4BGUA

1.50 a resolution structure of the malate dehydrogenase from haloferax volcanii
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
303
structure length
303
Chain Sequence
TKVSVIGAAGTVGAAAGYNLALRDVCDELVFVDIPKMEDKTVGQAADTNHGIAYDSNTVVTQGGYEDTAGSDVVVITAGIPRQPGQTRIDLAGDNAPIMDDIGSSLAEYNDDFVSITTSNPVDLLNRHLYETGDRDRHKVIGFGGRLDSARFRYVLSQRFDVPVKNVDATILGEHGDAQVPVFSKVRVDGNDPAFSADEKEEILGDLQESAMDVIERKGATQWGPATGVAHMVEAVLHDTGEVLPGSLVLDGEFGYEDTAFGVPVKLGSNGIEEVVEWDLDDYEADLMDDAAEKLRDQYDEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MALATE DEHYDROGENASE
publication title Insight Into Structural Evolution of Extremophilic Proteins
rcsb
total genus 111
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2013-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bguA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4bguA02
3GFBA 3CXRA 3JQFA 1LDBA 1VM6A 1DDOA 3KUXA 4GBJA 3MJ4A 3WLFA 1EUDA 4FJ0A 4PLFA 4TQGA 4J7XA 2B36A 4RORA 5IFLA 4NFHA 4CMIA 4E6PA 2B35A 2HMUA 2V6MA 3HNPA 1YONA 3AI1A 5KVCA 4WCFA 3HN7A 4JP3A 3K2BA 1BDBA 4PZEA 4C7KA 2OP0A 4GLLA 3M1AA 4LISA 2ET6A 2CVQA 4FGWA 1D7OA 2EW8A 3FWZA 3SBOA 3FF4A 4MDHA 1B8UA 3VH3A 4JBIA 3H5AA 3TWOA 2PD4A 4CV0A 3ITDA 4BO3A 3CEAA 4M49A 4M1QA 1CDOA 2Y0DA 3PRJA 4ZQBA 4MIYA 2EKQA 3QY9A 3RASA 3D3EA 3ZI0A 3WBBA 4M8SA 4GMFA 5A9RA 2HK7A 4PLVA 2DVMA 2YFQA 4O5OA 3GVIA 1WDLA 2YDXA 1R4MB 4RPLA 3WMXA 3WR5A 4XYLA 4IMPA 3IL2A 1D1TA 4YAEA 4E12A 4ALKA 1LLDA 4BGIA 2D4AA 3I4FA 2GZ3A 2FZEA 3HHPA 1M75A 3PHJA 4XYBA 4CLEA 1PEDA 4BO8A 3KSUA 3RWBA 3RFXA 3O03A 2P9EA 1VL8A 4J3FA 5TF4A 2VRBA 1ZFNA 3MTGA 3BMQB 2CF6A 1U4SA 3FBTA 4HADA 4NFSA 1WMAA 1N7GA 3IAHA 3BXXA 1SO8A 3L9WA 2J3IA 2PGLA 4LGVA 2PZMA 2IDZA 3JQCA 5JAMA 3PIDA 4JP2A 4AJ1A 3A28A 1T25A 4XZ3A 2PLAA 5FF9A 3HADA 2R00A 3QLJA 4TRNA 4DYVA 2Y1CA 1A7AA 3PK0A 1ENZA 3HWRA 4CMKA 3KO8A 2JAHA 1P0FA 1VLLA 4TKMA 1QXSA 4FCCA 4YVFA 2G1UA 3OIGA 5DT9A 1QR6A 4TROA 4WGGA 3L9XA 5JCJD 3U5TA 2X5KO 3VKUA 3PGJA 4LVUA 3S55A 3V2HA 3JQ9A 1MG0A 3GMDA 3N74A 4D41A 1UXHA 1ZK4A 2VZ8A 1DXYA 1E3WB 2AQKA 1HYGA 2IZZA 4MVJH 3L6OO 4Y67A 1XGKA 1MFZA 2NU7A 3ANNA 3JV7A 4M54A 5JDCC 5TC4A 3TJRA 4ALIA 4DLBA 2NVUB 1FDSA 3U4DA 5KWEA 1UH5A 5JYDA 5CAEA 1I3LA 4XGNA 3RUEA 2I66A 1AHHA 2VYND 4IDFA 4FS3A 1E3JA 4R9RA 4AG3A 2H63A 2XAAA 4DBVO 1LDYA 2EEZA 2OMEA 3VTFA 4D45A 1P1RA 1C1DB 4A26A 4D3SA 4P8RA 3DEYX 4ZQGA 1EE9A 1F0YA 2DPHA 2PNFA 4RPJA 2EP5A 3E8XA 1HDRA 4AVYA 3UHAA 4XKJA 5A03A 3GRKA 3MCVA 4KDEA 4CM6A 3S2EA 3SX2A 1CETA 1FMCA 2PGJA 3VPHA 2NQTA 2OZPA 1GPJA 1JWBB 5ILGA 4IPTA 3RC2A 2W2LA 1HLPA 3FPCA 4JIGA 4O59O 4DMLA 5U9CA 3QE3A 3VC7A 3WGQA 3JQGB 4IGFA 3RUDA 1PGNA 1WDKA 4Y98A 2BI7A 5IDXA 2BFAA 2O2YA 1G6KA 2Q2WA 4C7JA 2Q50A 3ANLA 4AJPA 1HE3A 4R1UA 5F1KA 1IULA 1Y8QB 3D5TA 4QTZA 2IODA 1QYWA 1O95A 5KVQA 5T57A 1JA9A 5AXCA 2X0RA 2BHLA 5KJFA 3Q9NA 3PPIA 3NTOA 2ZTLA 4CMEA 4F3YA 4XWYA 3H6KA 2JHGA 5LDGA 4MVJA 2BFPA 4YACA 1LDGA 3WGIA 2NU9A 5GMOA 5KCZA 3E03A 1JKFA 2IXBA 3NTQA 1NPDA 3PYXA 1DIAA 1RYEA 3LT0A 3E5RA 1LC0A 4OOFA 2IE0A 4XDZA 5J23A 2IYOA 2P5UA 3PGXA 4CL8A 3R3JA 3E9QA 2A4KA 1B14A 2O7SA 3IDSA 1I33A 4RL6A 4JNKA 2D59A 4WE3A 5ENDA 1XA0A 4IY1A 5JAQA 5T67A 4E31A 3NAQA 3NT5A 5L4LA 2XPCA 3M6IA 1K2WA 3GNQA 5G0WA 4BKQA 1NQ5A 3DHNA 1T26A 4G81A 3VOSA 2PK3A 2Q99A 4YJFB 5L7TA 3I9KA 4CM9D 1BW9B 3DBLA 1KETA 2G76A 4P4LA 5IF3A 2AXQA 3GPDG 1E92A 4I5EA 3ZU5A 2JCXA 3RBZA 5HRUA 2X22A 3QVTA 4NFYA 4BNNA 1MX3A 4XYGA 2W8ZA 4EITA 4ND5A 5JPIA 4YB8A 2C7GA 1VKNA 3INTA 3IIEA 2YHUA 3COSA 3JQAB 4JBHA 4FFPA 3ZV3A 4BNWA 4JJGA 3I6IA 1CF2O 3BTOA 3PJEA 1YVEI 4D42A 3ON5A 1WW8A 2VNAA 1LLUA 2ILTA 3AOGA 3F1KA 2B5VA 2NQ8A 4PLPA 3PLRA 4OQYA 2OUIA 4BO5A 5JNLA 4Q9NA 2BLLA 2NU6A 5JYEA 3GGGA 3ZNPA 1M6HA 4CV3A 2V7PA 1T2EA 1A4UA 3N7UA 4M89A 3W1VA 1I32A 3I9OA 8LDHA 1Z74A 2AHRA 1GADO 3LT1A 1HKUA 2NU8A 4CR8A 5JCJA 4CM4B 1TEHA 3A9WA 5EL0A 1JKJA 1PZHA 2Z1MA 3IJRA 3O26A 4LK3A 3MOGA 3RC9A 4A7PA 3RJ9A 4CLXA 4BNMA 2DBVO 4Y8VA 3DZIA 3WWYA 1P1KA 2ZTMA 1PR9A 1R4NB 1NHWA 5A3VA 3VPGA 2VQ3A 2Q1UA 4YAJA 2C5EA 3NJ4A 2AG8A 5TGDA 3GR6A 5KVSA 3HFGA 3NV9A 4XB1A 1S7CA 3JD0A 3KYDA 4JX8A 4PRLA 3ROPA 3VPFA 2DTDA 1VL0A 5I9NA 4BGUA 2JFFA 1U8FO 4KOAA 5K0ZA 2JL1A 1AGNA 4G65A 4ZA2A 3C1OA 4U6QA 5ER6A 3ZNOA 2YV2A 3G49A 1MXHA 1B3RA 2NSDA 3IKVA 1T2DA 2UUPA 4WOKA 1JVSA 4YRDA 5L3ZA 4WCFB 2FWMX 2JD1A 5CPFA 5C5IA 3QVXA 4PVCA 3PWKA 4LW8A 5JBIA 1XHLA 4J49A 2YV3A 3EZLA 3KYBA 5COQA 2UUOA 4GH5A 3UCEA 4HNGA 1TLTA 3P5SA 3ITKA 1HDZA 1LU9A 2DUWA 2FPPA 4ALLA 3HG7A 4O0LA 4TRJA 4U5QA 3NYWA 4E5KA 5C7OO 5BSEA 5IN5A 1LX6A 1MUUA 4HFRA 3E18A 3ENKA 1VJ0A 3BTVA 3DMTC 1UXIA 3WIDA 2CMDA 2OHXA 2YHIA 4U6SA 2Y05A 3EC7A 1XR3A 4RQTA 2LDXA 3SC6A 3PDJA 4YT4A 2NTNA 1VL6A 2BFMA 4MOWA 1T24A 5T8KC 2G0TA 5B1YA 2WYWA 4D3FA 5AOVA 4NH4A 4O6VA 1C14A 2ZQYA 4DYDA 5MDHA 3FI9A 3RIHA 2C20A 3RBVA 1ONNA 4J4TA 3A06A 2FSSA 4L8VA 2YUTA 1P33A 3HN2A 1ZNQO 3JQBC 1J49A 2LDBA 2VWPA 1FDVA 3V5NA 4A73A 4YR9A 2FPIA 1IUKA 2JCVA 3GAZA 5LC1A 1Q0QA 1PGQA 4CLRB 1LUAA 2VT2A 3GG2A 4R9SA 4YQYA 4ZQHA 5G0SA 1DFHA 1CERA 3ZGYA 1N2SA 3OQ6A 3VHRA 4Q3CA 4ITUA 3C1TA 3PEFA 4Z0HO 4AJIA 5B12A 5U1PA 3H4VA 2VRCD 1XELA 1ZCJA 2X9VA 1GTMA 4CM9A 4ZN6A 1WLYA 4DPMA 1QORA 2WD8A 3W4JA 2J3JA 2O2SA 1HF3A 1C1XA 1XSEA 2B4RO 3VAZA 5ILOA 1Y7TA 2VWHA 4GAEA 1YB1A 1GZ6A 3WYEA 3WFIA 2VHWA 2GN8A 3RVDA 3MJSA 3DMYA 4ZQEA 4PG4A 3OF2A 5JMPA 3OJOA 3FNEA 4DA9A 3PYMA 4JK3A 1YJQA 4J7UA 3AOEA 5AVOA 3ZWVA 3G1TA 3JD4A 2NV6A 1R4MA 3O38A 4Q3AA 1NQAO 3QW2A 4W9NA 1YGYA 4CQMD 2ZCUA 5JY6A 1XU7A 1PX0A 1IHYA 5DOZA 1QYXA 4IQ8A 1E3SA 4YJGA 2JKVA 5A02A 2E6UX 4OXYA 4RVGA 3JQAD 5ENVA 4CM8A 1ARZA 4XRGA 4BO7A 1P1HA 3SLGA 1ZEJA 2GASA 3BMQA 2X6TA 3QWAA 2YZ7A 4U8GA 4E4YA 1PU2A 5AXDA 5BT9A 3GG9A 3LU1A 3GDOA 1BXKA 5IG2A 7MDHA 5KJ1A 3UCFA 3WGGA 4NBTA 4OGWA 3CKYA 5HS6A 4FB5A 1F8FA 1H6AA 1RM5A 3NDJA 5BNFA 4DREA 4AJJA 1ISGA 1JVBA 4W4TA 3W8DA 3CH6A 3AY7A 1DRUA 4IXWA 1FDWA 4YRAA 4PG5A 3PXXA 1HDGO 4R01A 4D79A 3ZU4A 2CUKA 4BNIA 4M87A 2I6TA 4JXKA 4RF2A 1KVTA 2GD1O 3L4SO 1ONOA 3ZU2A 1C0LA 4CMGA 3EVTA 4ALMA 4HKTA 1F14A 2QRLA 3JSAA 1I2ZA 3U49A 2ZKLA 1JDJA 3QA9A 2O3TA 2O3JA 5IZ4A 4DIFA 3OP4A 4N7RA 4BNFA 2G5CA 3WJAA 1C1DA 4CV1A 1NAIA 4PG8A 1LEHA 4A5OA 3RROA 1CQIA 1P0CA 1I0ZA 1ADFA 4WCDA 5ADHA 4QFDA 4BV9A 3BMNA 3GDGA 1I5RA 3ZHYA 1U4OA 4ND3A 1UAYA 4OL9A 7ADHA 3AUUA 1GEGA 2WM3A 3QP9A 4W7HA 3DBLB 2B4TO 2C7VA 3RKUA 2WD7A 1NASA 1YE3A 2H9IA 2X0NA 3BHJA 4JN6B 2FZWA 3IP3A 4L0QA 2YJZA 3WTCA 4YPOA 3OM9A 2IRWA 3LLSA 3IUPA 4IQGA 4I9NA 5TIIA 1B8VA 4ESOA 4JLWA 1EDZA 1GAEO 4CR6A 4IXTA 2ZIZA 3GF4A 3QWIA 1YL6A 2Y66A 1NWHA 1JWAB 2F00A 2X9GA 5JS6A 4IQ0A 4II3A 2IZ0A 4WLNA 1NFRA 5T5QA 3INGA 4NK4A 5IDQA 3IMFA 1KVQA 2EKLA 2VN8A 2EERA 2V6BA 2VOJA 1O0SA 3OSUA 1M67A 1V6AA 3HQ4O 1I2CA 4DRYA 3JD3A 1DAPA 3Q9UA 3GUCA 1EMDA 4O1MA 4RCVA 4A27A 2E82A 5I7EA 3GHHA 4ZRNA 3ICPA 1DRVA 2DFVA 3Q11A 5JW6A 2BH9A 2H6EA 2JHFA 4WECA 3DAPA 1SAYA 5TT0A 3L77A 1B16A 2VRCA 3GRPA 3LT4A 1W73A 1DLJA 3NT4A 1PWZA 1GU7A 2AW5A 1ML3A 3C1AA 2P9CA 4W6ZA 5F3RA 2WJPA 3WOHA 1ULSA 3IS3A 3HDYA 2DQ4A 1EUZA 1DIBA 4CMJA 2VWGA 5BSFA 1LDMA 3X2EA 4NBRA 4IDBA 1IYZA 1H9BA 3JQEA 4ZVVA 1W0CA 3AM3A 1R0KA 1U3TA 1V9LA 3JYPA 1H93A 3UXYA 3TN7A 4D7AA 3H9JA 1S6YA 1KY4A 3UFXA 4L4RA 1PZGA 1W4ZA 4CQMA 3SEFA 3VH2A 5BSHA 2A35A 1PJ2A 2BRUA 3M2TA 4BNHA 4L75A 3GFGA 1WVGA 4RVFA 1Z75A 1MFPA 1QSGA 3JQAA 3DZKA 3GQVA 4FC7A 4MP8A 3RFTA 4YT2A 1W8DA 4DTIA 1DHRA 2ZJ0A 1V0JA 4D46A 6LDHA 5I8ZA 4FFRA 4J9UE 1IZ0A 5TJHA 2WDZA 4K28A 4CMBA 4DXHA 1I10A 3JQFC 4FPXA 3WNVA 3C85A 1QMGA 3DZGA 4R69A 2YHIB 1LSSA 1PQUA 5G4LA 3BMOA 4NI5A 1I30A 2PY6A 2OP1A 3WTBA 3KEOA 1TT7A 4BNLA 2R2GA 4UREA 4KP7A 3ASUA 1NPTO 3S2FA 4E2XA 2EIHA 4CM4A 3KYCA 4GLOA 2Q1SA 2VTDA 1ORRA 4MP3A 3GPIA 1EUCA 1E3LA 3QVWA 5I8WA 5EPOA 2EW2A 1HZJA 2I67A 4CQLA 1RJWA 2Z1NA 3KXDA 3VVBA 3DOJA 1WNTA 3I52A 3FHLA 2GR9A 3ONEA 1UZLA 1M6WA 1NQTA 4WNCA 2OO5A 2CSUA 4UEKA 2GLXA 1C0KA 1HDCA 5TRTA 3GN1A 4MVJD 4OSPA 5G4KA 3U4CA 4AJEA 3HDHA 4RVUA 9LDTA 5CEFA 4YQZA 1P9LA 1M2WA 2ZCVA 4CJXA 3NDRA 3HFSA 2B0JA 2JFGA 3PHLA 2DBQA 2D8AA 1K3TA 2AE2A 4UUOA 4BNKA 1A71A 4PLHA 3PIIA 4MPDA 3JQ7A 3OBBA 1NPYA 1C1XB 2ZB8A 1PJTA 2AQIA 4Y9DA 2PTGA 2A92A 5I9MA 2R00C 4R4JA 5JAIA 4MVJP 3KETA 3TF5A 4WASA 4L4SA 3QHAA 1QYVA 3D7LA 4IMRA 4XR4A 4XJTA 1G1AA 2HQ1A 1EVJA 3IP1A 4PFJA 3DO5A 4RLHA 3MTJA 4FJ2A 2ZQZA 4CM3A 1TA4A 3JQ9C 5HA5A 5L9AA 3ASVA 3D0OA 1SBYA 3DFUA 3MZ0A 4YJGB 4B4UA 1A4IA 1OI7A 1U1IA 1SZJG 1ZMOA 2Q49A 3F5SA 4KWHA 1QG6A 3H8VA 4BB6A 3D4PA 5B4UA 3LZ6A 3KSDO 4CM8B 4FFMA 1CEQA 1DFIA 3UGKA 2X9NA 3PFWO 3B1KA 1P3DA 4IUYA 2D0IA 1B3BA 2Y1DA 4BUCA 2NWQA 3RQSA 5KJEA 5I7VA 1XU9A 4ALNA 4HV4A 2Y99A 1HL3A 2O4UX 3GNTA 4M86A 4RZIA 1LRLA 3LT2A 4CLRA 1EVYA 1GZ3A 4UUNA 3ZWMA 2W98A 5A04A 3CINA 1N92A 5EMHA 1UZMA 1GQQA 3ZNNA 2EJWA 3TRIA 2JD2A 2NADA 3TZHA 2HMWA 1PJBA 2O4CA 3DDNA 1G0OA 4N54A 4Z9XA 4JCOA 4UEJA 2AA3A 4X54A 3IOYA 3W8FA 4J0FA 5JXWA 3C8MA 3AW9A 4BIIA 4IDAA 1OC4A 1DIGA 1NYTA 1JU9A 2XF8A 4XQGA 3I4CA 3VZQA 3PP8A 3RCBA 3U4IA 3T4XA 4HWKA 4IS2A 3OETA 3PDUA 1K6XA 3G79A 2OOSA 4YDRA 5AXBA 4LSMA 1WP4A 1CIVA 1NTOA 4P4GA 3TFQA 1T2AA 1VJTA 3NEPX 3VZSA 1IY8A 2BGLA 3AY6A 4CMEC 3ZHXA 3BMNB 4EZBA 5KJ6A 1YDWA 5I7SA 1DRWA 2ZYGA 1GEEA 1LLQA 1YKFA 1RKXA 2O48X 2TMGA 1U3WA 2WD7B 2ZB3A 3A1NA 3C7DB 3DZHA 5A9TA 4E5PA 4XR9A 4OKIA 2PZJA 2FRDA 4YT5A 4OXNA 3TSCA 2AEJA 1PTJA 1K5HA 1ULUA 3WB9A 5FEUA 3I9MA 3PFFA 3VZRA 1ZMTA 4PLYA 2NTVA 3C24A 4BVAA 3VZPA 1KC3A 3I9NA 3STHA 1N9GA 2HJSA 4UVDA 3TPCA 4E2ZA 5HS4A 3VDRA 1O89A 1UDAA 2DTEA 4OH1A 1DJQA 3PHGA 2PGDA 4YTEA 3H5RA 3QJ5A 1X1EA 4J90A 3PQDA 1NVTA 1U5CA 2PKQP 1T2FA 3NGLA 5KVVA 2GGSA 2Q1WA 1MC4A 1V3TA 3OIFA 4BNTA 4BV8A 3EAGA 3C3XA 1YB5A 1UUFA 2HJRA 2JFHA 4QFCA 4TSKA 1N5DA 2HMVA 3OA2A 3WDSA 4YEDA 3ZW8A 2C2XA 2Q2QA 3GEGA 4N5MA 5F1OA 4KUHA 3FCOA 3QVOA 2CZCA 3ZN2A 4D43A 1BWSA 5L7YA 4U0JA 3VH1A 2HO5A 3CMMA 2O3QA 4MVJF 2I76A 4HFMA 2WE8A 2O3RA 3IC5A 3H2SA 3S2IA 1N7HA 4BHTA 1RWBA 1Q0HA 2CVOA 5EQFA 4C4OA 1ISHA 2JCYA 1GDHA 2Y1EA 4I9UA 4FQ8A 3ZV6A 1IB6A 4RVDA 3GDFA 4H15A 4RDHA 3T7CA 3JD2A 3V1UA 5GZ1A 3H65A 3RKRA 3E82A 1XWFA 1IL0A 4YRBA 1O94A 4DC1A 4F46A 2C59A 4R5HA 3H5NA 4CQMB 3HUDA 1XQ1A 1K89A 2E37A 2VHXA 5IXSA 1CYDA 1H9AA 1A9ZA 2ZB7A 2VWQA 3CZRA 4GGOA 2Y0CA 4N5NA 3BHMA 1BXGB 3Q0EA 1RPNA 3KV3O 1PGPA 4QUKA 6ADHA 2GSDA 1ID1A 5A05A 5L7WA 4CMHA 3TZ6A 4DLLA 3JYLA 3P2OA 4AFNA 1UXKA 5F5NA 4DVJA 5F1PA 3LYLA 4B7UA 2I9PA 3HDQA 4BQPA 3ORFA 4J91A 4WNIA 3QWBA 1ISFA 4GQAA 1TB4A 2O50A 3F4LA 3FSRA 3DONA 3BMOB 3OA0A 2P4QA 5DP2A 1Q0LA 1D4FA 5CFZA 3D1LA 2CDAA 1PJSA 2QYSA 1KEVA 4TVBA 1P31A 1Y5MA 4FIZA 3G1UA 1F17A 3OJEA 3DXFA 1XDWA 4QEDA 3V2UA 3AWDA 4NIMA 1WMBA 3FBGA 3KRTA 3KYCB 4BMSA 3I6QA 3W8EA 3MJCA 3GGOA 1P77A 1IPFA 3DZFA 1ENYA 3ZWXA 2GZ2A 3DBHA 3U9LA 1KVSA 4CQLB 1H2HA 3K9QO 4QQRA 1HTBA 4S3MA 1BHSA 2D3TA 1YWGO 4IJUA 4OAQA 1ZO8A 4GKVA 2Y1OA 3ENNA 3RD5A 1HXHA 2VOEA 2X8LA 4IDEA 1U8XX 1MC5A 3PTZA 1U9JA 3CTMA 3HSKA 5G4KB 2QQ5A 2P2SA 3PWSA 4L73A 1TXGA 4HY3A 2GO1A 5DF1A 4RLSA 3I1JA 3NX4A 1AXEA 2B4QA 2WYUA 4OQZA 5JO0A 1J5PA 1LQUA 1NVMB 4BL5A 5B4VA 1QP8A 3VPXA 3BZUA 5JDIC 4J9VA 3L4BA 2YY7A 4AJKA 3H9GA 3KVOA 3JQ7B 4DQVA 1T1RA 2OORA 2Q46A 1X0VA 2HMTA 4FFNA 3UAGA 4CL3A 4PN3A 3F46A 4K26A 1MLDA 1LLCA 3GLQA 4MKZA 4TVOA 4XA8A 3GK3A 3LK7A 4J43A 2GNAA 4OMUA 4BNZA 5CDTA 3VTZA 5K6AA 4QO8A 1F12A 4J16A 1CJCA 3DBRA 1BG6A 1L7EA 1AUPA 4Z3DA 4WLUA 4GI2A 2QYTA 2OBYA 3EGOA 2FOIA 4EW6A 1OOEA 3WGHA 4JJIA 1SC6A 4IDCA 1E6UA 4CM1A 4EUFA 2QHXA 2DC1A 1UZNA 3WG9A 2WTBA 4EYEA 5LDHA 3UICA 3H2ZA 2ZJ1A 3WNQA 3ZCXA 2P9GA 3K96A 1P1FA 1U7TA 4OOEA 4LN1A 2Y1FA 4BKUA 3CPSA 3GVCA 1HWYA 2DBZA 3O8QA 3OFSA 3U0BA 4RF5A 1PSDA 1LNQA 1MB4A 3H9EO 5H83A 3F3SA 3B20A 3TL2A 3K6JA 1XQ6A 4JJFA 2I3AA 2X4GA 1C0IA 2X86A 4LCEA 1U2DA 1DAOA 2IZ1A 1E0DA 1J4AA 2X5JO 4ID9A 3OJ0A 3ULKA 3GC6A 4B7CA 1UAGA 2PV7A 3AOEC 1MXFA 1NVGA 4UVGA 3ZDFA 3FTNA 1C3VA 3H7AA 3I5MA 3ZH2A 2QX7A 4JBGA 2I3GA 2NACA 2WE7A 3UOGA 1Z45A 1KVUA 1NNUA 3BMCA 5ICMA 3KZVA 3UF0A 4MJLA 1PJ3A 3V1YA 4IIUA 3L6DA 4ONEA 2QIOA 4NNJA 1K6JA 3MJVA 4NBVA 1OMOA 2CY0A 2IEDA 2B69A 3OJFA 4DUPA 1I01A 1PL8A 1YJ8A 1ZJYA 4AJ2A 4GX2A 4LMPA 4BNGA 3SJ7A 1EFLA 3V8BA 1RM0A 1NP3A 5L4SA 3ZHZA 5COBA 2AQ8A 1EFKA 1EEHA 3PZBA 1DOHA 4B3IA 2HLPA 1QLJA 4RPHA 1E3IA 4QX6A 4M55A 1XCBA 3ZNQA 3K5PA 5KNLA 3NRCA 4G2NA 3AUAA 3R0IA 1I2BA 4NK5A 1EZ4A 1VPDA 4GX5A 1QV6A 4QT0A 4AJHA 3AK4A 5DCWA 4FSHA 2TMDA 1NM5A 1HSOA 1FDTA 1ZVMA 5A5EA 4RVHA 2VHZA 1A72A 1BTOA 4Z0PA 2WYVA 2VUSA 1EQ2A 4FDAA 3BHIA 4RJTA 2Q4BA 4RF3A 4E33A 1QV7A 1X7HA 4HFNA 1GUFA 1C0PA 2BMAA 4NJOA 3GEMA 3JD1A 1N9GB 3S2GA 1ZW1A 3ZWWA 5HBRA 4J1NA 1HYHA 2JAPA 1DHTA 4B3HA 4BO4A 4G5HA 3T4EA 2I65A 5CEJA 1FK8A 2PKQO 3FN4A 3RI3A 4CR7A 3ZW9A 5CEEA 2GCGA 3FNHA 3GGPA 1XKQA 4CV2A 1J0XO 4XIYA 3MJEA 5DOVA 4BMNA 4IJWA 5MGBA 5G0VA 5KJCA 1Y8RA 1E5QA 4DBZA 4GX1A 3I3OA 4EJMA 4RGBA 3RUCA 3ST7A 1HT0A 2RAFA 3FR8A 4PCVA 4WEQA 3VKVA 3VDQA 4ZD6A 1QYDA 5GZ3A 4H3VA 1YS4A 1SCUA 2AG5A 3NGXA 3RBXA 4EI2A 5A1TA 1QYCA 3ZU3A 1ZUD1 4DLAA 1J6UA 1GUYA 3TZQA 1E7QA 1U28A 2YDYA 5EESA 4MIEA 5ITVA 1GY8A 4U0KA 2X5OA 4K6CA 4R54A 3ZWOA 2FPGA 3WGZA 1PGJA 2ZYDA 3CSDA 3WX0A 2ZK7A 4NMHA 1Y5RA 4PVDA 1EK6A 1RYDA 4EBFA 3QWHA 3AFMA 1Y9EA 3EUWA 4QECA 1WAMA 1I36A 1P44A 1X14A 1GFSA 4B8ZA 1SPXA 1ZBQA 1YOVA 2HK9A 5TS3A 4NPCA 4E5MA 3FTPA 2Q2VA 4GSKA 1SB9A 1JN0A 4MKRA 3GA0A 1GPDG 3WXBA 2VHYA 2X23A 1IHXA 4R3NA 2UV8A 3OECA 2SCUA 1KYQA 1Q7GA 5I9LA 1UDBA 4J1QA 4KZPA 4PLGA 5HTOA 3BTUA 1ISJA 4QXMA 3QV1A 1H6DA 2YV1A 3ETEA 1HYEA 1I3NA 4U7WA 4AJNA 4Q39A 1NBOA 1OC2A 1LA2A 1E1MA 3DB2A 4MKXA 4E13A 3UW3A 5JCXA 2GDZA 3I83A 4R51A 4P22A 4IS3A 1R0SA 3W4IA 1ZXLA 3AJRA 4KMSA 4N18A 5EERA 4NR0A 4GX0A 4Z9FA 3CZMA 4Y6PA 3SC4A 3DBHB 2VHVA 3ETGA 1M66A 4DIBA 4MIOA 3E48A 2Q1TA 4ZJUA 2RCYA 1AN9A 1E5LA 4K1LA 5L45A 1BGVA 2P4HX 3DTYA 3NTRA 4NJMA 1KY5A 2C5AA 3TFOA 1EBFA 1OZAA 2NLOA 5IZCC 3GVHA 4BKPA 5AYVA 5DCUA 3KLPX 4RDIA 4IIVA 3H3FA 2PKRA 4BB5A 4K6FA 3FD8A 5CDUA 1ZSNA 4L9RA 4A2CA 2FN7A 4ILKA 1ADBA 3DOOA 2FP4A 3ETDA 4F6CA 4Y6RA 4B4VA 1SOVA 1ZJZA 3FNGA 4KUEA 4BNUA 3S8MA 2UDPA 4WLVA 3FRJA 3WGOA 4KDFA 1U2GA 5TQVA 2EKPA 1JAXA 3PVZA 4PLTA 1YH3A 1BXGA 3TOXA 2NUAA 1HEUA 3NUGA 4F45A 1PS8A 2X58A 2BI8A 5THQA 4B8WA 5F21A 5I7FA 1GYQA 1OBFO 3EHEA 2D2IA 3DBRB 1LTHR 4LCJA 3OH8A 2EGGA 2QZZA 4ND1A 1EK5A 5JC1A 1YL7A 3F9IA 5KKCA 1EVZA 2FY8A 4DC0A 3UKOA 2BGMA 3DC2A 4AL4A 2Y0EA 4WLEA 4RQUA 4PG6A 4ROSA 1E7RA 3O8QB 4WCFC 3ADOA 4YBZA 1EVIA 2HKIA 4PZDA 1KERA 2AE1A 3E6AA 4B4OA 2G82A 3ROQA 3W4KA 1PZFA 1R15A 1BRMA 4GMGA 4CMAA 4II2A 3NDIA 5EINA 5A9SA 2C54A 4Q3NA 3AI3A 4EGFA 4E5NA 3OIDA 3HB5X 1ISMA 5A06A 4KQWA 3LC1O 2VCYA 3GHYA 3JQDA 1JAYA 3EDMA 5IDWA 4JROA 5DNAA 5H82A 3EYWA 4KTVE 1BVRA 1YQDA 5DBIA 2CDBA 3RC1A 5K9ZA 4MO2A 5A3JA 5IAAA 1YQGA 1KIFA 5TJ9A 3BMCB 3HZZA 4L74A 2HK8A 5JSFA 3CUKA 1PQWA 3K2EA 1XLTA 3IKTA 4FD3A 3WGYA 3K30A 3ZWCA 2V6FA 1VE9A 3F4BA 5KTKA 4WUVA 2PD3A 3PHIA 1E6EA 3LLVA 2DTXA 3Q2IA 1LRKA 2VT3A 1ENOA 1E1NA 1FXSA 3QWFA 1CQJA 4IDGA 4OHUA 2J3KA 2B83A 5DCYA 2D5CA 4ZQFA 1UJMA 2NTJA 3JYOA 4MVJM 4BNJA 5JY1A 5L4NA 1XIVA 1DIRA 3RC7A 1Y6JA 1Q7CA 1JLLA 2C82A 3ZZNA 1D3AA 4AICA 1TI7A 4LVCA 2HDHA 4E2YA 1R12A 2E49A 4IDDA 1H94A 1YBVA 2EXXA 4TRMA 5L53A 3CE6A 3LVFO 3IUSA 4HP8A 5A4DA 1ZK0A 3ONFA 1ZK3A 2EG9A 5FWNA 2Z5LA 1V35A 4J0EA 3OEWA 1VKOA 3KBOA 4TWRA 1KEUA 1I24A 4Z0TA 4CMCA 5JLAA 1E7SA 2PH5A 3ROKA 4EEXA 2X1HA 3PLNA 3V2GA 4YYZA 4BGEA 4GWGA 1LI4A 3R3SA 3VPSA 3K31A 1ZH8A 1T1SA 4F6LA 4B79A 3Q2KA 2OXIA 2RHRA 3WQQA 1NWCA 1ADGA 4FFOA 4CPDA 1VI2A 4YAKA 3PJGA 4W99A 3T7EA 1RM3A 4J1SA 4XEHA 4P38A 3G17A 1NAHA 4ZICA 1JTVA 1KS9A 1VJ1A 3SVTA 1Y8RB 3ZWPA 3I23A 4GL4A 2RH8A 4UUMA 4XYEA 2EV9A 2CDCA 3H9UA 1HE4A 4YJHA 5JC8A 3AUTA 3WBFA 4OKNA 5BNTA 1HDXA 3M2PA 3L6EA 4Z9YA 2F1KA 1L7DA 2PR2A 3JCZA 3B6ZA 3ZHBA 4Z3KA 5JE8A 4HUJA 4FN4A 3R1IA 1NR1A 4QSMA 5KOIA 2O7QA 4ALJA 1P45A 3W6UA 4RVSA 1BVUA 1VRWA 2ZTUA 4B7XA 4BKOA 2GERA 2P68A 4EJ0A 4WPGA 1O9BA 4XD2A 1ADCA 3D3WB 1NXQA 1MP0A 3RAJA 3DWFA 2POQX 1BXZA 1O5IA 4WJZA 3TL3A 5DBGA 3WGTA 1HETA 3KM0A 5CP8A 2HU2A 2Y67A 3UVEA 3O4RA 4EUEA 1IPEA 1GD1O 1YRLA 3OICA 5CDYA 2BF7A 3BTSA 1X7GA 3RFVA 1RM4A 3ZWBA 4P4NA 1DEHA 3X2FA 3ZV5A 1Q7BA 2NM0A 2P91A 2PA3A 4I5DA 4R5MA 4UEOA 4BO6A 1YOVB 2WMDA 4DPLA 4E3ZA 1R6DA 2YQ4A 3OEYA 2NNLD 4NU6A 4TZKA 4UUPA 2PZKA 2AEMA 4PLZA 2OL4A 1PL6A 4MINA 1LQTA 5ITWA 4EUHA 2GN4A 2DU8A 4WLOA 1ZKMA 4R68A 4JQCA 1KC1A 3K8ZA 4E32A 1GQYA 1E3EA 3EK2A 3GZNA 3OMLA 4PG7A 2RBEA 1JW9B 3DOCA 4W7IA 5AQ1A 5JDCA 2DLDA 5T64A 1UP7A 1EE2A 4XQCA 4XGIA 5TLSA 2VZ9A 2I99A 2DBRA 3EZYA 3PI7A 4GGPA 3P7MA 4A0SA 5IJZA 3AM5A 1UR5A 1WWKA 1K0UA 4UVEA 2FMUA 2Z95A 1IOLA 3GEDA 1V8BA 4XB2A 4HNHA 3I9LA 5EIOA 2GYYA 4L4XA 4R16A 4XIJA 5C3MA 2HAEA 4KQXA 3K92A 4BO1A 3ROMA 3NT2A 5LCXA 3LC7O 1Q2XA 2UVDA 4NJMB 2HUNA 3AU8A 3QQPA 1FDUA 4XQEA 1U3VA 4FW8A 1OFGA 1AXGA 3UN1A 2GF2A 4CLHA 1TT5B 4HFJA 5A5FA 3ONDA 4MVJI 3DZBA 5AXAA 3TQHA 4I5GA 4RPGA 1T4DA 3E5MA 4CODB 2C29D 2GUGA 1LC3A 2E48A 2FSVA 2QZ9A 3L0DA 3G3EA 2C0CA 2EP7A 1R37A 2PFGA 3U3XA 4NQZA 1X1TA 1DC3A 3NJ8A 1X15A 4PLCA 2NVBA 5C7IO 3DHEA 3GUYA 4IGEA 3WWZA 4BMVA 4OM8A 5TSDA 2H1SA 2EJVA 1IE3A 1E1KA 2AEFA 1Q1NA 1DBVO 3LF1A 2WWRA 1W6UA 4BKRA 3A4VA 3LQFA 2FR8A 1DC5A 1ZK1A 4Y6SA 5THKA 2PZLA 4RV9A 1U3UA 1WXDA 4J4BA 4FFLA 3WFJA 3FPLA 4Q3BA 4ND4A 4Q3EA 2J5QA 4BO9A 5JFOA 4EDFA 2YYYA 2HRBA 2Q4EA 3RUIA 3UUWA 4J6FA 1UP4A 1Z6ZA 3KOUA 1NFQA 3LC2O 3L4BC 3U4HA 2VYVD 1B7GO 4IJVA 4J1TA 1X0XA 2WEKA 5C37A 3K73O 3GN2A 4UAGA 4BQRA 3ZWAA 5A9SB 1Z82A 4AJOA 1F8GA 2HMSA 5L51A 1H6BA 2PWZA 4B3JA 4YXFA 5K6AC 3WMWA 1JKIA 2OGUA 2ZYAA 5BQFA 5C7LO 1LSJA 1A7KA 4KTTE 3P2YA 1L1FA 1PJQA 2GN6A 2B5WA 2Q45A 1E77A 3KEQA 3PJDA 4HXYA 3QIVA 2IXAA 4UULA 2C2YA 1SEVA 3I9JA 3G0OA 3WSWA 1VSUA 3HE3A 2EGHA 1CWUA 3QVSA 4IZIA 1I3MA 2X0JA 1EDOA 1T2CA 1U7HA 4MVJG 3UH1A 4CLDA 3A14A 3AU9A 2DUUA 4J4HA 2X0IA 3B70A 4XDYA 2GRAA 4EEZA 4DL9A 1GUZA 3HDJA 3MWEB 2VYNA 2YW9A 4TMFA 1LDNA 3WJ7A 1UXJA 2HCTA 1PQPA 2O3UA 5CPBA 4EJ6A 5HM8A 2B37A 3JYQA 3DAGA 1A27A 4CMIB 4E5YA 2J5KA 1LJ8A 3KSZO 5KIAA 2ZATA 3AUSA 3ZWYA 4YAIA 4GKBA 1F06A 1MG5A 1UP6A 3D4OA 3DFZA 3TDKA 1ISIA 3DBVO 2CVZA 4NZ9A 4OXKA 4MP6A 1BSVA 1KVRA 1WZEA 3Q1LA 2QRJA 3TZCA 3GNSA 1EQUA 2VTEA 2D1YA 3ZV4A 1NR7A 4DGSA 4FGSA 1PJLA 4IJKA 3M1LA 4FJ1A 5TNXA 4TRRA 5ICSA 2GN9A 2QG4A 2H5LA 4I08A 3FNFA 4MVJE 3LSYA 3JQ8A 5CG1A 4HX5A 2PD6A 3L07A 4XCVA 1ONPA 1YQXA 2VUTA 4OYRA 1ZIDA 1G0NA 2QRKA 4BNVA 4UVHA 1H2BA 1E7YA 2BFOA 2V65A 3VH4A 1DO8A 2Y1GA 3IJPA 1PS9A 5GZ6A 1SOWA 1UXGA 3WSVA 4PIVA 2W2KA 1MV8A 2Q3EA 3FR7A 1I3KA 4W82A 4HBGA 5JDIA 1A5ZA 3RUFA 1LXCA 1DJNA 1VC2A 1GZ4A 1ZZEA 2CF5A 4W9NC 1B15A 1PR3A 1H5QA 2J8ZA 5H81A 1M76A 5FI5A 4CUKA 2W4QA 1DC4A 4CLOA 4BS9A 4R3WA 3EVNA 2J6IA 3NKLA 1WZIA 1PWXA 1O6ZA 2I5PO 4YJHB 1IZ9A 3D4NA 4YJDA 4ZU3A 3R6DA 1DB3A 3TOZA 4QO7A 2YFHA 2GZ1A 1GV0A 2VNSA 1B26A 2NVWA 3JTMA 1KBZA 4XJSA 4R1NA 4LRTB 4UVIA 3DMTA 3WQRA 2DPGA 1R66A 2EHDA 2CNBA 1NFFA 4CUJA 1E1LA 3W6ZA 3DAFA 2J3HA 1V3UA 2GPTA 1XYGA 1Z7BA 4RF4A 5CHEA 1GR0A 3WYCA 2XXBA 1GL3A 2RH4A 3GZ4A 3LDHA 5T8KA 4AJLA 2BKAA 2VUUA 4WLFA 1D8AA 3KHUA 5DDIP 2AMFA 2IYPA 3DQPA 3DR3A 3PWZA 2XXJA 4FC6A 3LF2A 4ND2A 1ENPA 3CMCO 3GVXA 3JQ6A 3Q3CA 3O9ZA 3JQBA 2UAGA 1YO6A 2FR1A 4K9DA 1OAAA 1Y81A 4H16A 4OSOA 5EN4A 4FOSA 4H7PA 4PGFA 4XYMA 1GQ2A 2J5RA 1LSOA 5IXYA 5JAZA 1YXMA 1SNYA 1PGOA 2VYVA 3RU9A 9LDBA 2BGKA 3PJFA 5L40A 5TX7A 5BNIA 4PLWA 2QW8A 2RHCA 2FHSA 3B1FA 1PZEA 4KWIA 2CD9A 1H6CA 1ZEMA 1NQOA 2YQ5A 4XQ9A 1SEPA 4LRSB 2BELA 1DFGA 1GCOA 4IZHA 1R16A 5HWSA 2V6GA 3GZNB 3IQDB 2W90A 1Y9AA 3EMKA 1O8CA 2UYYA 5TT1A 3DHYA 4CM5A 4YWJA 4DPKA 4RPKA 5BSGA 1NX6A 1UDCA 4NHEA 3TZKA 3MWDB 4LSWA 3V1TC 3INRA 5KKAA 4I5FA 3DZJA 3GH3A 3AY3A 1B2LA 8ADHA 3GVPA 1AE1A 2Y93A 4J2OA 4D0RA 5ES3A 3RUHA 4TZTA 4NDNE 1ZSVA 3AFNA 3MOIA 3QSGA 3GMSA 3WQSB 4I8XA 4BO2A 1U5AA 5IN4A 3FWNA 3DTTA 2A94A 2WSBA 2VZ0A 1HZZA 3ICCA 4J2HA 4B4WA 1YB4A 2DKNA 4PRKA 3GT0A 4I9HA 1HLDA 3F47A 5ER9A 1DSSG 3P19A 2DAPA 2EF1A 1FJHA 1YBMA 1ZK2A 1A9YA 2C07A 3PHHA 4XX0A 3D3WA 1KOLA 3UCXA 1R0LA 1E3WA 3GAFA 3BA1A 3OQ1A 4D44A 5L95A 4LMRA 5T6BA 2CFCA 2NVUA 1BMDA 1QLHA 3EW7A 4AJ4A 1BDMA 4BOYA 4DMMA 1E7MA 1T4BA 4L76A 1QRRA 1K6IA 3ZWNA 2JD0A 4DQXA 5DZSA 4D3DA 1LDEA 3B1JA 1LBEA 3D64A 5G0TA 3S1LA 4CM7A 3DL2A 3KTDA 1HE2A 3WLEA 1XEAA 2ZTVA 4S1VA 4YA6A 1P1IA 4GVXA 1QKIA 3Q6IA 4YT8A 3AM4A 5GY7A 3WS7A 4E21A 3ADPA 4NU5A 2DFDA 1LRJA 1SB8A 1Z73A 2OBNA 3U62A 3BIOA 1PJ4A 4A03A 1GYRA 3C7AA 1Y1PA 5EJ2A 3PYLA 5B4TA 4JGBA 4DWVA 1Z7EA 1N8KA 4IM7A 3JQGA 4GPD1 4ZGWA 3SXPA 5JMWA 1D1SA 3E1KA 5FI3A 1E6WA 4E30A 4RZHA 2A9FA 2D5AA 3PQEA 4R1TA 5JO9A 3JYNA 1B8PA 3EY4A 3BYZA 1HE5A 4GSLA 3KLMX 4O63O 3RUAA 4GVLA 1Y8QA 2DT5A 5DP1A 2EWMA 1ZSYA 4D0SA 1MGOA 4OJNA 4XRRA 2HRZA 1X13A 1NHGA 1HDOA 3N58A 4INAA 1B0AA 5DBFA 4WK6A 1JQBA 3KB6A 4NBUA 2IEBA 3PQFA 3PZRA 4NG5A 1E7WA 3WIEA 3WYBA 1YL5A 4XGKA 3SLKA 1P74A 1TT5A 3OJLA 3F6YA 4J7CA 3OHSX 4OIMA 4R1SA 5CG2A 2RIRA 5U4QA 5FYDA 1GYPA 2E4AA 4YAGA 4ZRMA 4A10A 2G17A 3C7CB 3MJTA 3F1LA 5G0UA 2XOXA 2Y68A 5EQDA 3SJUA 1PJCA 1V3VA 3HB4X 1ZXBA 3CIFA 3H9QA 4Z6KA 3QRWA 4BO0A 4R41A 5B37A 3KYDB 1H0KA 4BGVA 4NBWA 2O23A 3TNLA 1P1JA 2AQHA 5COAA 3U09A 4IBOA 1CRWG 1PIWA 4IINA 4FR5A 4N5LA 3HJAA 1I8TA 4WOJA 2BD0A 3VVCA 1X7DA 1TVEA 1SMKA 1DLIA 3F5QA 1N1GA 3GOHA 4BNXA 1HSZA 4YJFA 3RSHA 1FF9A 1BW9A 2OFPA 2HSDA 4PZCA 3D5QA 4BNYA 5DN9A 5BR7A 1DIHA 2O3SA 3OQBA 2ZB4A 4CUZA 4E0BA 1WDMA 4GWKA 3GY0A 5FFFA 4WEOA 1VSVA 1KEWA 3RJ5A 4FBGA 4YCAA 1PS0A 1XG5A 1LSUA 5CDGA 2X7HA 3JQ8B 4ZHSA 1N1EA 1DC6A 5DULA 2FR0A 5IZCA 3E9MA 4DIOA 3H3JA 2R6JA 1YDEA 3ABIA 3BAZA 2W2LD 3E9NA 4I1IA 1EBUA 1GV1A 2P5YA 4URFA 1WPQA 2W2KB 3ANMA 3AI2A 1HRDA 4FOOA 1AHIA 1KEPA 4E2WA 3RU7A 1MA0A 4WKGA 5G2OA 2DM6A 4Q3DA 5IDYA 1YBAA 4CLOB 2JJYA 4DQUA 1R4NA 4RO0A 2PH3A 1PL7A 3MEQA 1HDYA 4KUGA 1GCUA 5CDSA 4OO3A 4TKLA 5F5LA 1DPGA 3WICA
chains in the Genus database with same CATH superfamily
3GFBA 2R6GA 5GIPE 4TXHA 4V0QA 4WDRA 4ARVA 2FX5A 1GU1A 1L7BA 3AEUB 3KQMA 4L0DA 5TGTA 1LDBA 4MJXA 1DDOA 4UM7A 1QGUB 1U8CB 4KBFA 2XYHA 4H08A 5GM2A 3VC1A 4TQGA 2IWHA 2X6QA 4CTJA 4FINA 2ECOA 4PNZA 1C41A 1MT3A 5ARCA 4Q05A 4CMIA 4E6PA 4WT7A 1XF9A 1Y1LA 2H4WA 2HMUA 2ZUDA 3I2YX 5FBRB 5LXTF 3TQCA 5KNDA 1KP9A 3HNPA 5C51B 1YONA 3AI1A 1RYBA 4Q82A 1U0GA 3HY6A 1ZP6A 3ILXA 2OP0A 2QVLA 1Q74A 3M1AA 4C7KA 1D7OA 2JK1A 2MR6A 2ZIUB 2DMRA 2REQA 3TWOA 1K63A 2WKSA 2OGSA 1Q12A 2PO7A 2QM7A 5GWXA 4ZQBA 4YHBA 1N2CA 2EKQA 2WI8A 1QFJA 3QY9A 3D3EA 3L8ZA 4O2BB 3B8EA 3WBBA 2XSZD 3UAWA 4AMBA 5FV7A 3FJYA 4YECA 5BSRA 3TTUA 3FPSA 2O6LA 4QQ8A 3TLCA 4JVOA 5KREA 2IXDA 3GVIA 2YDXA 3M89A 2OBBA 3WR5A 4G5RA 4FWBA 2WJJA 2YVUA 5AI6A 7REQB 4ZI7B 4OI1A 1D1TA 3FSEA 5KTKA 4N82A 1LLDA 3TLJA 3FNQA 2D4AA 1JR6A 3PHJA 3VYUB 5HOEA 2R8EA 4LHYA 4XYBA 1C30A 3UTCA 3U26A 2G3YA 3I76A 4YMUA 3QJGA 2ZWMA 3MWLA 4KJZA 1V4BA 1A88A 1YZUA 3FBTA 4HADA 4XLTA 3IAHA 4LXQA 3R7NA 2PGLA 2IDZA 2Y0BA 2G28A 3PIDA 4JP2A 3V4PB 2FRDC 3FKJA 4AJ1A 5JNWA 2PLAA 2J08A 2R00A 2VDRB 3QLJA 3BWCA 1OU0A 4TRNA 5J47A 3A3PA 2EJTA 3DUFA 3W6OA 3F6RA 2NAFA 3V4RA 1P0FA 1VLLA 2L0XA 1Q1BA 1QXSA 4GMKA 1M73E 4UMFA 5TVKA 3SI7A 4IHJB 2C7QA 3X1ZA 3MS7A 2Z5FA 2GAOA 4Y2UA 3DA8A 4TLDA 2C4MA 4M9ZA 2SNIE 4BMDA 3GBVA 3L4JA 5LP6F 3VKUA 4G41A 3RSFA 1YV9A 1UJBA 3A58B 3PGJA 1QZXA 1UDXA 2GM9A 4WNAB 5ALZA 1PNOA 3M6VA 3N8NA 4TMTA 5CR9A 3V2HA 2H1OA 4K87A 3JQ9A 3GMDA 4MWTA 3T61A 4LOIA 5E1OA 4E1AA 1DKUA 1T5TA 5E7JA 4AXBA 4HDMB 1ZK4A 1CU1A 3UHOA 3GLIE 3E53A 2ADMA 3LXRA 4MVJH 4Y67A 2BUAA 2QE7A 3ANNA 3JV7A 4R05A 1D4AA 1LFDB 1GGVA 1FDSA 2ARKA 2IA5A 4KO2S 1CR1A 2QENA 1I80A 3KX2A 1UH5A 4TMKA 4UBJA 4EABA 2GETA 5E3HA 3SWWA 1UK6A 2BJWA 1GRVA 1GILA 1I3LA 2FFQA 2JRLA 2VPZA 4A8JA 1WDWB 3ABQB 4BVKA 2UUAB 2ECFA 1SBZA 1V6CA 1U9IA 1VLJA 2MYPA 3HYCA 4K3VA 4XWKA 2BEVA 4OBBA 1PP4A 4DBVO 5DTEA 4TWJA 2FEWB 4HEJA 2GB4A 1DWOA 3U4GA 3ZGNA 3QG1A 3VTFA 4LQ4A 4WDQA 4ZOLF 3WA7A 4C6SA 1WCIA 3C3BA 2IV3A 1DX4A 4D3SA 4EA7A 4QOHA 3DEYX 4ZQGA 1UC8A 5B64A 2PX4A 4EUKA 2DPHA 4RPJA 3L8DA 5G0WA 4AQDA 2YS7A 3GJ6A 1S2IA 2ZJBA 3O1LA 3R3HA 4MTLA 4NAUA 3GA5A 1WVIA 1R6VA 2I4NA 5CIWA 5AUNB 1YTLA 3EZNA 4ZI2A 2OENG 4NZZA 3NI2A 3VPHA 2CXOA 3IILA 3KB2A 3VM6A 3M3DA 1GPJA 2EWVA 3I42A 5TMBA 3TUIC 4IPTA 2BKEA 3L8CA 1GNSA 3FTCA 1XZCA 4X44A 1DQSA 2PT9A 3SHVA 2XYPA 3UMMA 3EA5A 1ADYA 3IP8A 3W06A 1TK2A 3W34A 1PGNA 5E4TA 5AW7A 1JIXA 4ZHQF 5KYXB 2RD2A 5IAKA 4MQEA 2P3QA 4YRPA 2Q50A 3I04A 1P0MA 1W4LA 2NYAA 2PT5A 1I94B 5BSKA 5F1KA 2GCNA 2A5FA 4EY7A 1XRPA 4QTZA 2ZROA 3PC2A 1CRLA 1H4VB 4BVBA 1M2OB 3BPSA 3DP9A 3S7TA 4PPYA 2QM3A 4YCLA 2YVLA 2X0RA 4LJ5A 3VSDA 5BURA 3RIEA 3U1TA 2DOKA 5D00A 4QKQA 5CDFA 5DBHX 5JPDA 2FPKA 1YFKA 4XWYA 3L7IA 3VR0A 4YUVA 5HKBA 5F76A 4B6QA 3EWIA 1CP2A 4YACA 1PN3A 2X76A 4MIKA 3VU1A 3WGIA 3DS8A 3PENA 2CT8A 4W8GA 3KFLA 2IXBA 1WHTA 1O9GA 2NZXA 3FDZA 3P45A 1ZIXA 4RMGA 3WAJA 5M2QA 5HQJA 3LT0A 5JWRA 3E5RA 5DTQA 2C31A 4X97A 2G8LA 3IUQA 2IHNA 3B48A 3TINA 2IE0A 5C8VA 1N7IA 2QN2A 5K3CA 2P5UA 4HLUC 4YFVA 5AHKA 5AJYA 5B3JC 3HP4A 3G13A 2PR7A 3TIIA 3IDSA 3WJ1A 2AG1A 4JSTA 1Y8ZA 1OA1A 5F78A 4PZAA 1ZIPA 3I9V6 4JNKA 1H2FA 1G55A 2HJVA 5JAQA 2ZRPA 3KZKA 5T67A 3A1TA 5LBTA 3GUUA 3NT5A 4F9FA 1RZRA 4OMCA 3AG6A 3GNQA 3TD9A 4BKQA 2XMDA 3DLBA 3SVLA 4MEBA 3GH1A 3N2GB 3WGMA 5JZMA 2PK3A 3TX6A 2B20A 1HLGA 4L3VA 1L5VA 2XZTA 1PR1A 2QAJA 3TMYA 1G2IA 1JHQA 4Z4EA 3DBLA 1TJ4A 1V2GA 2G76A 4P4LA 1UT5A 3LWDA 4RZ2A 1PHRA 5KU7A 3GPDG 1I13A 5ALVA 3GFOA 4B6EA 1TVMA 1DT3A 3FY4A 2YR0A 2PU5A 1CY1A 3QVTA 4HDRB 4NFYA 3KZXA 4AKSA 3PUHA 3A11A 1J07A 3UENA 4ND5A 4UHDA 4MQ6A 5JPIA 3AVUA 2PCLA 1FS5A 4JBHA 1B74A 1BE0A 1XC7A 2QQGA 3Q98A 4FFPA 3RTDA 3ZK9A 4KW7A 4AZVA 4BNWA 4JJGA 1DUSA 1Z7YA 2G71A 1CF2O 2GYUA 3GLHA 3LVQE 4HH0A 3IOMA 2IL1A 5H9VA 2O5CA 1M5UA 3H5WA 3ON5A 2VNAA 5CFPA 3H05A 5GGYA 3F1KA 2B5VA 1DKPA 3BQMB 1IUNA 3PLRA 2OUIA 1WPGA 2QGFA 4M0UA 4PLPA 3VJMA 3E4DA 1MF7A 1IAQA 3SJAA 4ZODA 2G63A 3D7KA 4DV7B 1M6HA 5E7MA 1T2EA 1XQWA 1A4UA 5IJXA 2YWCA 3MWFA 1I32A 4DA0A 4F21A 1RS0A 1Z74A 4X5OA 4B5KA 2V1XA 4M1EA 4QUAA 2Y9MB 2OSVA 1MB3A 1XTJA 3HBJA 1MX5A 5EE5B 5LM3A 2YJGA 5DASA 1IOWA 4CM4B 1E9RA 3KKKA 1I6KA 4NG4A 4MS4A 1CS0B 3QEKA 5EXEA 3A9WA 3SS8A 3E9DA 1XVLA 2UUBB 1JKJA 1MW9X 1VA5A 1XBTA 2HV8A 3RC9A 3UYKA 1M8PA 1NVBA 1Y3AA 1XZLA 3LWNA 3RJ9A 3ZUPA 2DBVO 1EUCB 3DZIA 4K2AA 1P2VA 2ZTMA 4Y8VA 5IKMA 1GSAA 1SBTA 4DMFA 3IBTA 1NHWA 2C1ZA 2GPAA 2IITA 3NAZA 5A3VA 1L8QA 1B0PA 2Q6TA 1FDRA 3BQNB 5BYBA 4P7BA 2ODQA 4LY9A 4P58A 2C5EA 1UJ2A 2YN0A 3D8RA 2NG1A 3EXHC 3MYYA 3HACA 1RFLA 4Y2PA 4CCAA 2P1ZA 5KVSA 1GDTA 1FFCA 3EXAA 1SHZA 1U8FO 2X1MA 4GYWA 2X3FA 5K0ZA 4EKNB 5DGCA 4MWZA 5DK4A 2JL1A 3IVRA 4OXRA 1OFIA 1UBLS 2D5IA 4G65A 4ZA2A 4IX1A 3TVDA 3VR3D 2WWWA 1Z25A 2VPWA 4U6QA 5ER6A 1Y1KE 2EBHX 2YV2A 2V7QA 1QWSA 3T3MB 5JHGB 4O08A 1B3RA 1P6UA 3OZCA 4JEUA 1ZBDA 2H0RA 1JVSA 5FPSA 2WUWE 3IERA 4WCFB 4M9RA 2JD1A 4AI6A 3CE9A 3UT0A 3ZQKA 3DE4X 2HA3A 3QVXA 4RJJA 5C5IA 1KWGA 4DCOA 4ML3A 2GEBA 3ESDA 2B3TA 4PYKA 1RAHA 2WB2A 3L7OA 5CYFA 5CXUA 5JYBA 1Y8CA 1TLTA 3KKQA 2G5GX 4ZOAA 5I4IA 4P0PB 5K51A 1HDZA 4N0MA 1W88B 1ZH2A 3WLOA 1BDIA 2FPPA 4L9SA 4ALLA 2OCLA 3EWAA 1QIJA 3D43A 2ZAYA 3H7IA 1LGYA 3HG7A 3IVXA 3JPWA 2CZGA 3R0ZA 4JD5A 1TUGA 4S1OA 5DB4A 5IN5A 4HFRA 4RGYA 3C6KA 3CW8X 2AF3C 3GWZA 1UXIA 2OCXA 4UC0A 5DNUA 3WIDA 3HUFA 1TKBA 4OQQA 2ONYA 4XARA 3TQFA 3OF3A 1BCSA 1KYWA 4RQTA 1OLXA 2EX0A 5A1JA 2LDXA 2UZ1A 3LY5A 3OBIA 4LZLA 4YP7A 3RC3A 4BP1A 3BH6A 3PDJA 3SOPA 1QR2A 3TZEA 1JUDA 2E9SA 1K3FA 2NTNA 3AERA 4NU0A 1T24A 4UD2A 4WBSA 5H0IA 2G0TA 2ZANA 1EWKA 4KE9A 3JVDA 5B1YA 2EZ8A 2WYWA 3P2KA 2A14A 4HRAA 5AOVA 4D3FA 1L7VC 3EDQA 5MDHA 1QZTA 1H85A 3FI9A 4M1OA 5BV7A 1FFBA 4RMIA 3AR7A 2XVMA 4MS1A 3RIHA 4S1PA 3RU3A 2A0YA 4AMGA 5LYJB 4RX1A 3U4MA 1P33A 1ZNQO 2XMZA 1T6YA 4PYJA 1E2PA 2FH5B 3QU9A 2HN9A 13PKA 3ZVLA 2ADFA 1TYEB 4H6VA 3QX7A 2AOTB 4EQZA 5LZ2A 5AQEA 2JCVA 1NVUQ 1K9SA 3BJIC 1JHUA 1G19A 3NMUF 4LI0A 1RTTA 2VHEA 4C2UA 2VP4A 4R9SA 1QKKA 5D7BA 4RKFA 4TTJA 1IXKA 2QDKA 3S44A 3WGNA 1NT2A 4LV5B 2QNRA 5DLYA 3QKSB 1BYIA 3BL8A 1AGPA 2ZSJA 4UPDA 5B12A 3C87A 5IVPA 3MG9A 1W5EA 1JHRA 4EG5A 3L0CA 1DVRA 3EIUA 3SJZA 1WLYA 3S0JA 4N41A 2ZE5A 3R9KA 3LBAA 2UZAA 1XRJA 3IP6A 3TAXA 2GM4A 1EXMA 3KVRA 3KKNA 2YW2A 1Y7TA 2VWHA 1K5GA 3L04A 2ODWA 3TQQA 2VHWA 2GN8A 3RVDA 3AQ4A 4BV2A 3DFFA 4NJEB 4QGGA 4EG8A 3OF2A 4IR7A 4ER0A 1E63A 1EVKA 1JFRA 2Y6VA 3FNEA 4ND6A 1G6OA 4YALA 3ZDXB 3HJHA 3UXHA 3N0RA 4YH1A 4BN0A 3D7SA 5ALEA 3ZWVA 3G1TA 1CZLA 1R4MA 4S1NA 3O38A 4Y2HA 3ABSB 4BRWA 1KAEA 3EQ9A 4H4CA 1M72A 4MRMB 3ND5A 4O2BF 4H6WA 1VBFA 1J5EB 1QOPB 4WINA 3R9IA 1ILEA 4EYGA 1IHYA 3TSYA 4B0PA 3TKYA 4IQ8A 4FXOA 5KUTA 4ZAYA 3KL2A 5LNK6 1Z28A 5HRCA 5A02A 4BFZA 2V7XA 1WX1A 2ZWIA 4F5EA 1KWKA 4F96A 3OTOB 4BO7A 1P1HA 3ER8A 2GASA 1RWOA 3QWAA 3WJ2A 5LQCA 1YCGA 2YZ7A 1U2QA 5C1OA 3LOQA 4HD8A 3HO6A 3WIOA 1JSCA 2Z04A 3LU1A 3GDOA 5LWQA 1BXKA 1FVOA 1OCEA 5KJ1A 4GRIA 1IATA 3WGGA 4EECA 4OGWA 5ICGA 3A05A 3CKYA 1E64A 1ZD4A 5L3SA 1II8B 4Q24A 5ALTA 1RM5A 3NDJA 1LF0A 2QT0A 3E7FA 4YIKA 3RAEC 1DOAA 4H4DA 4W4TA 3W8DA 1F8XA 2HGZA 1NJ8A 1CQPA 3HBMA 3EEQA 4F9GA 3FZNA 2IUFA 2Z83A 3IKMB 3FB1A 1YDMA 4YRAA 1QWOA 3WZLA 3UBTA 2B82A 2VDUE 3WDKA 2VG8A 4ZAFA 3R9XA 3J80A 2E5WA 4IHJF 5DHAA 3RDPA 2CUKA 2FK8A 2W4MA 1U7DA 4INPA 5H3HA 4BNIA 5DN6D 5HHTA 4BJ6A 1KY3A 1EXDA 4W7SA 3L43A 4RF2A 1KVTA 2C1EA 4PC2A 2WIGA 3ZU2A 4MNTA 2WQ6A 1EFDN 3ZXXA 2XTAA 4YCDA 1NUPA 4OX9B 2Q8NA 4KX5A 1JALA 2PWAA 2QX6A 2ZKLA 4IOMA 5JS2A 1JDJA 3H11A 3QA9A 3Q7RA 2P2DA 3HKCA 3PL5A 4MQ4A 3RVMA 4POOA 3V00A 4BNFA 4MKFA 4CV1A 2FEOA 2XMRA 3AESB 1LTQA 3W3ZB 3MGKA 3BRSA 4IMJB 4WCDA 4BATA 1F7VA 4CEHA 1AF7A 4OLFA 4PNPA 5DW0A 4PYRA 4BV9A 4EB8A 4ETIA 1U4OA 5B30A 4MR9A 2QRQA 4PSCA 3AUUA 2J9YB 4QOJA 3WOVA 1GEGA 3MWKA 3SBXA 4ENRA 3BRWA 1P29A 1G2PA 1UF9A 2C7VA 3PUZA 4GI5A 2D5LA 4JENA 4ON9A 5C3UA 1RHJA 5E8JA 3RANA 5HZMA 3MCTA 3FVTA 2QTMA 1DRJA 2FZCA 2ANBA 1DZ3A 4I9NA 4DABA 3G9QA 4JLWA 3MWGA 3ZY4A 2DKFA 1GAEO 3LXUX 4ISCA 2V3VA 1AA6A 2CFIA 2ZUVA 3LUFA 1U7ZA 1KEEB 4GPEA 4HMQA 2YOFA 3I62A 1O03A 1UKVY 2I7VA 3QVGA 3D4BA 3H8JA 3ILVA 3KUDA 3LCUA 4JZYA 2F00A 3WBJA 4IQ0A 4KXLA 2QTWB 4II3A 2ZIWB 4WLNA 1NFRA 2HXSA 5EKSA 5T5QA 4FWIB 1QLWA 4NK4A 3IMFA 4E7OA 1J33A 4ZOCA 1GTRA 2A3NA 5AM0A 1EFCA 1MENA 3Q5EA 1O0SA 3OSUA 1M67A 3N0TA 3LMKA 3LFUA 2M6KA 5REQA 1BCRA 2N46A 4URXR 1XZPA 1WLSA 3CWCA 1QRDA 3JD3A 1DAPA 3Q9UA 4URYR 2ZS8A 4AJ9A 1K75A 1L5HB 4O1MA 1ZD1A 2ZSKA 4OB7A 2E82A 3T7AA 4EG6A 4O29A 2C9ZA 3DQQA 4FNMA 1V71A 2QN9A 1SK8A 2BZ0A 1EXNA 2VHCA 2X1VA 5JW6A 2BH9A 1T5LA 4WECA 1ZMXA 5TT0A 1SAYA 5ICCA 1CR2A 4E11A 3N5KA 1B16A 1IN1A 1E1CB 2H18A 3OLQA 3HLTA 3A70A 3E0XA 2AOUB 2I6GA 5BSUA 5SZKB 6REQA 3GRPA 3ZDAA 1X7XB 3D2CA 3IDQA 1NMZA 1E6CA 3FPGA 4MROA 2VAXA 2AW5A 3SLRA 5AK5A 3ZJVA 1XK6A 1ZRHA 4W6ZA 5F3RA 2WJPA 3WOHA 3UANA 4ETMA 1G6Q1 4BWFB 3RARA 2HADA 1EUZA 1DIBA 3O1IC 1CC1S 2VWGA 1L4LA 3P9KA 4HB0A 5ESWA 4CMJA 1X7YB 3W2HA 3AEKB 1NJFA 2O52A 3RVNA 1TZBA 3HLYA 2HF7A 1Q1EA 1E6MA 2BFFB 1S3GA 3PPYA 3JQEA 1RWWA 4FKMA 3O3OB 1U0OC 4H3SA 3VR4D 1V9LA 2K7FA 4EGSA 4QHSA 5JROA 2YWHA 3H9JA 4S1TA 1KY4A 2BGWA 4L4RA 1IY0A 4CQMA 3JRXA 2A35A 2WWVD 3WLMA 4BNHA 2VZLA 4LF6B 5HILA 2PIDA 2X40A 3T9AA 5HF6A 1SD5A 2RARA 2HHHB 4ZQIA 2I4LA 1D0SA 3C16C 1MFPA 1TD1A 2FUEA 3L8FA 2XTNA 3GQVA 4FC7A 1W8DA 3GLIA 2GZAA 3IUNA 1P1CA 1P39A 1XLTC 4QC2A 4DTIA 4EY8A 2G9UA 3IDZA 4YLYA 5CBKA 1K66A 1V0JA 3EAFA 3GFSA 3Q72A 3VX3A 3KTOA 1QK5A 4D4HA 1RP7A 4DXHA 1P6XA 1EI9A 5J1TB 2X0DA 2Q5OA 3C85A 1L5QA 4Y6LA 3DZGA 3NGMA 2PQMA 4DA4A 4OK6A 5BSVA 2VTBB 2J5BA 4F5ZA 3BMOA 3A6LA 3LKVA 1QCCA 1O5TA 2W2NA 4I6JA 4EG1A 1I30A 1NVXQ 3PKJA 4QGHA 4N7BA 2CB0A 3WTBA 3GLSA 1TT7A 1OIVA 4ZJPA 4KP7A 2B1QA 2FZ4A 2IE8A 3H0CA 3ASUA 3QXCA 3QYJA 4Z9BA 3S2FA 1CT9A 1DAEA 2EIHA 2GZMA 3KYCA 3O94A 5F9MA 5K3FA 4ZK2A 1H3NA 5EIBC 4GLOA 1HYQA 2VJOA 2Q3LA 5I7EA 4S1WA 4OHKA 2R47A 1IWPB 4XE5A 2C4TA 2D1TA 3PRYA 4O1HA 2R6HA 5ETJA 4C0SA 1SHLA 3D6VA 2MSDB 3L5KA 4CQLA 3AR5A 1R9JA 3VVBA 1QPZA 1M2JA 5DSTA 5ICEA 2W4IA 1CUYA 3QPBA 2PL9A 4Q9IA 3I52A 4XLLA 1YJ5A 3CY6A 4D96A 1DGQA 2GR9A 2FK7A 3HR7A 4M0LA 2PXAA 2IY8A 3GXBA 4CEJB 1VRVA 3EWNA 1NQTA 3L6RA 2OO5A 2EFGA 3NHSA 3VOBA 1GGMA 1RJFA 1UK9A 4W5HA 3WYNA 1BNCA 5TRTA 1UQRA 3GN1A 1V11B 2W0MA 1V8DA 2FVYA 3D3JA 4KQ2A 2FW0A 2E1RA 3H6HA 2XKJE 2W2XA 3FFXA 1HBJA 3DYVA 1M2WA 4U3JB 4CN8A 4W5RA 2LR0A 2RKOA 3PI6A 2DBQA 2QXYA 2WU8A 3AY0A 3CRQA 2D8AA 3N8HA 2O6HA 2PX3A 3E7PA 4UZSA 3PNLA 1Z47A 4UUOA 1I51A 1RXUA 3CRNA 4QJ5A 1J8VA 4CKZA 4LSGA 3PIIA 4CFSA 4S0XA 5F77A 1M0EA 2QUIA 4EGAA 1NPYA 1TVKB 3VR4H 1YS7A 2DUNA 3SMVA 2K87A 3S1AB 1TW3A 5DYGA 5KOHB 2AQIA 3UV7A 4Y9DA 2X4LA 5LQMA 4JLMA 2XBMA 4R4JA 4WACA 5BN3B 1BHO1 3F74A 3L84A 3KETA 4ZVRA 3TF5A 4G07A 1Z18A 4WASA 3VR5A 1XD8A 1Z5NA 3TBFA 4D6YA 1GPMA 4U7PB 3D7LA 2PH1A 3ZCQA 2QD2A 4GVPA 2HBZA 1QE5A 4OHCA 1EVJA 5AVTA 4BASA 4YR7A 3QE9Y 2Q0XA 4PFJA 1CUJA 2GK7A 3DO5A 4RLHA 2I1WA 3COVA 2IUYA 1NLYA 3RSZA 2DPYA 2OAQ1 4MUHA 4QSHA 3OZDA 3ECAA 4E1VA 4CM3A 1LV8A 5E38A 5L9AA 5HA5A 3CX6A 4YRLA 3ASVA 1SUFA 4ZCQA 2CHGA 2H4FA 1IZ7A 4WUTA 1CTQA 1QG6A 3M70A 3D4PA 1JIIA 5C8XA 1YZVA 3LZ6A 2CNKA 3QVUA 1JEYB 4L7VA 3GPLA 2FPUA 2NTYC 4HWOA 3CLUD 2X9NA 4A6DA 3PFWO 2GILA 3NTLA 3N9IA 4AYWA 2I9KA 3T35A 1TCUA 1QJ4A 4IUYA 3CVXA 5ED4A 2XYQA 2Y1DA 5FRDA 4BZWA 1NLUA 2NWQA 2XKKA 3OLWA 2HF8A 1OX6A 1XU9A 4WXMA 1YK0A 3P9PA 3WRXA 1D0IA 3UYLA 5K0EA 2O8EA 1JJFA 1HEYA 2R85A 4CF5A 2O4UX 2P11A 4RZIA 3NOXA 3LT2A 1MO5A 3ZVKA 3ZHTA 1EVYA 4XLZA 3W9SA 3ZWMA 2W98A 4YDQA 1N2OA 3CWQA 3CINA 5LYJF 1N92A 2CUNA 4JZKA 4I1YA 5DI9A 3OUTA 4DJAA 2VEDA 4EO9A 5EPEA 1ORVA 4HAYA 3WK7A 1XJCA 4RQBA 3TRIA 4HQLA 1JB1A 2JIQA 2BHSA 3NHYA 4DANA 3CZ5A 4OQ4A 2O20A 3DDNA 4KXNA 4RVOA 4BLPA 3WP0A 2O14A 4KRXA 4X54A 3QQ5A 4F4JA 5JXWA 2IP4A 3LGXA 3UKDA 3SDZA 4BIIA 4IDAA 2XITA 1DIGA 1E2UA 2HT6A 2GXUA 1ZUHA 2XCQA 2ZI6A 1LPSA 3I4CA 3PP8A 4RMJA 4CT5A 4DMCA 1T5SA 4G84A 1N2ZA 3OQOA 3NM5A 2I29A 1ODJA 3BJEA 2WUVA 3ED1A 3HU2A 3TM4A 3LECA 4IS2A 3PQ7A 3OETA 5WRFA 4AG5A 4AY2A 1K6XA 2RHOA 4IKPA 4M0PA 4YDRA 4CDGA 4X3PA 2CEKA 1EP2B 5E0OA 1Z13A 1QHYA 4DBLC 5K0TA 3AJEA 3AG5A 3NEPX 4QTUB 3L0SA 2BGLA 2MHCA 4TV8B 1EM6A 1LK0A 3AY6A 4U9HS 5HFJA 4KYTA 4B47A 2V5VA 4BN5A 3BMNB 3HGQA 4YRSA 1YDWA 2ECQA 1DRWA 1L7PA 1XZQA 5EMNA 4DRXB 5D5HA 1LLQA 4ITVA 2HO4A 2TMGA 1U3WA 2XZDA 2ZB3A 3C7DB 4LNUA 5JNVA 4EKEA 4DXDA 2VHQA 4MJ7A 4YT5A 5HKOA 4H0CA 5D6NA 2OPHA 3QEAZ 1PTJA 1EFPA 3WB9A 3VZRA 1ZMTA 2FSVC 2HBQA 2FW7A 2PSSA 5LD2B 2MYUA 4KGZA 4KXQA 2NTVA 2PA0A 4JYAB 5AI8A 2XUQA 2GZSA 3IEUA 1J8YF 2VJMA 2QVXX 4UVDA 1L2TA 3DWGA 2WLSA 3FUUA 4OH1A 1DJQA 1EB9A 1Z6GA 2A1IA 3QJ5A 4UAUA 3FH0A 2PXXA 2ZDHA 3QU2A 4BJHB 5F7ZA 4DCNA 1NNSA 5TV2A 3OIFA 1V3TA 5A62A 4BNTA 3C3XA 1W5AA 4HRXA 1MV5A 2JFHA 4N6GA 3U19A 2OZLB 4WKOA 4WZAE 4X7MA 3OA2A 1AKNA 3WDSA 1CFZA 4YEDA 1PF7E 4DZRA 2QOEA 2Q2QA 2BFEA 3NCTA 3GEGA 1E0SA 3AV0B 2PNJA 4A16A 5F1OA 4KUHA 3S99A 2GO7A 2JGJA 3FCOA 4UUAA 1E59A 4IVPA 2IX9A 4JOBA 2ONZA 4XD7D 1E2JA 2CZCA 3QY0A 4ZT4A 1BWSA 3ZN2A 4LBWA 4D43A 4YP0A 2BHNA 1M1ZA 4P3KA 3ZWKA 1P91A 2HO5A 3CMMA 2O3QA 5AKEA 3VSCA 4BMOB 1GPUA 3B53X 4XCXA 4DR6B 1KMMA 2A9PA 2P67A 2XRYA 3QI7A 4Q0MA 4XUGB 3OZ7A 5U4XA 1N7HA 1UDRA 1ZIOA 4BHTA 4CDMA 5GJBA 3IEIA 1VSQA 2OMKA 4BZXA 1ISHA 2H2HA 2OC9A 2O2DA 4QLOA 1A8QA 2NV2B 4BU0A 2VDWA 1K9VF 4FQ8A 5A2QA 2G5PA 2IHYA 1VG1A 1IB6A 4ANFA 4RVDA 3GDFA 3QBEA 4ZARA 1L5YA 2O1XA 4HNAA 3K70C 1BRTA 4EF4A 1I4TD 3E82A 3B1YA 1YZ3A 1R8JA 2EJUA 1MAWA 5IAEA 3TR5A 2I1VB 1ZHFA 3DD5A 1ZN9A 4U2BA 3WKBA 4G24A 5DYWA 4QU0A 3P9NA 3EX7C 2OXCA 4QDTA 5MFZA 2FG6C 1U0LA 1CYDA 1CHDA 1A9ZA 1H9AA 1ODSA 2PBZA 4BFTA 1MORA 4I4IA 2GCOA 3KSAC 3CZRA 3A4NA 3GFPA 2OC4A 2A67A 1L4GA 1XDSA 4GGOA 4N5NA 3Q0EA 1BXGB 4TV9B 4YV7A 2BM9A 5A4JA 2WWYA 1YVRA 4IJ5A 3HSYA 1QIEA 5JCXA 1HNXB 2OCBA 3BHNA 3UB3A 4XX1A 2B5OA 2X2OA 4DRZA 3CCFA 3JATB 3ZEIA 4CMHA 3P2OA 1UKCA 3ADKA 4AD8A 3C3WA 1V8OA 2G77B 5F1PA 4B7ZA 5HOQA 4F4HA 1D2MA 3IAUA 2GCEA 5I9BA 1CUEA 3GEIA 4ARUA 2LNDA 4B6JA 2JIPA 1RZ3A 2ZJ7A 3NTXA 3MCWA 4GBMA 4WNIA 1PZNA 4IRMA 2ORIA 1TB4A 2O50A 4TYPA 5L3VA 2RAPA 3DONA 5K3OA 3Q5GA 1EXWA 1FFDA 2J0UB 4KC0A 2CDAA 1XTPA 1FDIA 4R2XA 4QU9A 3OJEA 1AXRA 2Q8PA 4D1YA 1AN0A 3W9UA 1X8JA 2PYIA 3C6YA 3AWDA 5CA1A 3H5LA 2VJDA 1W8IA 1UBOS 4GYYA 1WXIA 3RVRA 3W8EA 5HYVA 4CVNA 3GCWA 1W85A 3UJCA 3DMFA 3HXMA 3W2TA 4X65B 4DWJA 4FXPA 1RI5A 2EZ9A 4OK5A 5KYTA 1RPTA 3VR6D 3U9LA 3WL4A 3UFBA 4LYYA 4E94A 1Z7WA 4CT0A 4QNNA 4B33A 4H7FA 3BFJA 1UJ6A 1ZJJA 1BHSA 1JEOA 3SHOA 2Z8XA 5JUWA 3M9XA 3ENNA 3NKVA 4PFKA 3RD5A 3J7AC 4KRFA 3LP8A 2X8LA 4O4HA 4MV9A 1ISRA 2COEA 3P9IA 1JEDA 5CXXA 3KOMA 1ULTA 3HBFA 4M36A 3PTZA 3LW8A 4IDNA 2CHVA 4PZUA 1U9JA 4B35A 4P0QB 3C5HA 5JCOA 1LCIA 1G60A 3HKEB 4WERA 1RDFA 4L73A 4MUKA 3T3HA 4JU8A 2ZW9A 3JVUA 4TWIA 3OFNA 3KB8A 3OZVA 4DCCA 4P35A 2YMPA 3CN9A 4DUGD 4M53A 2B4QA 3COZA 3SXUA 4OQZA 1J5PA 1LQUA 2R6ZA 2I22A 2B0CA 1LY1A 3BZUA 3MQFA 4YJDA 1FCJA 3NUQA 4AJKA 3H9GA 1H2ZA 2M1ZA 4G5OA 2J6CA 1ZINA 3CLKA 4DQVA 2P75A 1T1RA 2BEWA 4GYJA 2QRHA 4QM7A 2HMTA 2QLMA 4XM2A 3UAGA 2I7TA 5EHZA 2C4VA 3KZ1E 2AX3A 3N76A 1NRWA 3QELA 3I5UA 1WXWA 4XA8A 4TVOA 3GK3A 4OSEA 3ZK8A 1JYSA 3OCXA 4S2EA 4GHWA 2BMVA 2GNAA 4J43A 4OMUA 2ATXA 2NO1A 4XPIA 5L6MB 4HXFB 3G5LA 3WWDA 3ZWQA 4BB0A 4J16A 2G1AA 3ANSA 2QT1A 1LPPA 3AJDA 3V6MA 3EEFA 5E6SA 4EW6A 3PXAA 3WGHA 2Z8YA 4IDCA 3UT5B 1ZICA 1FUKA 3Q87B 5IJ9A 3ITNA 2QHXA 2DC1A 4F3TA 3CPHA 2B4YA 3MT7A 3WG9A 5LDHA 4XJXA 3ZGLA 1Q7TA 3T3GA 3R24A 1OR8A 4C0JA 5C32A 1SUDA 4E3WA 3DOUA 2FMHA 2CJWA 2F90A 3KKOA 4OOEA 4BKUA 4RPIA 3RG8A 3E1SA 3HDGA 5FV4A 4HPJB 4AZ0B 2IH2A 3BBLA 5ECGC 1Z4IA 1Z9BA 3KT6A 2OA0A 1PSDA 4P6VF 3T4UA 4O8CA 3O2SB 1X1QA 2R44A 3I6YA 5BW6B 2D2FA 3DVAA 3HJUA 1MCZA 3E1GA 1E3DA 1H3FA 1P80A 1XQ6A 2IY7A 5B1EA 1GCIA 2I3AA 2Q7XA 2COKA 2XRZA 2X86A 4G63A 4IHKA 4EB6B 4LCEA 4D9GA 1TU4A 1U2DA 4V1CB 3SHFA 1D09A 1E0DA 2P78A 4YJ3B 4C22A 1J4AA 2X5JO 3CR8A 4YNBA 1U0TA 2N0SA 3VR6H 4PIPA 5DXFA 4DDHA 3BFPA 4LVOA 2FWJA 3BIXA 3GFRA 3FTNA 1C3VA 3H7AA 3U61B 5TMEA 2RHMA 4JBGA 4UTPA 2EFEB 2NACA 2WE7A 1JG3A 1KOJA 1P2BA 3JASB 1KHTA 1XZ8A 2OY0A 3KHTA 4OQPA 2FPSA 4BBZA 3BMCA 4ZAGA 2I62A 3IEXA 3R3XA 3LL4A 3AHCA 1BZYA 5GONB 1NKTA 1TK3A 3WWPA 1V4VA 4IIUA 2YIDA 4CU2A 3GAMA 1G2OA 3L6DA 3T0FA 2BN4A 1E79A 2QIOA 2XBLA 4O8ZA 4NNJA 3UJ6A 1QG0A 5CNJA 1ZC3A 2CY0A 4BLSA 3PCTA 1I7LA 1AM4D 1YS1X 2B69A 5C34B 3JZFA 1ZJYA 1KDRA 1ZD5A 2P9FA 3I2JA 1ACLA 2ID9A 1RYYA 1EFLA 5FUWA 1NP3A 1SKYB 2BMDA 5L4SA 5COBA 1PT5A 1SFRA 5JANA 1EFKA 1EEHA 3HHEA 3PZBA 4Q4CA 2WRZA 3O3MB 1DMSA 4MA0A 2WG1A 4PYLA 2H4JA 5JD6A 1E3IA 1IXRC 3T7JA 2P9ZA 4QX6A 1FVHA 3JARB 1RABA 2DPXA 3QGMA 3QYAA 3DLPX 5LZ8A 2W6IA 4QZVA 1UFRA 4RAQA 4ZWNA 1NBIA 1TAGA 4DM4A 4GPIB 1QV6A 4QT0A 1J0AA 5K3EA 2PUVA 3D7NA 3OF5A 3CLVA 4FSHA 4I9GA 3VNVA 2ZFUA 1AUXA 1GR1A 3WKCA 5A5EA 3IJEB 4N7JA 5GJVC 2VHZA 5EE0A 3ZY2A 2WYVA 4JI5B 3BJRA 5KQSA 4FDAA 1A04A 4BE7B 2Q4BA 2Z2IA 4RF3A 1SVMA 5KYWA 1QV7A 1BX1A 1HE1C 2FQYA 3ONNA 4KQFA 4WA8A 5DMXA 1G59A 1C0PA 4NJOA 1X86B 1MR3F 3TLYA 4IIJA 2V4UA 3JD1A 2MINB 2AEEA 3RRFA 2P3OA 3HWX1 3EDOA 5HBRA 3ZWWA 4R71A 3CPEA 4RY0A 1FW8A 1HYHA 1H66A 1N1MA 2JAPA 5KC9A 4KE7A 5A7FA 5P21A 4BO4A 2D4HA 1XRMA 3T4EA 4YUXA 3PTAA 4RS3A 5CEJA 3FN4A 5DV9A 5TMPA 1P3JA 5AK0A 1XKQA 1XL0A 2AI3A 2IUTA 4CV2A 1J0XO 4HTFB 4Q6WA 2HLDA 4KR9A 5AR1A 2LRHA 3ETNA 3KLNA 4NCHA 2CWWA 2IHJA 5DOVA 1FS4A 5MGBA 3OZEA 1Y8RA 3G0BA 4IHQA 4JC0A 4G67A 3ZLBA 2O8VA 4RGBA 1ZL0A 2Z43A 3ORQA 2I0FA 1E1RA 3AEQB 3NETA 2OD9A 1PR4A 3G0IA 2QTZA 3KPYA 3W04A 1KP3A 4IYJA 3VKVA 4NBKA 3GCXA 3VDQA 3PC3A 1QYDA 3FAKA 1W2HA 1ECBA 4IHAA 4PV7A 5A0TA 1SCUA 2BFBA 3MRXA 2FWAA 4WH0A 3NGXA 5AVJA 3MLEA 5JSZA 4IV5A 1AV6A 4NESA 3OTIA 3DEFA 1GVNB 1W35A 1QYCA 2ZXUA 3ZU3A 1ZYUA 4R1PA 5AOCA 4PFQA 4KR6A 1K1EA 2RHTA 2OV3A 4W8OA 1GUYA 3TZQA 3WL5A 3PR2B 1GPYA 1PQYA 1YR2A 2XBUA 1ZVJA 2WU4A 1UC9A 4QPJC 3UJ3X 1QO0D 3MMXA 1JILA 4YRQA 4RHXA 1Z5PA 5KOYA 5HJEA 4HK4A 2FPGA 4BAGA 1M1NA 3T9BA 5HTKA 5A7GA 3OX3A 2ZK7A 3E35A 4NMHA 1Y5RA 3KWMA 2GD6A 1UMBA 2LKCA 2VDJA 1GKLA 1RPJA 4PS0A 1FY2A 1WRBA 4TQ9A 4QECA 2GZDA 2BFDB 4TV8F 1X14A 3PTLA 5MN5A 4ZO4A 1OI3A 1PEAA 2L19A 3U7RA 2G07A 4XFJA 1SPXA 1U80A 2R5FA 3A1SA 3ZIAD 5TS3A 4E5MA 1SU8A 1GRRA 4JASB 2QI9F 2O1EA 3CWZA 4MPPA 4ZXPA 3PEYA 2HCBA 1VE1A 2R1VA 3E61A 3T5PA 2FFHA 2R6AA 3GA0A 5F2KA 5BWBA 2WTUA 1XVAA 3WXBA 2VHYA 2X23A 4U2GA 3SDBA 2HA6A 2CLCX 2H85A 1GG5A 2QZJA 4R3NA 1ODFA 1SXGA 1NRJB 2XUFA 1KYQA 1NIPA 1UDBA 3R7BA 5HTOA 2VXOA 1WEHA 3D5EA 1NXWA 4C4XA 3IXLA 1H6DA 4PEVA 4TUYA 4ZCLA 4DUYB 1I3NA 1JEQB 4AJNA 2RGBA 1VG0B 2HIHA 1NBOA 1J9EA 4WXHA 4AW9A 2BF4A 3BD7A 1SUIA 1PWEA 2PUFA 3UW3A 5JU6A 1M1YE 4P22A 4RZXA 4IS3A 1FFXA 3RLFA 3M3HA 3FF1A 1N9KA 2WTAA 2I34A 5KTTA 2I80A 3JZIA 4J29A 3I09A 4KMSA 4N18A 3CQ9A 4FLEA 1K88A 4L4ZA 4EVIA 1X70A 4RQAA 4DA6A 4GX0A 1IZYA 1RLIA 3BULA 1MBZA 3AP1A 4Y2XA 4Z9FA 3TQTA 4CEIB 1OBVA 3DBHB 1TUBA 2RAVA 1XN4A 2VHVA 3ETGA 3K6RA 4WJKB 3IEMA 4MIOA 5JIBA 1KEKA 3CUTA 3OZWA 5MF6A 1R9GA 1E9VA 1NE2A 3W1EA 5CBPA 4B48A 3VDXA 4K1LA 2P4HX 4Q4AB 4ZEVA 1DAIA 2C5AA 1KFCB 2XX3A 3B6KA 2X2EA 4RDIA 2D74A 3H3FA 2ZBGA 3C0KA 1XXHB 1D9XA 4K6FA 1OX4A 3KTFA 5LN1A 5CDUA 3PT5A 3UB2A 4A2CA 5ISMA 3PEVA 2FN7A 4ILKA 1RXYA 4YQFA 3C3KA 4Y6RA 3LKBA 5BOSA 2R25B 2Q9CA 4GI7A 3FNGA 1Y7IA 2PUHA 5KBYA 4WLVA 2QMEA 1CQXA 4CG3A 4YP9A 1Y5IA 5IKOA