0A 4K0RA 1X70A 5EQJB 3ZZ1A 1Z38A 4G0VA 4IFEA 3URKA 2OV8A 1AZWA 4FYJA 5IAEA 1GZ6A 3A37A 4P83A 5CVEA 3MVEA 1VJTA 4CV3A 3O73A 4TS9A 2YX1A 3IB3A 2D13A 1Y9JA 2WLTA 1YIAA 3SSAA 1DJLA 4WXHA 3GT4A 4Q3OA 3D6AA 2O8FA 4EMSA 4EPRA 2UUBB 2ZS8A 2WWXA 1PGPA 3PLNA 3HB5X 3GLIB 2YZKA 2J1LA 3I4LA 3IV6A 4HQOA 4TVBA 4BMVA 4F8EA 5FBWB 3AW8A 4RTNA 2PSEA 2VRCD 2Z98A 4BNHA 3H4VA 4PS1A 3ODGA 1JAYA 4S1PA 3GD7A 3KZVA 3HZHA 3VM6A 4D81A 4DV7B 3D7SA 2JI4A 1YBVA 2JCGA 1IXZA 1PR6A 4O4JB 1MA3A 3PK0A 3QV2A 2WKQA 3H8SA 2B2NA 3PQ3A 3LAWA 4WACA 5LVAA 4QIHA 4WL0A 1JHAA 1YB1A 3IUEA 3TRFA 3Q5EA 5BW5A 3E4CA 1ZD8A 3TTTA 1LI7A 1PD0A 1SBHA 1YZFA 3CE6A 1D8AA 3I37X 4MB2A 4KPFC 2V0GA 1G4AE 4IDHA 2FZEA 4OMDA 2ZM6B 2H29A 1PZFA 3NVMB 5JAUA 4UHJA 4HDQB 3V34A 3UW1A 1IVYA 4GSYA 1LDMA 4MHOA 4O4LA 3GLTA 5AI6A 3FTNA 5DW0A 3REFA 2B5OA 5EJ2A 3K9LA 1PFUA 1KPHA 2R8YA 3BMNA 3LLUA 1WLYA 3VSAA 5ITZA 4GW3A 3AP2A 1RIFA 2BLNA 2I55A 3OSZA 1WA5A 3SSNA 8AT1A 4UTVA 3CEMA 5HR5A 4XZ3A 3QWBA 3TFQA 1Q7GA 3F6PA 3D6UA 2AR9A 4KGVA 5SY9A 1XDDA 5AMXA 1VA4A 2KPOA 4FYHA 3FN4A 1JR4A 5CRIA 3C45A 3UHAA 1X1TA 4LDQA 1NJ1A 4PXSA 3S1SA 4O4IA 3R4VA 4LFBB 5C1BA 3DBVO 3UHJA 3EN0A 1NR5A 3R41A 2A59A 2J48A 3PQFA 4IFTA 5DBOA 2PZGA 4FC6A 4V0QA 3NW9A 4XVRA 1HDRA 4EHFA 3EPKA 4YVFA 2YCBA 5ULLA 3CNEA 1JALA 4LOJA 1HEIA 3EBOA 4PE5B 1TEZA 1Z2DA 2ZZKA 4WZBA 3ZTYA 1D2AA 2YRXA 2HEIA 3EQZA 4TV9F 3BTVA 5H80A 4PCUA 5JVDF 4BFYA 2V9PA 5B64A 1RT9A 3PGMA 2UVQA 4KLNA 3C97A 2EKBA 1GTJ1 3U3MA 3KZXA 2D2VA 5FI5A 3RRJA 5BRAA 2CXPA 4XVCA 3F7TA 3HXOA 4M1YA 4FT4A 3WIVA 3ZLTA 1JHZA 1Y4DE 2VDQB 1ODJA 4U2BA 4MB6A 5K0GA 1M34B 2O2HA 3Q12A 4Z4GA 3B9RA 5K51A 3VC7A 4YRIA 4EELA 1PL0A 3WWZA 1E2JA 2GN2A 3G13A 4S1OA 1WM1A 4EEKA 5HYVA 3CLRD 1RZRD 4P84A 2G4CA 3IODA 4YRKA 1V7QA 2PUHA 4L4UA 1DBQA 2A1UB 3F3KA 4QBTA 4XWYA 1DJMA 3DXYA 4FHGA 2V74B 2A8YA 2VZEA 3OURA 4BFCA 5JQGA 3QUSA 4G1EB 5JE8A 2F8TA 3R3HA 3CPJB 5DOVA 4U6SA 3E9ZA 5JMTA 2R8ZA 4PNHA 1VI6A 4MR7B 5KU1A 4TL8A 3KSBC 3HO6A 5L9AA 2FMIA 2EKDA 4GGPA 1O03A 2R62A 1KZGB 4MVYA 3TW8B 4BV3A 4U2FA 4GYWA 1XDUA 5FB3A 2NNWB 1N2HA 2JI6A 3DNPA 1FRZA 5KYGA 2BKEA 1P7WA 4RHTA 2R5FA 3SE0A 2ZJBA 1NE7A 2RFLA 4WOJA 1MJNA 4RK1A 3DPSA 3HB9A 4GC9A 3AOGA 3R40A 1S01A 3TW4A 4C2BA 5CFOA 4QM6A 1I94B 4DA9A 1IRIA 2AMFA 2P69A 3HCPA 3P45A 3FSRA 4IVQA 4M8LA 5LP6A 1DBRA 3ZX5A 4IXNA 1PBTA 2RH4A 3S8EA 3FFTA 3QJYA 3KSUA 4IO1A 4K26A 5ECWA 2ZIXB 3EBLA 5L45A 1AC5A 1ULUA 2PCJA 4DCGA 3U6BA 4YYEA 3F67A 4NDNE 3T5DA 1GNQA 3DC7A 1KFJB 2Q2OA 4LMBA 1HA3A 5EHGA 4MLZA 7ADHA 3ZK8A 2F3PA 1ZK2A 3EB9A 1DC8A 2ZSHA 3IPXA 5GZ6A 1V45E 3DFMA 4PNEA 2IYZA 1ISPA 6ADHA 2WSBA 1RXSA 4UXHA 2CV0A 3AOEA 1Z18A 2X77A 1LC0A 4HB0A 3GT0A 2P5YA 2HYDA 3NBZC 1JJAA 3SYKA 4F9TA 5IJ9B 3GNSA 4CNBA 1XZHA 3QBVA 3GK3A 1C2YA 2E4VA 3MPOA 1KDVA 5ISMA 4BNTA 1O8BA 1KYVA 1PFQA 1ZRHA 2OILA 3EULA 5EXEA 1L4EA 3T52A 4LJLA 2P4UA 1NWCA 3M2PA 4U6NA 4G3XA 2BBSA 4AECA 1UIMA 3VSEA 5JNSA 5LIPA 1ULBA 1A77A 2EZ9A 3BJIC 3EIOA 4HDCA 1NXVA 3AFMA 2IVZA 3O1LA 1C8LA 2GCEA 3BTUA 2IBSA 1TM2A 1DCKA 3ABZA 2Z30A 3PUZA 4BECA 5KWIA 1GVNB 2V6MA 5G4LA 4K9RA 1KP9A 1PJLA 1AKRA 1NNLA 4B7XA 3UPDA 3WR5A 4BLQA 2GCIA 5A4AA 5ICFA 5BR7A 1CG6A 4YPVA 3M70A 5CDGA 1QTQA 2H54A 4XQEA 2FFQA 3ZHBA 1OGJA 1J7JA 1ORDA 2OT3B 4KYIB 2VAPA 4ESOA 5JMOA 3SQXA 3DYBA 1DT5A 1VHQA 2WJAA 2YHSA 2CNNA 4PC3A 3PD1A 2GNAA 3QGMA 4AZ0B 1VPWA 1GFZA 4Q4LA 3EOZA 3VHQA 2LIVA 2QLBA 4F21A 1EJBA 1QZTA 2FN4A 3OX3A 3P9NA 4MUMA 3O3OB 4XPIA 3U4CA 3HJBA 3T3OA 4AW9A 1SXQA 2IXEA 3KRTA 3DOCA 3V9PA 2DPMA 3WYDA 3HN6A 4RH1A 1S7GA 2Q4EA 4J2TA 521PA 4NENA 2PL1A 2QZSA 1ZOIA 4K9OA 4OATA 4Z0TA 5J59A 4G09A 4IG9A 3ZIDA 3QY9A 1MVLA 5IF3A 1WXXA 3MINB 5LQUA 3E3MA 5CFRA 3D0RA 3E2IA 3UO8B 4ES6A 1KEWA 1XGKA 3GLRA 3IAM1 3IR5A 3Q85A 4IMJB 4RHYA 4RYDA 3WRYA 4OFBA 1JIJA 3FLMA 3EOBI 4NZ9A 3JARB 4U3JA 4WXRA 1JFRA 4ZD6A 2PXAA 1IQ0A 3LNCA 1T5OA 2C57A 2GKSA 4B3BA 3JTEA 4U2CA 4ZDKA 3CVUA 4ARAA 4E22A 2YJ3A 1KYXA 2VT3A 2YHBA 3H04A 2KQUA 3AM5A 2HU7A 2PWZA 4PQYA 3W2IA 5AVTA 3D3EA 4JP5A 5DO9A 2REBA 1FNMA 4DYDA 3JTMA 4X65B 4MI3A 3DULA 4C6SA 1PUIA 2EQ5A 4I4CA 4OM7A 4HHEA 3IP3A 2CSXA 4AY5A 1VTKA 1NI5A 4QOEA 2WSMA 7GPBA 2AF4C 2BFWA 4FMCF 3ZWKA 1ZM4A 2W5UA 3P5BA 4JLUA 1J4AA 1IC6A 1R3DA 1TTPB 1Q0QA 2FFBA 4IEEA 4L8LA 4WW0A 1AS2A 6NULA 5IJZA 1P4HA 3WYCA 4FB4A 1E59A 5EJ4A 2P30A 2Q1UA 1CLEA 1HT0A 3CURA 2WJGA 4XPZA 2NLOA 1Z0ZA 4ZVRA 3HHPA 3WB1A 5FUVA 3S7ZA 2X9QA 4E5KA 2XDWA 2YBDA 3II6X 4EX7A 3FUVA 3PQ8A 4RL4A 2ODQA 3ASZA 5FPTA 5JTTA 3T5BA 2WKPA 1B23P 2IOHA 4Y30A 2WMNB 3LCRA 2PMFA 2DHEA 1Q15A 4MWBA 1MB2A 2PT7A 3AKEA 3HZZA 4OQXA 4DV1B 2MSCB 2JAXA 5C7LO 3IP1A 2F55A 1K7EB 3D1JA 2QRKA 3ANNA 3G88A 4PR3A 3KD3A 2F1JA 3PWTA 3NXKA 2ODNA 3T4EA 4Q1DA 5AW4A 2Q3FA 5FF9A 1H3EA 4LECA 1SVIA 1O0CA 4WVFA 4M46A 3K6SB 1U3FA 2PX8A 3RYTC 2Y05A 1M76A 3KBBA 4MQ5A 5ELLA 3S2EA 2B82A 2C4MA 2K87A 1O94C 1SCIA 1A27A 4ME6A 1PDWA 1VOTA 1Y6GA 2RCNA 1PWHA 3NX4A 4ZQEA 5CB6A 4Q39A 4JKYA 4B6EA 1U0BB 2HGZA 1H2WA 3AF4A 1T9CA 4KWHA 4UAVA 2QVLA 4H1VA 3MRXA 5KJEA 1KY5A 3U49A 1BU8A 1J97A 1HL7A 4JJ4A 3FKSD 3FD8A 4AJJA 1NBAA 4F91B 1I7QB 1L7VC 3OPXA 1DCMA 4L74A 5EQFA 2PFGA 4L3OA 2R8RA 1V9CA 5CVCA 1YRHA 2W6OA 4BVLA 4LA4A 1I6WA 2XNJA 1VKRA 1J33A 2V5AA 2DKNA 2XLBA 2ZXFA 1DUIA 1L5VA 1QGUA 4C6HA 2JFUA 3GCDA 3L8EA 4X20B 3SIXA 1MXHA 1Y8QA 1J5EB 4AG3A 1WNFA 1OFUX 3JU3A 2JJQA 1FTWA 5BN1A 1R6VA 2IUSA 2IEGA 4MCIA 4MLCA 3NHYA 3WQBA 1G5TA 5IZCC 2H1HA 1D1QA 4AF7A 4MUGA 3CWCA 1KJJA 4TMYA 3H75A 3X3HA 1FC0A 3RNLA 4AXXA 3AFGA 2BFCA 4PG6A 1NUPA 2HWWA 1ABEA 2JJ1A 1YSCA 2GAIA 2WJ4A 3BERA 1JV2B 1ZYUA 4M1OA 2VWGA 5AD1A 1E4VA 2C8LA 5B7QA 3GMSA 4ZAFA 2ISCA 3EAGA 4C0WA 5EIFA 4LGCA 2BGIA 2ACEA 3CR8A 5H9VA 5B58C 3M9WA 4GZMA 2C2OA 4KR0A 4MV9A 4B45A 2RH8A 1JQ5A 2XXBA 4AY4A 3T9BA 2I1QA 1RS0A 3HBAA 4CVNA 4CCWA 3SWWA 3I01A 1E98A 3RT9A 1DELA 1MAUA 1Q1GA 4Z0HO 3SD7A 2B92A 3T9FA 4DIOA 5AKHA 1Y5NA 5DRTA 3VUEA 1YS9A 2I2CA 3HCRA 1MB4A 4AS2A 3BKWA 4F1KA 3ZZ0A 1S1CA 4ALJA 2CVOA 4KQFA 3RBAA 2HA4A 2UVPB 1M8KA 1QIJA 4TTPA 3TQFA 2X0KA 2OM6A 1TVMA 3B1KA 4W1QA 3DBHB 4DSAA 1I0IA 4Q7QA 3FPGA 3ZGNA 3PQ4A 4ITUA 4RZSA 2B3TA 4US0R 1YZKA 4B3JA 1TJ4A 1LLDA 2V54A 4GYYA 4N76A 5J1TB 1UAYA 3M89A 3ITNA 2QPTA 5JSHA 2FUKA 3NBXX 2WD9A 4GR5A 4NV1A 1CDEA 3F2VA 3C5EA 3IJRA 3AM1A 2ZVJA 3K4HA 2RH9B 3TD6A 4QREA 1Y3CE 3MJ4A 2O2EA 2J5KA 3JQ8A 5TGDA 4PBSA 5LQSA 3DUFB 5CYGA 5GVSA 2AK3A 2OMKA 3GOQA 3OG9A 2P9CA 3EXHC 3RVLA 3S5JA 3EXG2 5JFTA 5KOHB 1OLSB 1T5BA 3G5UA 2BGMA 4BNJA 5FBQB 4US1R 3R8CA 1PEYA 3FTPA 5DM70 2BM8A 1X1EA 2NUAB 1YGPA 4E14A 1B8PA 5CA1A 2AV6A 1P0FA 1A8QA 1PR0A 2OFOA 4ZKDA 1W85B 4URVR 4WCFA 4JYCA 1CT9A 3A3PA 1Z28A 2IDJA 1Z4MA 4HDSB 3PD7A 4Z4HA 4CTJA 4WEQA 2Q4DA 3LK6A 2CCGA 1E7MA 1MG5A 3BE8A 4R2KA 2BM1A 5CGZA 5JIBA 3FUUA 2VRCA 5FOUA 1UOQA 1E8MA 2KLHA 4A8JC 2FGJA 2VPQA 1LTHR 1GTL1 1SUAA 3QX7A 3AW9A 2GJSA 4EKDA 1KMQA 3QLVA 1YQUA 2I87A 2OCIA 3JQPA 4M9XA 1XA4A 3ETDA 2PQ0A 3R7NA 3VC3A 3J81A 2Q2WA 2ES4A 3GLHB 1LK5A 3OIGA 1BO6A 3SIRA 3CH4B 4HLCA 2XRYA 1KMHB 4QO7A 3GHHA 4B4OA 4O29A 3P4YA 4M1QA 4HAWA 1J1UA 2IPNA 3WK6A 3U9SA 3UMJA 3E2PA 1V8OA 4PSVA 2WSIA 1JS1X 4HB2A 4RLFA 4CYMA 1VA5A 3G5MA 3TQIA 2EWWA 4I0WB 5I9SA 2C92A 4LE1A 2VK4A 1QNFA 3K70B 2HA5A 4M0EA 1X8XA 3FR7A 3I8SA 4KDEA 1DWOA 4EY7A 2XOXA 5L7WA 4A91A 4LBVA 3SIWA 2IZZA 2VO1A 5DCLA 4AKGA 3HCDA 5CYFA 3TIFA 3TMYA 2RD2A 1ACMA 1LH0A 4JVNA 1IOLA 3OZIA 5E38A 2VNJA 3L93A 4RD1A 4NRDA 2QJTA 2JLQA 2QRUA 1TKAA 3HYCA 1GGKA 1LJLA 2PJUA 3W2GA 5A1TA 1RCTE 4UUAA 3ZHRA 2IU3A 4EFDA 1K8RA 1JW9B 1PFYA 2BR5A 2ZWIA 1XEFA 4DBLE 4AYWA 4NNJA 3H5LA 4FPXA 4LYHA 1TXGA 4BRUA 1T2DA 4BBAA 1MW9X 5A4MS 2WAYA 1G21E 1XCOA 3ZWOA 3P0RA 2CGEA 2Z09A 4DAOA 1Z7GA 5THXA 1E1CB 1VLLA 2XVXA 3WK9A 1LLCA 3R3UA 3E5RA 4EPTA 1EFPB 1IU9A 3DVQX 1AGYA 1KBZA 1MO3A 3AR6A 3PI7A 4FW8A 4LOAA 4HB3A 3OWOA 4M1ZA 4DREA 4UBNA 7MDHA 1WF6A 2O2SA 4K9LA 4D74A 1V8PA 2TECE 4UCWA 1HMPA 2BI4A 4LXGA 4RABA 5JISA 1A7UA 2ZVPX 3S55A 2JI8A 5C32A 4UPEA 4I1RA 2H1RA 4OB7A 3HFGA 2B69A 3GJ6A 1XFAA 2F3QA 1WD5A 2UYQA 3IA7A 4LNHA 3UWPA 4C7OB 3MYRA 4BOYA 3VZSA 4EG8A 4LXQA 4QPJC 1EUDB 3RR2A 1F14A 3QX8A 4CQLB 5T5QA 1KKMA 4QDZA 1RZRA 1R4MA 4N6NA 3O1JC 4OXRA 2CVHA 1B6TA 1FDUA 2AOTB 3G0BA 3OZDA 5FCDA 4QBKA 3STVA 3UT0A 1WB4A 5FV7A 1N5MA 2VRNA 1OA1A 1DAOA 3D4LA 1JGTA 2FG6C 5TT0A 1W5EA 2P35A 1H0RA 3IH5A 5E7QA 1LPOA 2PUVA 1ZU5A 3VJMA 4KBFA 5ESDA 1OWNA 1IIRA 1MEOA 1ST3A 4L27A 5ALXA 3SZ3A 4RGVA 2DSTA 1A9SA 1NJSA 1A9YA 2RMKA 3IMFA 2QT0A 4LCEA 4Q7JB 2IGBA 1XR3A 4RACA 2J32A 3S2FA 4EPYA 3DVAB 2ZCJA 2JIPA 1GU0A 3EVTA 3DH0A 4FGJA 5MF6A 3ZDFA 3BWVA 4BQQA 1UOPA 2CLEB 2FSUA 1NFFA 3GGCA 4BX8A 2H48A 3LVQE 4DNPA 4RHUA 4E94A 5JSZB 3K0SA 1LI4A 4J75A 1HZJA 5EXXA 3BDIA 3TK1A 1YH3A 3RVRA 1UBRS 4I4LA 4RZXA 3ZHCA 4BFLA 1CRQA 3HJCA 3BM5A 4E88A 5D2CA 3T7EA 5BXYA 4L9AA 3EC1A 4QPNA 1DXOA 1QHGA 2BFPA 1W52X 4PG7A 4YN3A 2G1KA 2BMFA 4E2YA 3QE2A 4REQB 2YXBA 1RXCA 2FCAA 2ZT7A 4CIXA 4KQJA 3LUHA 4OB8A 4PTLA 4PIVA 5REQA 1SKUA 4B6SA 3HWX1 1SD5A 2AUNA 3L8ZA 3PA6A 1BQ4A 3QU5A 3NR2A 3RVMA 1HL3A 4FYPA 3M1IA 4GYJA 2O0LA 5AVRA 3G9QA 4HRXA 3FOBA 2RBGA 3TR5A 2X0IA 4DHEA 1ODFA 1OR8A 2JASA 1OZHA 2TSYB 5GAJA 4FM9A 2CHGA 3RAGA 4RXMA 4TXNA 4OXQA 3FBGA 4N5NA 1CY2A 1ZO8A 3D43A 1GOTA 2V58A 3ASYA 1KQ3A 3EIEA 1WO8A 1N8SA 3KBOA 4NZPA 3VI4B 3W8DA 3G2MA 5C5DA 1IDOA 3ZV7A 3IPLA 1O9GA 1Z6QA 4BWGA 4UUQA 1D03A 1QUEA 1FEZA 3HSSA 4N5LA 1R6XA 1TZJA 4WZAB 4H77A 5JWHA 4YAKA 3UMRA 2N75A 1HC7A 2KBEA 1MRSA 4NHEA 1OBCA 3SVTA 1LPNA 4CETA 3ZDDA 1T10A 2P0EA 3QU7A 1TMGE 4F12A 1QKKA 1XTJA 1JQEA 2C4TA 4M0CA 4WTOA 4FFOA 3TM5A 5I47A 4EL5A 1A4XA 1Z56C 4X24A 4KSYA 5DBEX 4V0SA 1UKAA 5GJVC 3IVAA 3T0GA 4E33A 5EXSA 2BFEB 2A0UA 3PFIA 3HGTA 1YJXA 3L0PA 4DLPA 4CKWA 3I01M 4C9BA 3GVPA 1IM2A 2CVQA 1T91A 1JHVA 1VYHA 1ZQ9A 3N2GA 4ETNA 1NU6A 3FZQA 1QDUA 1JQLB 5IVHA 2YVQA 5B6IA 1JBEA 2ISSD 4YQEA 4RWZA 2BW0A 4F04A 2F9LA 5K0EA 2P8SA 3OQHA 3HXQA 3RYCB 3OUTA 4M0FA 1OV4A 2ODPA 2R84A 4AMGA 3F5MA 2CNBA 2ZI6A 1AXGA 4H7KA 3OO0A 3PE3A 2XNSA 2YCLA 1X38A 4LPSA 4U4AA 4MMXB 3HFJA 4FD2A 3PEUA 3UYKA 3H84A 4H3HB 1E9FA 3ZJ5A 4AJ4A 4L5JA 4PF1A 3VU3A 5CW2A 3C1UA 3GDWA 2FE4A 2P3SA 3RUAA 1P0PA 2ZZNA 3OT1B 1RKVA 3OCXA 3ZBUA 1NVUQ 4RUKA 5CLHA 2H18A 4OMUA 3ELDA 3ZCTA 5IDWA 1LK7A 4R3NA 3VKUA 4E08A 1HFEL 1QG6A 3ESXA 1KI1A 4HN4B 4R98A 4WDRA 2YN0A 1VECA 1QPBA 1Y7HA 3O31A 2ZUUA 3EA4A 1G63A 3ZD8A 3BIFA 3V4SA 3TIIA 3PXXA 5LXTA 3ZWQA 4DQ0A 1VJ1A 1L7XA 3OU6A 4ZK2A 2VIIA 3GOHA 4HBZA 5EESA 4DVJA 4HLQB 1NUHA 1WXDA 3ROQA 2WKSA 2D0DA 2X0NA 3EAFA 3LUGA 3O4IA 3FVVA 2LXNA 5JS8A 3NC4A 4I9FA 2PZAA 2I78A 3HVKA 5ES3A 3LBAA 4ER7A 1Z63A 5DGHA 1SUBA 2ZSIA 1F38A 4PLHA 1J9EA 1QQ7A 2B7CA 3D4BA 2OVFA 4JCOA 3ANSA 4K81B 5KDLA 2OCLA 4LC0A 2K4MA 1QTRA 2G4LA 3EQ9A 3AF0A 2EX1A 4IKPA 5IX8A 2CZQA 5EQDA 4G9GA 2QB5A 5KX5B 2F3UA 1E20A 1G55A 1Z74A 2VVTA 2XWBF 2NV6A 3FPKA 1ZJZA 3JYLA 3VKFA 3LPCA 4R9RA 5B3JA 4CF4A 3DOIA 3EUEA 4FWIB 1ZD4A 1R50A 3A9VA 5LQAA 3H87A 2HUPA 3VKGA 2RCYA 5FRDA 2JBHA 3NHLA 5COAA 4YMWA 1OX4A 4D02A 3LKVA 2X6QA 4DILA 4YRQA 5KNBD 3G8YA 4C1NA 4YUAA 1NNEA 3WLPA 5KQPA 3QELA 2W2KA 3DMPA 1EDEA 3GIDA 3KWLA 3IVRA 3M4JA 2D1YA 1PZMA 2N1MA 3NRBA 4OXIA 5F35A 2D6FA 2XUIA 4DMMA 1LBSA 1RMQA 4OB6A 5BVHB 5I7VA 5A3RA 3C3JA 4ZDWA 4FOPA 2GK7A 1IEVA 4R6XA 4U02A 4W9NA 1YZHA 4IHJF 4MKFA 1RJ9B 2E1RA 3PDHA 3V8RA 1ZI8A 3ZHYA 4PNZA 2LBPA 2QEQA 2NYRA 3OEWA 5LMCA 3V6MA 5LQNA 1WSBA 2OORA 1J09A 3P94A 1JA1A 4QTXA 4MYCA 2D1SA 1GARA 2PFSA 3EZ6A 3WGTA 4RZUA 1X39A 2GAOA 4ZRDA 1CJBA 4GOND 3STXA 1TYEB 2QUKA 3CUWA 3F1LA 1R8JA 3ORYA 4A0GA 4GPZA 3LC7O 2ZWPA 2G77B 2OG1A 2L82A 1A76A 3EXFB 1I7PA 4R4JA 3WXBA 4ZYLA 4I19A 2IYXA 1G5HA 4DSUA 5BOSB 1TDJA 4Z3OA 4C06A 5G0UA 5BWBA 2FXIA 3V8NA 1OT5A 1YHZA 4HGYA 2FEXA 4IOLA 4OK6A 3L0SA 1SVWA 1NR7A 5I7HA 4DIUA 4LRWA 3KR0A 4NCAA 1T6BY 4KI0A 2E5LB 4AX8A 4F85A 5HF5A 4RY2A 1XLTA 1ZM9A 3KSRA 3MTEA 5E4FA 1LVHA 3W5SA 3ZW9A 4BMZA 4C0JA 1GL7A 1P0CA 4AO7A 4BP9A 3H9UA 3QVGB 3EMDA 4FFNA 1C7FA 3DCJA 3OI7A 3QFFA 1BYUA 1T8RA 2XPCA 3FG9A 4C43A 4CEHB 1GDTA 1JT2A 3NBQA 2GZHA 2WU8A 4FWBA 4RYLA 1PR9A 2FN8A 1I5EA 4DLUA 1EJ6A 2QRPA 3L6CA 4P4LA 2PKYX 4AZ3A 3I2IA 5KYWA 1W5FA 3PCRB 4Z1OA 3CSDA 1GZ5A 1XBTA 4W5QA 3FR8A 4N54A 4F8YA 3RK4A 1Y9EA 5CVJA 1YZGA 2HBRA 1JNXX 2QLNA 3HMQA 4PQRA 5DTRA 3S7TA 4TQ9A 4RTJA 1GRNA 1Y9DA 2AOWA 1G19A 1VG1A 2H5EA 4IDDA 1A2QA 1TT5A 2O9JA 5G4KB 4S04A 1XZMA 3LA8A 3W8NA 4J0FA 1GUBA 3FPJA 4NBUA 3F8WA 4P6VF 2NYUA 3AERB 1X86B 2WM8A 3AETA 3G7NA 3IXQA 4FIZA 1XRRA 5I7FA 2VHWA 4BVKA 1NC3A 1O5IA 1NQTA 1LI5A 5D86A 3UJCA 1XV5A 3VFDA 4ZU6X 3RWOA 1RYHA 1X1BA 5HDQA 3U44A 3S3TA 5JUWA 2V6IA 3HG7A 1JBKA 2FG5A 1U11A 2C0PA 5E2AA 1CS0B 5G2OA 1NUTA 2MOKA 4Y2SA 3RU9A 5IN4A 4IQ8A 4M0DA 4BNFA 3PF8A 4EHKA 2C97A 1QVAA 4IDQA 4IV5A 1XN4A 1I4LD 3F2IA 5ELMA 3UT5A 1C8KA 4MR8B 2WWVD 3E7DA 3TSAA 1M1XB 2GN6A 4EW3A 1WWKA 3DEAA 4UEQA 3K4QA 3X2FA 1LDBA 3EARA 1H5UA 4F4FA 3C6QA 5CEJA 4LJRA 4LDZA 1IBLB 4K7JA 1ESNA 1AKUA 1K3FA 3PDUA 3RADC 4QYWA 1T35A 1XO1A 1XZDA 3QG5A 4JITA 1U3GA 1P6UA 4ND4A 4QSHA 3X1DA 4EB8A 5B1EA 1JHUA 5SY4A 5BSVA 3PWZA 3DT8A 5FUWA 3DHVA 1R9JA 1NV8A 3NOXA 4P80A 3IEPA 3FZEA 4UD6A 3QVUA 1PUXA 3QJ5A 5ALIA 2ASVA 4CR6A 1S1MA 4DCUA 5D5PA 2EF0A 2C42A 4Y6OA 4DLSA 2ZSEA 4N9QA 5DYYA 1EXWA 1DS6A 2H1CA 3WA6A 5K6TA 1T5HX 2IYPA 1UF9A 1LPMA 1I2CA 4F1JA 1TQ6A 2CLHB 4IW3B 2R87A 4LYEA 2OXTA 1F6WA 3GZNA 4O4JA 1A95A 1J49A 1VCHA 2R00C 1WKVA 3BSWA 4M7WA 5K0NA 5E0OA 1NKTA 5HKAA 1EAYA 4AN0A 4QUBA 5H1YA 1VM6A 3WWEA 2CL5A 2W8BB 2OBFA 4R8RA 5I9MA 1XTSA 4PCAA 2PHZA 3MW8A 1T9BA 1IHDA 3CF0A 3MJCA 3O7MA 1PT6A 4YFYA 3TX6A 1U0SY 1YTLA 4AJ9A 4YTEA 2AD1A 4K05A 2D8MA 2Q0QA 1NVFA 4E5DA 1UJ6A 2CNLA 2Q07A 3Q2IA 4X1IB 1NAHA 4FNMA 5A62A 4U8HA 3WB9A 5C2JB 4BU1A 3QEAZ 2O20A 3ZJUA 3U4AA 1JR2A 2V7WA 1XPOA 1Z4OA 3K70D 1XNHA 1J42A 2G5GX 1H23A 3EDOA 4UVEA 3D0OA 3E1GA 2CDRA 3NB0A 3GDHA 1UMBB 3QMPA 4MS1B 1WQ4A 4GWKA 4TMZA 5FLXA 2PV7A 1JLHA 4L0CA 5EOVA 2JLAA 3OFSA 4DG8A 2XXJA 1KK1A 1PYGA 2LKDA 2CHQA 1HETA 3IQXA 5I9BA 1B26A 3D6HA 1GZSA 2GUWA 1MO2A 1U7PA 2GFIA 3ECAA 3F6EX 3UXHA 1GG5A 2RI6A 3N2LA 3EEOA 3Q1LA 1BX3A 2ECQA 1XE3A 2RSLA 3ASUA 2EL9A 3A9RA 1GDHA 2GOYA 1MLDA 3H97A 1XAGA 5JD6A 4D79A 2PN1A 3MFQA 4EW2A 3HXPA 3IHTA 1CD5A 4HVTA 4WOKA 3J81k 5EI5A 4CMJA 5DKFA 1TU4A 2GXQA 2UZ3A 3CPHA 3MFYA 3NTXA 1T2FA 1CS4C 4AN4A 3KQMA 3FYHA 2Q0SA 2VF2A 2ZIUB 3RBXA 1V71A 4X60A 13PKA 1XRQA 3RODA 3Q0EA 4LF7B 1TAGA 3JWGA 2QMEA 4D9BA 1Q3KA 5J43A 1YB6A 1C29B 4BP3A 5K4GA 3UAVA 3WA7A 3OCZA 2JLWA 5T3UA 3QXXA 5TVKA 3UQYS 3FWYA 1UJMA 2HRDA 4HAYA 4BBPA 1M34A 3TQHA 4LSGA 3O74A 3IPAA 4YCCA 3K09C 4PZLA 1ZSYA 4B4WA 1EIZA 1XYVA 2QYSA 3PEVA 4MK4A 3THOA 1NJFA 5DM1A 2P3LA 3W1VA 1YONA 2I99A 2G82A 2G7MC 4HEA6 4ZOLA 3FOWA 3VPAA 3VZQA 2H9IA 4D0LB 3ZBPA 4H4EA 2Y1GA 1GPYA 2A1UA 3P9YA 5EP4A 4REMA 4RULA 3CM0A 2V98A 2P9QA 3N53A 1VCOA 3QF7A 1TZCA 3R0VA 4JC8A 2HK8A 4LYYA 4UTZA 1QYXA 5CR9A 2XEXA 3ZXIA 4FNAA 3S44A 1D2MA 2DLDA 3LTNC 1UCFA 1ESMA 2PTHA 4L85A 1JZTA 1RBMA 4G5XA 1YRLA 3TB4A 4G0UA 1QM5A 3VAZA 1GSIA 1K1EA 1ZPDA 1E9RA 2JJ2A 5I48A 1K5GA 5J58A 1TIBA 3GLKA 4C6RA 4JI7B 3MWDB 4TL6A 5FJJA 2G9UA 2G9ZA 2PGJA 4FUTA 5F1YA 1SUIA 2EATA 3FOEC 5FR2A 1XKTA 4Z9BA 4ARSA 2FMHA 1CUCA 2DQ4A 2ZIVB 3EY4A 3L07A 3PQDA 4IDEA 4URFA 4C89A 2GZDA 4ZREA 1UEJA 1N8TA 4OQLA 4EP1A 4GRIA 4F3KA 4FJ1A 3CMCO 4RMGA 3NOQA 4A8PA 4R0MA 1NPTO 4LCBA 1XYGA 2Q2VA 3T54A 1E3DA 1HBJA 2ASEA 4J1TA 3UWKA 5CBPB 2QI9C 4MRSA 1SOMA 4FI3C 3HR7A 3BF7A 2JK1A 3SVLA 1NF9A 2PL9A 1SCNE 1TADA 4NV3A 2O8BB 2FHSA 1JFLA 4H31A 2HJGA 4XQ0A 3HKDB 2C4WA 3SZOA 4RTLA 4CKXA 1T3TA 1S3IA 3K1ZA 4TSRA 3RS7A 4EECA 3V6LA 1QRUA 2EJUA 3SZRA 1CIVA 5A4IS 3FMOB 3T7AA 1M75A 3OZUA 4M22A 2JGAA 4A8JB 1OYYA 5TQJA 2CFRA 3V1LA 3GRKA 2CFIA 2GLUA 3VHXA 5IJ9A 1IZ0A 2CB9A 3I45A 5EMHA 4FWTA 2LTAA 4A2PA 3PFKA 3KTFA 2HRZA 4KXQA 3DBRA 4Q24A 4YMIA 1GTMA 1YBAA 1LGYA 4ZPXA 3CUKA 3NDBB 1MJ5A 1WHTB 4Q4DA 4F60A 2ST1A 2J5BA 3V00A 3AHEA 3IVGA 1CVRA 5ESRA 1MUUA 2ZRQA 4MXDA 5CG2A 3SXPA 2B1RA 2ZIEA 4QJIA 1T15A 3ZD7A 4V0LA 2B35A 5DHPA 1DINA 4GMDA 4IKOA 4BAGA 2BR4A 1RLMA 3GEEA 4CG0A 1AD2A 1K75A 3B6EA 1P7PA 3A2MA 3PT9A 4I5EA 3M3PA 4IL5A 4Q7KA 2IVFA 3ZWYA 2IKSA 1KH1A 4R3UC 1ONOA 1SZDA 1EP3B 5EXDA 3ROZA 5FO0A 4LS3A 2IYRA 1IN6A 1ZEJA 2IA5A 1IVNA 1RWMA 1ZICA 2CWWA 3IP9A 4KQKA 1WB5A 2QN6A 1T4MA 2QTHA 3TE6A 4ZQIA 3F9CA 1U7ZA 1XALA 2C29D 1MDBA 1ZOSA 3C24A 2Z0MA 1FUIA 1Z6ZA 4YR7A 1HSZA 4QNMA 3UWDA 3WLEA 1REQB 4HQFA 5CMLA 5I45A 2QMUA 4CR8A 2XCUA 4DM7A 3EPPA 3O4HA 3PXDA 4L5BA 1L5HA 1SUCA 1QVWA 4QU9A 3RFCA 3UAYA 5LYJA 3VHLB 1AH2A 2P2GA 2GASA 4I3FA 1MQAA 1MA0A 2PSDA 3A4YA 3FZGA 3TKLA 1RJEA 1XVUA 3OJFA 4AD8A 4CKCB 2RGEA 4J6EA 2AEMA 1FRQA 1AKMA 1KOFA 1PCXA 2J4CA 4JN6B 4OQDA 4YMVA 3W0LB 3HJTA 3ZGZA 4RF2A 4E2ZA 1UP4A 5E6UB 5CFLA 4B4DA 1PL8A 4MPDA 1IBRA 5J2UB 3THXB 3B51X 1JDNA 2VTKA 4FUQA 3UMVA 3GBVA 1RQ2A 1CHDA 4NYMQ 1XHEA 2HQRA 1PS9A 2RI0A 1XJWA 1AN9A 1YZYA 2C1EA 2Y4OA 1BMQA 2ZB3A 4I1OA 4JVLA 3G0OA 2FLKA 4RVOA 1F0NA 1AUOA 1JLRA 1K3UB 3NDRA 4NU0A 1E9DA 1LS1A 2PCLA 2G08A 2AFHE 2R8EA 3OAAA 1FMFA 2VC2B 3GF4A 2JAQA 4DR4B 1EFTA 1K9VF 3EGWA 1WY7A 4KH0A 2FPLA 4ZYWA 4H18A 1KBQA 2HK7A 3LVFO 3IOYA 1HQKA 4DKXA