4CFYA

Savinase crystal structures for combined single crystal diffraction and powder diffraction analysis
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SUBTILISIN SAVINASE
publication title Analysis of an Industrial Production Suspension of Bacillus Lentus Subtilisin Crystals by Powder Diffraction: A Powerful Quality-Control Tool.
pubmed doi rcsb
source organism Bacillus lentus
total genus 101
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4cfyA00
1C3LA 1SBIA 3LXUX 5JXIA 3I2YX 3TECE 1S2NA 4NE7A 5CW1A 1TM5E 2PWAA 1KDZA 1SIOA 2XTJA 2P4EA 1Y1KE 1Y9ZA 1BFUA 1R0RE 3F7MA 3VSBA 1PFGA 1TM4E 5SICE 4CFZA 3DVRX 1HT3A 1ZVJA 3Q40A 1EGQA 1SCAA 1C9JA 2IY9A 2X8JB 3TI9A 3ZXYA 3GCXA 1A2QA 1NDUA 3F49S 1AH2A 3PTLA 2Z2ZA 4CFYA 5ARCA 2QTWB 5I9SA 2PKCA 4HX2A 1KE2A 2PMWB 1AQNA 1TK2A 3LPDA 3EIFA 2B6NA 2HPZA 1AV7A 3GT3A 1KDVA 3L1KA 1GA6A 2ZWOA 3OSZA 1SUAA 3BGOS 4BWGA 1SCDA 2DQKA 3GT4A 3LPCA 2PQ2A 5K7SA 3ZXXA 1BJRE 1P7WA 3A3OA 1JEAA 3I37X 3DYBA 3AJ9A 1GTG1 5AVKA 1SN7A 4Z2AA 4AKSA 1P8JA 1THMA 1Y4DE 1NDQA 1TM1E 1CNMA 1Y34E 4H6XA 1VSBA 2Z57A 1Q5PA 1BH6A 1IAVA 2SICE 1WMFA 3DE4X 1ST3A 3DW3X 1V5IA 2G4VA 5ARBA 2DP4E 1T1GA 2Z56A 4OMCA 2W2NA 3EDYA 5B1DA 3DVSX 5AMXA 4ZOQI 1KE1A 3BPSA 1V6CA 1Y3FE 2IXTA 3DE2X 5FBZA 1SUEA 1SELA 4NE9A 1Y4AE 4GI3A 3DE7X 2TECE 1BE8A 3Q5GA 1AVTA 2ST1A 5AQEA 1GT91 1SIUA 5FAXA 3VTAA 1TMGE 1TO1E 1PJ8A 3HJRA 4H6WA 2ID8A 4C3VA 1SUDA 4I0WB 3PRKE 1SUCA 3SICE 5B1EA 3DVQX 1S01A 4DWWA 2Z58A 4WOCA 1OYVA 1SCNE 3WIVA 1S02A 3EE6A 3A3PA 4B5LA 1SBTA 3I34X 2GKOA 1IC6A 1MEEA 2PRKA 4LVNA 3WIUA 3QMPA 3DE1X 2WWTA 1WSDA 4FONA 3TI7A 1EA7A 4AKTA 1YJAA 2SECE 3DWEX 3AJ8A 1TM3E 1WVMA 4K8RB 2V8BA 2WV7A 3AFGA 1GTL1 1YJCA 2W2OA 5JMOA 4JP8A 3CO0S 3DE3X 3D9QX 3VYVA 1AK9A 3DW1X 1SUPA 3DE6X 4KB5A 4DZTA 4HVLA 4J94A 4KG7A 1SUBA 1GA4A 1SCBA 2PWBA 1DBIA 1GNSA 1Y33E 3QFHA 3P5BA 3DE0X 2WUVA 4M1ZA 4YN3A 5JXJA 1BFKA 1GNVA 1OT5A 3DDZX 1DUIA 1OYOA 2HD4A 2Z30A 1ST2A 1Y3CE 1T1EA 1MPTA 3H42B 2DUJA 1SBNE 2XRMA 3I30X 4MZDA 3WHIA 4OMDA 2SBTA 1SBHA 1GCIA 1CSEE 2ZRQA 4NMXB 1BE6A 4LVOA 1P7VA 2Z2YA 1SCJA 4RYDA 3VV2A 1SBCA 1TECE 1PTKA 3DE5X 1WMEA 1YU6A 1SVNA 1Y3DE 3VHQA 2W2PA 5ARDA 2X8JA 2ID4A 2Z2XA 5JXHA 1R64A 1TM7E 2SNIE 3SQOA 5FFNA 4WOBA 1LW6E 4ZARA 3VV3A 3BX1A 1WMDA 1C9MA 1C9NA 1PEKE 3F7OA 5JXGA 3QTLA 1GA1A 1KDYA 1Y3BE 3UNXA 2W2MA 1SIBE 2ZWPA 1T1IA 4DJ5X 3T41A 1AU9A 1TO2E 3A3NA 1ZVKA 1Y48E 2W2QA 1SH7A 1XF1A 4CG0A 4H6VA 1GTJ1 3D43A 1UBNA 1R6VA 1YJBA 1NLUA 3LPAA 4OV6B 3CNQS 1AF4A 2WUWE 4KPGA 2PYZA 5AVJA 3WQBA 2E1PA 3GCWA 1SPBS 4C3UA
chains in the Genus database with same CATH superfamily
4YP0A 5F7JA 4D3ZA 3K2QA 4GD3Q 1MT0A 1T8WA 2Z1DA 1KI3A 4LZNA 4P9NA 2R1VA 3PWKA 3RKRA 1KWKA 3EZ7A 2BCJQ 2IUEA 4HCJA 4I50F 1DOAA 4BO7A 2DG2A 5LPNA 3OHPA 3OE5A 2Y1OA 1U0SY 1KDZA 3A37A 2NV2B 5CNKA 2RGCA 3QI7A 3NBYC 3SOZA 4X3CA 1QB8A 1LI4A 2HA4A 4S0XA 1Z18A 3OIWA 4JP5A 1M1YE 2AN3A 5MN6A 2MHCA 4QULA 5HKKA 7ADHA 4IOJA 4LX8A 4WZBE 4FINA 1DCTA 4IIGA 2GILA 1UFKA 1YS1X 4C5BA 4CKWA 3HK2A 3SSAA 3GVIA 1CEYA 4MDFA 3LOUA 2FQYA 2EWWA 4WMLA 2GPSA 5LQKA 3AHFA 2B2NA 1FNBA 5E7QA 2C3PA 2OBYA 4INZA 1IVNA 5COBA 1VSQA 1Q7CA 1FYDA 2WWVD 1GV1A 3OQIB 4Q48A 5KS2A 4M86A 2PXXA 2CVZA 4EMUA 1K06A 3DT8A 4CEIB 4E12A 3RJMA 4OYRA 2H57A 1ZVJA 5TEWA 2ZB7A 3QV1A 1SXPA 1QHXA 1MG5A 3Q40A 4IM7A 5AUNB 1ACJA 4HDSB 3AVPA 8AT1A 8MHTA 3I61A 1C9JA 5AW0A 3EJ6A 1MTOA 1FEZA 4OBWA 5DBHX 4AJJA 2X8JB 2K5UA 5ADUS 1OXTA 2OBXA 2P8SA 2GR9A 4K6HA 1QOQB 3G7NA 3Q6NA 4GMKA 3W79A 1R9NA 3ROTA 3AOGA 1Z5OA 1D03A 2NNLD 4TV9A 4Z99A 2ZSUA 4MQ5A 5LM3A 3QEAZ 3ECAA 1MO6A 3AF3A 1FU8A 3GDWA 3IVRA 4EUHA 5F78A 3QHPA 3IEPA 2PKCA 4PRKA 1D2AA 2AXEA 3H9UA 5EMMA 5I7SA 3IP9A 3B20A 1V8PA 2POCA 4JJIA 1L7QA 4YUAA 1Q0SA 2CV1A 1XEFA 2YXBA 2ACKA 3EJWA 3EIFA 3CX6A 4IF6A 4JSYA 3X1ZA 4DJJA 1YFZA 4M60A 2B4YA 3WV4A 1VB5A 1J8DA 1CS0B 3U3ZA 4R8LA 3KQSA 4AWXA 3AVQA 4WFIA 1I2BA 2O6HA 3LSTA 4M7PA 3CZRA 2YMPA 4D4MA 3OEYA 1VA4A 2RI0A 1DKMA 3H0EA 3QUBA 1EX9A 4J1NA 4UEQA 1DIOB 2QP9X 1PGNA 1YONA 1AZSC 4X93A 4RMGA 4D4IA 1P18A 3HACA 2JFFA 1DMSA 2PLAA 3A0RB 1I7QB 3T35A 4DGSA 1L4GA 3LO5A 4E14A 2G0AA 3RIMA 4A36A 3GT4A 4REQA 1KXZA 3VHLB 1XZNA 4FOLA 5F1OA 2HCTA 3KR2A 3SDBA 1SOMA 3MGKA 3T5AA 1BXZA 1YCGA 3QBVA 4CM6A 1DXOA 1QGUA 1BJRE 1XZEA 3A3OA 2YZGA 2O3UA 2X4GA 2OC4A 3VH1A 1TZCA 1J4AA 1R88A 4HZUA 4CTKA 2XNHA 5C4IA 4HDQB 2OPHA 5FX2A 1TAHA 1Q21A 4Y2QA 4WN9A 3OX2A 2PLWA 1TUEA 1RKUA 1RS0A 3RU9A 2ZZMA 4LOKA 1PVDA 1DL5A 2F43B 1GZUA 5E0OA 4EKGA 3TGLA 4FFMA 1P1RA 4JJ6A 1YUMA 1GG8A 4JC5A 4NQRA 4BMOB 3WGIA 3R7AA 2V6IA 3AVUA 4Z2AA 3FXAA 1ONBA 5DFAA 4CMGA 5KNDH 1M8KA 2MDTA 4KHPB 2GN2A 2OTCA 2YRXA 4MVJA 4LWZA 2GXSA 1WO8A 3BZUA 3KPUA 4R2WA 1ELOA 3FVTA 4RSMA 4TVBA 4FS8A 4G23A 5BN3B 5HGXA 2Q4DA 3HRKA 2J46A 2IS2A 2PIAA 1FFYA 4DWVA 4DBLC 2X3YA 2YHUA 4NL4H 4C04A 4HDOB 5EG5A 4DYDA 1NN0A 4JQCA 1EE2A 2C1EA 1U2GA 2QTAA 5SZKB 3TE7A 4D57A 3UN1A 5KNDD 1M74A 3IALA 4UHHA 1EUCB 5EUMA 3F4BA 1FXWF 3B6JA 1B76A 1FB5A 2QPOA 4KFRA 1BA2A 2HT6A 5CB8A 3PR1A 3LX6A 5FPTA 3T95A 3VDXA 2J3QA 3GT7A 1JMVA 1U2PA 2EKLA 4ENUA 1ZH2A 2AK2A 2VRCD 4DA7A 3VPSA 1P4HA 3LLCA 5A1TA 1TAQA 1UXGA 2R1ZA 4U02A 3GLQA 5J59A 3UKDA 2RH4A 4DIOA 1W29A 1RM3A 3TQTA 3RC3A 4M0FA 4A0GA 5JFTA 2DTEA 4TTTS 1O97C 3CTPA 3GG2A 4FYJA 4B44A 4EPYA 4BLUA 2QZPA 3VZQA 5IWCA 3BRCA 4B40A 2MSNA 2CZCA 3TNJA 4IX1A 3O73A 2IOHA 4DV5B 2W8BA 2NT3A 3KK0A 1FSZA 1OA1A 1NQUA 1AMUA 4HAVA 4GO1A 1NJ2A 1GRCA 2CXXA 4U7FA 1XN4A 3DE2X 1GFSA 2WKQA 4F86A 3HE3A 3RHZA 1J21A 1X7DA 4CIWA 2AN5A 4TVSA 5L4LA 3G1WA 2HZ7A 1P1BA 4FDVA 1O89A 3T5GA 1E2NA 2D8MA 5LZ5A 5K0CA 3X1YA 1FFXA 1RLOA 4EB6B 4GR9A 3D2LA 1NWCA 1Q92A 2PUVA 3HR8A 1P44A 3EF1A 3O83A 1K8XB 1TRKA 2IUUA 1OUMA 1TXGA 1WUHS 2ECQA 5A7HA 3IQWA 3RNLA 2OCDA 4EJSA 4XLTA 2G80A 2OAEA 4CLDA 4D0GA 3RRZA 2WKSA 4DIKA 1HFKA 4NPAA 1V37A 2GO1A 2X77A 4BNLA 3M2TA 4U7WA 3VI3B 1J6UA 3FDZA 4G4SP 2WVJA 3EAQA 3VFDA 4EW3A 8ABPA 2JCSA 2CLOB 2YY5A 4JYCA 1BZYA 4BQQA 1WRBA 1QDEA 2IZ6A 2Q2VA 3CUUA 4FVTA 4ND5A 1MR3F 2EXXA 1V8DA 1XQYA 3SJZA 2J3JA 4IQGA 5KOJB 4W9MC 2ZI4A 4EPXA 3BVPA 3GV0A 3HKCB 4RV4A 1ZA2A 3EHDA 2IPXA 3V3TA 4BQNA 4Q6BA 3RIEA 3H3JA 3BJMA 1YA4A 2WZQA 1AN9A 3AEKB 3FPLA 3RTCA 3M82A 4B17A 3LYAA 5JD3A 3UUFA 1GRQA 4EG3A 2PSEA 1OXVA 3A4TA 5A5DA 1PZGA 1TTPB 4HGZA 3K15A 4UTZA 4R7GA 1TT5B 1LKZA 2GD6A 1JZQA 1S5PA 1VPVA 5LNK1 3REQA 3KWMA 1NBHA 4ZVRA 5BT8A 2O5VA 3OO1A 3TLYA 3NMUF 1HTWA 2P9EA 3FF4A 1Z7EA 1NNUA 5EKDA 3V2IA 4F92B 1CUFA 1C7JA 4TS1A 3R0VA 5AM4A 1WP9A 2HRQA 3RBZA 3H1EA 1Z6YA 3MB8A 5L95A 2FOLA 4QBTA 3I5XA 1WHSB 3GCGA 1RPJA 3PFCA 3PL5A 1RAEA 2TS1A 1V8FA 4FCTA 2UXBB 3IMCA 4F2DA 1C7EA 4KJXA 1S02A 3GHYA 3K9NA 4N7JA 3IERA 4NNPA 1CULC 4CRWB 1LBSA 3H9CA 2P9ZA 3DBOB 4LVNA 4AY3A 3WIUA 4ESVA 2I2BA 3RRFA 4BE7B 4D8UA 2OYCA 4BECA 2ZZKA 2NZWA 1SXQA 4D5GA 1Y4SA 1V25A 2BFFA 1K75A 4AJIA 3OFKA 1TYAE 1FYXA 2FOIA 2C0PA 3ABOB 4DLTA 1YJAA 3CR8A 1M2GA 3GA5A 2SECE 3I9NA 4XQ0A 5FOTA 1BX3A 4R54A 4LJ4A 1Z63A 2ERCA 2Y6VA 3K1JA 1Z22A 4HPXB 2ZWIA 3FPSA 1OYYA 3LAWA 3LBHA 4OQ4A 3S68A 3U0VA 3D6HA 4FIZA 1H05A 2EFGA 4X45A 5JHHB 1CHNA 5D5HA 5IANA 2HMYB 1M83A 1O0BA 4HRYA 4I1YA 2EFDB 1OAOA 1WVMA 3PT9A 4Z4IA 4M1OA 4FD2A 2XW6A 2DTDA 4LHXA 5KJFA 3FWPA 1UOOA 5LQRA 1YE3A 4DQVA 2ZI9A 1YS6A 3AFGA 3HXKA 5PGMA 2VXBA 1W0JD 2Q4EA 4GEKA 4A8JA 2JLSA 3CFYA 2W2OA 3L0SA 3P0JA 1LLDA 1IK6A 1NBOA 2ZS9A 3N2YA 4TLMB 3A4YA 1QP8A 1SCUA 3SHFA 3A3KA 1XJWA 4OJQA 4N39A 4DIEA 1C3OB 1GQYA 3X1JA 3HGTA 2C2BA 5BV7A 1AS2A 3CH7A 4KBYA 3W9SA 2ZAGA 5DHTA 5JBNA 4IHQA 4JU9A 3PVSA 3UWOA 4RQUA 3NM5A 4FBGA 2O0LA 4J94A 4HBZA 5KVQA 2I6TA 7YASA 2QQFA 2QTRA 3ZIUA 1TDJA 1PDVA 4MUJA 3ICCA 3ZXSA 3QSGA 5CVDA 1IQPA 2O3TA 1N5RA 4MKFA 1E6CA 2QE7D 3HCNA 3OZEA 4BIIA 1NONA 4EHKA 5KO2A 2QRPA 4LJRA 2RHTA 2XKJE 3IHLA 3M5WA 3NGXA 4NDZA 2HJ9A 2FG5A 4DYHA 2QXTA 2VZ8A 4FFBB 4DANA 3GJSA 1ECJA 3CGWA 5D1HA 1AKQA 4BEJA 3CNEA 1YQDA 2FDXA 3FIUA 2SCUB 2XUKA 1YNSA 2I4IA 4DJAA 3A1UA 3E7DA 1H3EA 2FH5B 2WG1A 3RVLA 5YASA 1IJFA 4JXKA 4PNEA 2Q9AA 5T4EA 3EULA 4YCDA 5AVOA 1OYOA 4FSHA 4Z0HO 1RDFA 1RBZA 1YDEA 1VJCA 3VPFA 1E1CA 4EWLA 4XFJA 1HDXA 2HF7A 4LYJA 1MPTA 1OAKA 1UAYA 3BRWD 4H2DA 1NVGA 1CDDA 2F3QA 2I54A 1JPNA 3NVMB 1EGVB 2ZSHA 4YCBA 3LXRA 3M6WA 2OG1A 2AUMA 1O97D 1WULS 5J2TF 1U2GC 1ZS9A 3M6AA 4Q4LA 5CJJA 2BC9A 4IIFA 1RTTA 2FFAA 1JQEA 4FZ3A 4XSGA 2ATVA 3TD9A 5CK4A 1ZK3A 2P79A 1R0WA 1WVIA 1WV1A 3PKJA 2YMQA 3Q87B 1TA4A 1C14A 2ISCA 2QX8A 4Q9IA 2JCVA 5SY4A 1Z5UA 1LUAA 3OCUA 4MI1A 4CQNA 2TMGA 5ALFA 1DKPA 5KBYA 3THXA 1JALA 3WWZA 3VV2A 1IBMB 5F76A 1QF6A 1UFQA 3I8XA 1GGJA 1E6UA 4LJ9A 3SS7X 4QXQA 1R5NA 1PE0A 3BGIA 3EPLA 1XCBA 1DFHA 1DV1A 4F56A 2BFBB 2EG9A 3GYGA 3OQ6A 3ZCPA 4F9TA 2CMHA 5CJ2A 1V9SA 3CEHA 1M6EX 5H68A 3AGPA 2ID9A 2P0YA 1DIBA 1MVNA 2NQ2C 4KBGA 4YAIA 2PGNA 1R8QA 3ELUA 3RVKA 1DIGA 4Y3UA 4C2AA 4EY5A 1QE5A 4URFA 4G84A 2C2HA 4TKLA 3CLRC 4DOMA 2NXJA 5KQPA 3ZXUB 3WWYA 2DJ5A 1EPUA 2C5BA 1USGA 2JAQA 1Y8RB 4IIUA 4II2A 4S1OA 4F1KA 4YRSA 3K6SB 1MX5A 1XALA 1L5GB 2BFMA 2IVFA 3SNHA 2ILTA 4EJSC 1PUXA 4DSUA 5JECA 1YBHA 2VWGA 3GGOA 3FF1A 5LQMA 4CKXA 4B47A 4CM4A 4PC6A 5LDHA 3N2EA 4HGOA 3BXPA 3OF3A 4AY2A 3I53A 3RLIA 5EWMA 1JDTA 1D6SA 1L6RA 4K6KA 5U1PA 3P0RA 5TIIA 5LMNB 3HJAA 2MT9A 3EN0A 4ZVPA 1T25A 3B53X 2FP4A 4EX7A 4BMVA 1XMQB 1RTKA 4MDYA 2F1RA 1W2HA 3V8RA 1DT5A 2J4FA 4F8JA 2AZDA 1GTRA 5JJ5A 1OHHD 3GW8A 2J0EA 2NO0A 1L5YA 3IX7A 3KJGA 3OEHA 4RK0A 4DQDA 1RXVA 2AF3C 1X1EA 1ID1A 4PG7A 1RQPA 3UMGA 4LOJA 1VIAA 4PG4A 4UTVA 4ZEWA 1U98A 1VRWA 1OXBB 4L76A 1S7GA 3ITNA 2DFLA 3NXKA 2JD1A 4AP5A 5IKXA 2O3JA 1G8FA 2VWPA 1L5KA 4BMYA 3Q9LA 5HQTA 3JATB 3K5PA 4RFLA 3PRYA 5CRIA 1PG0A 4RTLA 1NT4A 1Z75A 3JR3A 1YVUA 4IV0A 4LYEA 4PIMA 5BN4B 1ZM2A 4EG5A 3IUBA 2IZ0A 5CT4A 3TJMA 1VCMA 3QUCA 2YYAA 1KIFA 4TT8A 2DUMA 1X7XA 1FTWA 3N05A 5IYZB 4JT8A 4C7XA 4QOFA 4C08A 4L5BA 1JMKC 1VCOA 3EIWA 3VPGA 1W2WB 5L3QA 3CRQA 3UJ6A 4CEJA 3RHTA 1ILWA 1ZVKA 3G5AA 1FX1A 1XDZA 2REBA 4HC4A 3VR1A 5CM9C 2EKZA 1F9EA 5JPCA 4YWJA 2E82A 1JE1A 4KNWA 4BBPA 5B6JA 2Q6TA 2IDKA 3K1ZA 1GL6A 1K27A 2B8NA 2Y0PA 3H0KA 3NHYA 3IIKA 4FQ7A 4QREA 3I2KA 4XEUA 3PPIA 1L5MA 1AGNA 3I3SR 1J09A 1LTHR 4C6HA 5LD2B 4JBGA 3R0QA 4BKUA 4BB9A 4YMUA 4K87A 2DHCA 3N39C 4WOJA 5AXCA 3L7OA 5EAIA 4QJ3A 1GTVA 5ERGB 3LC0A 4X1IA 3LQQA 1J2UA 1QE3A 4U9IS 2QAIA 3MWEA 4KUHA 3W1WA 4A8PA 3O21A 3AM4A 3F9CA 2ENWA 4JC0A 1R0CA 3GZJA 4WGFA 4PX2A 1DLJA 4NV3A 3E0QA 1Y6RA 3TSAA 1OAOC 1S9DA 1HRKA 4PIPA 4TYNA 3W2TA 3J7AC 1A97A 2EEPA 2YZMA 1FPMA 4BGIA 3HUDA 1WOYA 3LKBA 3MJRA 3S0JA 1N6HA 1ZNXA 3IJPA 3KTOA 4Q3CA 4A8JC 5I9NA 2ZUEA 3DR3A 3FTPA 1M33A 2VTVA 4QA9A 1NBMD 1AF7A 2ACVA 5DLYA 4GR4A 4AMGA 3C1AA 3DC7A 4UFOA 1XRRA 2MSDB 3OLVA 5TGTA 1CVLA 1UK9A 3K2IA 5E7JA 4DMUB 3W90A 3BTSA 2X7JA 4MI6A 1JIIA 1REQB 1M66A 1ZQ1A 1R10A 3AV0B 4F5DA 4C4SA 3EBOA 1SOWA 4EARA 3KBBA 4BKMA 2ZUSA 3O95A 3PA8A 2PWYA 2BSXA 3PXBA 4XGQA 2PRSA 3O74A 4XOIA 1U3FA 2HBYA 3B5IA 3FVVA 2GZAA 4Z3DA 4AIIA 1AT1A 5L6LB 1YVRA 1J00A 1KI2A 1MJGA 2VF8A 3AUSA 3T5CA 4AG5A 1BMFD 1JJAA 1IB6A 3FNEA 3H2SA 4KWEA 4KK3A 5EMHA 5DBIA 3EYWA 4N7RA 2Q3MA 5TMDA 2Q62A 4BP1A 4GP7A 2OBFA 5M7EA 4BFYA 4HWTA 1CK4A 4U6NA 1U0BB 4HNSA 3AV3A 1TM4E 4KCGA 1CHDA 5JASA 3HDQA 1H5UA 1AK1A 2MTBA 2QRMA 3OQIA 4YHHB 4NPCA 1OB2A 1HE4A 3AUUA 4EA8A 5HZKA 4CEIA 3V4OA 1AQUA 2P1RA 1TMOA 3AK4A 3RFXA 1CUIA 3PC2A 1XZDA 4OI2A 1EEHA 2IOFA 2XMGA 3P2YA 1Z56C 2V58A 4X9XA 3L0IB 4HDSA 4NBWA 4OHZA 3RU2A 2X0IA 3KO8A 3HEMA 2G77B 3GCXA 2JGMA 3TQRA 2BR3A 1SQ6A 3EOZA 1DWOA 4HF7A 4PZPA 4YGYA 4C0BA 3IAS6 4HMOA 3K5HA 4E5VA 5B57C 4GFDA 1U9CA 4FYHA 2KB0A 2I1LA 4GWKA 2GYUA 3ZOKA 3H05A 3CW2A 2ZXUA 4YDQA 1EVYA 1TK3A 1CZRA 3FUWA 2EGHA 4FWTA 2PQ0A 2FQWA 4KN8A 4XSVA 1G8AA 3EQ7A 4HJXA 3NVAA 3SJ7A 2WG0A 3WZMA 3FNIA 4XVQA 3HKBB 1JEEA 2BT4A 4GM1A 1CS0A 4OXKA 1NY5A 4ITVA 4WUVA 1ZSYA 1EK0A 1XAIA 3HKEB 1NQ5A 2DQ4A 1AKRA 2NU6B 2GN9A 3NIWA 5F2KA 1L4LA 2J87A 5BQFA 2HWYA 1HR0B 3WLHA 4XIJA 4G0ZA 4BWGA 3BA6A 4LGYA 3V97A 4DMGA 1OW3B 2XOXA 1QFZA 2ZROA 3AHHA 1MB3A 5FPYA 3T3HA 4EI8A 4F1WA 1VYTA 2YNMA 4ZDKA 2JLXA 5ICFA 3IRVA 1UMCA 2HA5A 2V7WA 3HCCA 4K3UA 4Y7CA 2ZJAA 5FXMA 4AX8A 4B3MB 1O4VA 2B82A 2IPMA 3CZPA 3STTA 2PQ2A 3IEKA 4M0KA 5BMOA 1XC7A 3TTUA 1IVYA 2JZNA 1U2SA 4M55A 1YFKA 3CF6R 3FCXA 3NYIA 5KPJA 2VEDA 4F4HA 2NYVA 4Y1GA 1JHAA 3ROMA 1YDMA 1K5HA 2ZIZA 1T2CA 3AJ9A 1L6IA 5E2AA 4NP6A 3C6KA 5EY5B 2PT5A 3W8DA 1FFHA 3QEJA 4AURA 3KFVA 3P9XA 1CX9B 1XEXB 3AQ4A 1A4RA 3HYLA 1KJQA 3P97A 4RK4A 2WD8A 3WO1A 4CZ2A 2Z9DA 1ZD1A 5AVKA 3WMWA 1PL0A 2F43A 3F96A 3ZWOA 3FSGD 1MUUA 1ODFA 2BIFA 2ZXEA 3FWZA 2QN7A 2OESA 4LEIA 4KXYA 4RFSB 2XVXA 5KYNA 1RJGA 2KJQA 1W4ZA 1KVSA 3TZBA 5JS1A 3DEFA 3FBWA 2IHJA 4YRGA 1TW3A 2RHBA 2HRCA 3N86A 3GLSA 1OIXA 3V1NA 3W5DA 1JR6A 4IINA 1QH8B 6PFKA 3LY9A 2IX3A 3RC8A 2FG6C 2PBLA 4EELA 1B16A 2WLSA 3U17A 3AH8A 1LBHA 2NO1A 4UEJA 4L6AA 2VUTA 3EPJA 1H6CA 1OBVA 3A28A 1ZPDA 3I73A 1SURA 1U4NA 2FWPA 1HQKA 3ZDYB 1VPWA 1YZNA 4EZIA 4IYRA 1T9AA 2EL9A 4GGPA 4AJ1A 1G3QA 2JKVA 1FRNA 3CF4G 3GLHE 3OIDA 4MXDA 1IEWA 4B43A 2VAMA 2H31A 3RFVA 1EUCA 3E4CA 3N6RA 4HR7A 2C7VA 1E6LA 1TVCA 2XMCA 1X19A 1HYEA 1I80A 3CKLA 1NYLA 2CJWB 1XNJA 1DJOA 3E9RA 4PLFA 2A59A 4ZAYA 3MRSA 3N9IA 4KN6A 3ZWQA 3ICVA 2H7YA 4KR7A 3MMSA 1GSOA 2PNJA 5DTIA 2IHTA 3UHOA 4OOEA 1JAYA 2QP3A 4FK8A 1R6DA 2YOHA 4RFVA 1KL7A 1AKNA 5MF6A 4L85A 4MV1A 4N0PA 1AE1A 1ZHFA 2OHFA 3P2KA 4ZOQI 2XZDA 4AJLA 4C4ZA 1L5LA 2YBEA 4FJ1A 5IYZF 4JJ4A 5JNWA 2HLNA 5IS2A 1RAHA 1ZESA 4KQ2A 2F1JA 1EU1A 4EW6A 2GCOB 4UC0A 2QPTA 5IHPA 4G37A 4WN3A 1Y82A 4C6SA 1KF0A 2EDCA 2R48A 3R3XA 4IW3B 2P6RA 4NZOA 1CUJA 2B98A 1JT9A 4YCNA 3TLGB 2G1KA 1EM8B 2BN4A 4EB6A 3M0EA 1YI0A 1IE3A 1XD9A 4TKZA 4KREA 1V4VA 2QDKA 4P80A 2RHGB 1A9XB 2B61A 2G9VA 3OEWA 4YGXB 2D1QA 3CBQA 3FVQA 2QRZA 1PZXA 4KQHA 3ACCA 3FH0A 3T3EA 4AQDA 3E9NA 2YV5A 1P5ZB 3Q3IA 4UE6A 4BO0A 3DD5A 2OLEA 3EGOA 3VTAA 2OQIA 3ITKA 3ZU5A 4PINA 1TMGE 3BGSA 3KSZO 4KEAA 1GOTA 3ZHZA 2IHZA 4DPLA 2ECFA 2HWKA 3DONA 4NCNA 4O59O 3ZLUA 2ID8A 4BDSA 4WESB 5KOJA 4ECAA 1IWOA 2A7QA 3RRMA 2JHPA 4E2FA 3HKCA 3PQ5A 2PSJA 2I7XA 1NJSA 2C03A 2GFIA 3CUEF 1JUDA 1G20B 4X8MA 5C31A 3ZK9A 5I8PA 821PA 3AEKA 2H2FA 2D5AA 2QN2A 2Z98A 4H7HA 4GZ5A 4KL8S 4PICA 4G5SA 1G6OA 4IZHA 4UQPA 1XDUA 3CMMA 1R4AA 4J4HA 1YACA 2IV2X 1U7OA 1TT5A 1HEYA 2BHRA 3GLKA 3C0KA 5EJIA 5FA6A 3LPNA 3DOIA 3GY0A 1NGSA 4YCSA 5EQJB 1YB5A 4QLOA 1F12A 1PKXA 3SHQA 3TKAA 2GH1A 2GPJA 2BMVA 1YRBA 4TL9A 1KMMA 4YJ2B 4R9SA 5DHAA 2IJGX 3VYUB 3RYHB 1VHLA 5AKZA 1OA0A 3Q7RA 1VG9B 1N1EA 4B7UA 1BMQA 1WHSA 3W05A 4ZZ0A 3THYB 1ZJWA 5HS4A 1UODA 1U5BB 3SE0A 3G9TA 2L0XA 2EZ8A 5ICMA 4ERXA 2NIPA 5HOEA 1LLFA 1RKBA 4NK5A 4E33A 3BAFA 4D6YA 1EBFA 2W2LA 4FE3A 4HAZA 3ZVNA 2WWYA 1LJLA 4QYWA 3U13A 4U7HA 4Y2SA 3IAM1 5FP0A 1Y89A 2OOSA 3KPJA 1PFQA 2BKEA 4D3FA 3M1AA 3OJFA 4FYWA 2ZG6A 4W5TA 1B23P 3NBKA 2WFLB 4I2NA 1ZCBA 3NIBA 1IQUA 5DMXA 1KY2A 3HJUA 2WF8A 3R8XA 4JBNA 4WFQA 5ITZB 2OFPA 1BCRB 1E79A 4MRNA 4PY2A 4ZVKA 1WG8A 4CDNA 4OX9B 1G8YA 4G1UC 4QOSA 4R1OA 5FL3A 4ER6A 4CW7A 5LL6P 3V8NA 1P4JA 1OREA 3WL4A 4Z8XA 2FRDA 5J40A 4O2LA 1XJ5A 1MCZA 4A8TA 1DAIA 4DIFA 2XH8A 1U2RA 1IOWA 2IXEA 2RBGA 3HS3A 5FAKA 4HX9A 2W6JD 4TSFD 5FBVB 1J0BA 3MCVA 4ONEA 4YQFA 3OJLA 1GKLA 2K2WA 3PGVA 3ESQA 4W5NA 3LRPA 2EJWA 4GKBA 5CEFA 4WWHA 4HMPA 3NEYA 5JMOA 2M6RA 1JKXA 5BSFA 2ZPUA 1JDBB 1ODSA 2YNMC 4DA8A 1JPVA 2ZW9A 3T1OA 3IQIX 2JIZA 3VNSA 3NWBA 2ZSKA 1C3OA 4ZWNA 4FOPA 4L74A 2VA8A 4WBNB 4HAOA 1YQGA 4YS6A 2XZLA 1NF2A 4CIVA 1UR5A 3CKMA 4IQ8A 1BIFA 2V55B 5B7NA 4OL0A 2SKCA 2HUPA 5TMPA 4B71A 2BEUB 3LT5A 4Q05A 3D7NA 3VR0A 1UC4B 1JR2A 4Z53A 3LVBA 5HEKA 3M6UA 2VYCA 1PBTA 3KTFA 1XTIA 1GR1A 3MF4A 2XDAA 5H83A 3OEHD 1XJCA 4AW9A 1PWHA 2R5NA 2QR5A 2O1WA 1IXRC 2FPUA 2VJOA 3KYDB 3KUUA 4LQDA 1QIMA 4FFBA 3WYDA 4QDTA 1IHXA 1G2OA 2O8NA 4ZV9A 1HKHA 1CYDA 3TZCA 5KOHB 2QLTA 2SCUA 1HNXB 2JC3A 2VZEA 3AUXA 2PT9A 1KOFA 4AJNA 2YV4A 3LLUA 5AHKA 5K20A 3LE8A 3IAUA 4P5PA 1QQBA 3QW4B 3VMMA 3TR0A 3B1KA 3J7TA 4TWJA 1HI9A 5TSDA 1NV9A 3R7FA 4JSTA 4C0AC 1VIDA 1LDYA 3OZDA 4XJXA 4F8EA 4B4VA 4Z5XA 1T10A 3N3AC 3WGZA 5JJCA 1J8YF 3L1HA 1JLLB 3JYLA 3KALA 1V1JA 3D3KA 3WLKX 3T5MA 3KKEA 2IP1A 4M9CA 4A7PA 4MV4A 5K8VA 3LX4A 1NSFA 4KFTA 3WFZA 4JITA 4E1AA 3N07A 1G2IA 2AQHA 1IIRA 3R0XA 1T34A 3G8BA 1NQWA 1SXHA 5DM2A 2CCGA 2C2WA 4J2TA 4CIBA 1WPXA 2YJ4A 3IPLA 4IFEA 4V0MA 4QUDA 2RHLA 3ZD7A 2VTBB 3OWXA 1TYDE 1XTBA 5HUHA 5KNBH 2X23A 1BO6A 3CMCO 3SF0A 5KOYA 2JD2A 5JT1A 1QMPA 2PJUA 1LVUA 2XUDA 2YS6A 3QUAA 4KUGA 4MCIA 2GN4A 2HBRA 2HUNA 1U65A 5EHQA 3HG7A 2AH5A 4LECA 5LLSA 4LFCB 1PS0A 2BFBA 2WMDA 3E48A 4XPZA 4RSGA 4DDMA 4RTSA 2YWFA 5H1YA 1H93A 2Y1EA 4DIDA 4L5AA 1TEVA 2P4UA 4HH1A 3IO3A 3AUTA 3F2VA 3LECA 1MKYA 4F04A 5HILA 5DCLA 5EJMA 3P2MA 5EE3A 3SX4A 5MGNA 1XDWA 2H1IA 3D3NA 4BGVA 1Y8RA 4EOGA 1RJFA 3W8FA 2E3JA 3K6SA 2XBMA 3F4KA 4XYGA 3WB0A 4CDGA 3HP7A 5TARA 3UWSA 3LKVA 2RGNA 4ZOLF 4WW0A 1AURA 1E7QA 1R9MA 2I6FA 1ML3A 2HTEA 1I94B 3G2NA 1FS5A 4IWXA 3PUJA 2QYOA 1WCYA 1HSOA 4LXYA 2A30A 2QLBA 3TIGA 3VVBA 3RYTC 3D2CA 4C03A 1HZZA 1F60A 1USWA 4WY5A 3ET5A 1CY2A 5HKAA 4IVPA 1H85A 2DF8A 4HLQB 3BDAA 3DHYA 4OXNA 3CH4B 1VIMA 3W7AA 4AKHA 4LSZA 4OSEA 1I9GA 1J56A 2C9CA 2QD5A 2WWWA 3PX3A 4QVKA 2XE6A 2YJTD 1GAXA 1IN5A 3PXCX 4ABTA 5H70A 2V7BA 4LRYA 4DR7B 2PR2A 3IVCA 3Q8MA 5F98A 3WL8A 3SSOA 4DZZA 4ZC1A 3MHTA 1GA1A 3H0CA 1T1RA 4NHEA 3I1JA 5EJ4A 2C8KA 3OTHA 3D3EA 2QMZA 2CMKA 2RGDA 2QXUA 3MMXA 4IEIA 1BGXT 3JATA 4NU6A 3ILHA 3QBJA 1AB6A 3F0TA 4LK2A 4WZBA 1VLLA 3PD1A 4DQKA 1XZ8A 3FPKA 4KVZA 1EZ4A 3DTVD 3N58A 3PIIA 1W35A 5HMLA 5BN4A 4WDRA 2J07A 3DR5A 1H94A 3ZI7A 2II6A 4BJ5A 2I6XA 3FPJA 1M9NA 1ZD3A 2H7XA 2YHBA 2R65A 3LCCA 2CWDA 4C6RA 2HLDD 1CJMA 4EYGA 2VHJA 2PVPA 1D4OA 3R3JA 1FP2A 2R7LA 2TSYB 4XVUA 1TYEB 2PKQO 4AU1A 3AVWA 1PNOA 4GX2A 1RHJA 1B8PA 1YAJA 4HB3A 4B81A 1AA6A 4QOHA 2CYBA 3U19A 1UBKS 1XL1A 1TK9A 1NC1A 2TMKA 1DDOA 3SM9A 4F0JA 1PVVA 1Z28A 2O7SA 4LOIA 4H1TA 4DAOA 1YI8A 3HL0A 1P80A 4B7XA 3K9CA 2WI8A 1SBYA 3PNOA 1Z5GA 5LDDC 4DDUA 3RYCB 1PK9A 4DV3B 4QQRA 4YRLA 3LPAA 2PZGA 1AUQA 3ZH9B 3ZWNA 1L8OA 3SZGA 3ERCA 1LFAA 4F06A 3PUHA 2FRDC 4H9GA 3KZVA 3ETLA 5AVJA 3L8DA 4JXJA 1NG1A 3DV2A 4PGFA 1LPOA 1Y7PA 2ZJBA 4V03A 5JBIA 5EJ7A 3ISTA 3G0GA 3Q0TA 1MGPA 1U1DA 2HFJA 3V46A 3LNTA 1RI1A 3PQFA 3SHTA 2NMVA 1GU0A 3L7BA 3EWSA 1CVIA 2E4WA 4CF6A 5CU7A 1JHYA 1Q0UA 2O14A 4KV7A 3OQMA 1KPGA 9ABPA 1DFIA 2GKGA 4PLHA 1K5DA 4GL2A 3KUKA 2Q1XA 4QWWA 4R0NA 2NGRA 3ZQ4A 2J3KA 3QF4B 2WJJA 1LRKA 4ND3A 5HKLA 1W6UA 3U4GA 3L0OA 5IEJA 1V1RB 2PWAA 1L4UA 4BV9A 3IJ5A 5LMZA 1P4RA 1M0EA 2N9UA 5JNSA 3NHRA 2Z09A 2WKPA 2Q3LA 2ZBEA 1REQA 4LPKA 4AMBA 4QBKA 2BFWA 4FNMA 3OESA 4DXAA 3Q3CA 5JDCA 1K68A 2ZANA 5KVVA 2V5VA 4XARA 3PXEA 4L9RA 4BV8A 3A6KA 1YR1A 4EGQA 4EMBA 1NZFA 4LYYA 3GOQA 4NMMA 5EZYB 1WXQA 2P40A 3OM8A 3SDSA 3MJFA 4MAFA 3SX0A 4AP6A 2E4VA 2VYNA 2A5DA 1SOVA 1UOEA 3EPRA 1T8YA 1P33A 1U4SA 5CT6A 1S8OA 5SICE 3L05A 4G0OA 5K8UA 1ND6A 2IYNA 2VBCA 2JH3A 3C1TA 4MB2A 4DEVA 2AFIE 3KT0A 2XMQA 4RL4A 4H3HB 4OX9Y 2AGVA 5IRCD 2EGGA 2NZ2A 4W63A 1EXVA 4QFDA 3LZCA 5BORA 2AR7A 2VQ6A 4MIOA 3AB8A 4ZVTA 3OJEA 4HFRA 4QT4A 5AKKA 1K7CA 1BAPA 2YQZA 1NURA 1O57A 3SHWA 3R9WA 3RJ5A 1HUQA 2FW6A 3GZ4A 4DQUA 3UWKA 4W7IA 3I72A 4URUR 2PGDA 1ZJZA 1Y7TA 2VHQA 2QP4A 3X1DA 5KNCD 4JVMA 4PCUA 1BDMA 1J0EA 4HX2A 1U0GA 2PRIA 3CXUA 4WLNA 1P6XA 3VHRA 4AXXA 5HRAA 2BGWA 4RHFA 4NWIA 1OIWA 2AZTA 3ETHA 3JVVA 4EJFA 4KR0A 1ZL2A 2VNAA 3V6LA 4XYBA 3NVDA 2Y9MB 1VI2A 2WAYA 3I2FA 4RYLA 1DDGA 3RJ9A 1NU8A 3KEQA 3FZNA 2GETA 5JYDA 3AYZB 5K0BA 1QP0A 2RE8A 2O2IA 1E6WA 3B5JA 3HKBA 1V26A 2WB4A 3O4JA 3ZY6A 4B76A 3I4CA 3HKEA 3C87A 2NU6A 3DMTA 1Z12A 4NRDA 4EY6A 1UBRS 5EXEA 3B85A 3F74A 3I8SA 1RQ7A 3A9SA 2J9FB 1SCDA 5DGDA 1O0CA 1ZN8A 2LCFA 2QQ5A 5ICCA 4MITA 2OM2A 4D0LB 2Z9BA 5THQA 2P3OA 2XAUA 3ZY2A 4MRSA 2IYXA 2SKEA 4F5ZA 3ZXXA 2JLYA 4B6OA 2FLKA 3UJBA 4RTMA 1XPJA 2IYEA 3JU3A 2C84A 1G63A 2DECA 1YB1A 3ZY4A 4I55B 4ZT3A 4B32A 1JDJA 3FTCA 5MGBA 2KBEA 5ALIA 3OU7A 1ORTA 3AONB 4I4LA 1XRQA 4YV2A 2GRAA 3AIKA 3FSJX 2FHPA 2JGIA 2RGNC 4EL5A 4NLLA 3Q9SA 1DAPA 2WTNA 2CYAA 4IHAA 3K53A 1C8LA 2NVBA 3HDTA 1XEXA 4IDQA 4OHVA 3SYKA 3UXMA 4Q1FA 4CLRB 4OK3A 2P4QA 2ZT7A 1RXIA 1ZOSA 4F9EA 1QYDA 2P6OA 2OCGA 4LTMA 1HV8A 4AYTA 5CIQA 4EW2A 1HZZC 2ZJZA 1WR8A 3CUVA 1LPSA 4RFSA 5FPKA 5IT0A 1P8JA 4U0KA 3UHAA 4PAOA 1Y4DE 1NHWA 3OIGA 1KDOA 3HP1A 5B4VA 2IS6A 2J9ZB 2GDJA 3RRYA 4BGEA 3I9V6 2OBLA 1UXJA 4H6XA 4RZ2A 2Y77A 3FTFA 2Z8XA 3Q1LA 1A2KC 2WJAA 1GZSA 3ZV7A 5JRZA 2QA5A 2FX5A 4WA8A 4W5OA 4GRAA 4DCOA 4J9VA 1T2AA 1T5IA 1NI4B 1PDOA 3QXJA 5GVRA 3U26A 4YAFA 5HMMA 2I8CA 2XDYA 5DO9A 3S6JA 5KB3A 3KZXA 3VVLA 4YCCA 1XZKA 4L6IA 3CF0A 1CE8B 2X42A 1JFFB 1IVSA 1BW9B 3FHCB 2PS9A 2HQBA 3KZCA 3FG9A 3E3OA 2CJWA 2G4VA 1T0JB 5EGNA 2HB6A 5FA5A 4WBNA 1POXA 1IY1A 1T1GA 3PX2A 3GAFA 3OA2A 2RBKA 1GAJA 1H2AS 3GN1A 3R77A 4ZFNA 4RF3A 2PBFA 2XECA 3BK1A 1DXHA 4TSKA 1HLDA 2VHTA 2OM6A 3HPQA 1XZBA 4QE3A 5A62A 1P1FA 4QO8A 5B1SA 2YH2A 1G4HA 3DVSX 2WBLC 3UATA 4ZMBA 2OO5A 1DQNA 1WZEA 4OEHA 4GMGA 4BLWA 4G97A 3TLAA 3PNSA 3SR4A 3UC9A 5JE8A 3S2GA 1SD5A 4ZZ3A 2W2VA 1LX6A 2GNPA 2GCGA 2PIDA 3T0FA 4F60A 2Q6KA 4JVLA 4TVOA 3OOJA 5H82A 1RZRD 1H4QA 3T1TA 1U31A 2GCOA 3FGNA 3VH4A 4AX4A 3N8DA 3E9YA 2L2QA 3B12A 5KNLA 1I6MA 2GB4A 3COWA 4MQLA 4RACA 4ARBA 5LD2C 3F67A 3W2IA 3QVMA 2AE1A 4YRFA 1SHTX 1Y5LA 2QZSA 2CXPA 1KRWA 4LOLA 1D5WA 2OE2A 2P9YA 3TLGA 2TMYA 1EM8A 3BB4A 4EKIA 3QW2A 1YZKA 4N12A 3U39A 2E21A 3ESYA 5I9IA 4Y9RA 1A9XA 4OGGA 5GONB 3LZ6A 4M1SA 3D3WB 4I4IA 4TYMA 4FDUA 4M0EA 1N5OX 4Z6KA 2GA8A 3DJFA 4HNQA 1WMSA 3B52X 3MWGA 4F38A 1XZHA 2Q5LA 4HH3C 3VRHA 3NDIA 1UKZA 1CF9A 4W99A 3M9WA 2KBFA 1BS2A 3H6KA 3L04A 3BXHA 4MWDA 2X9NA 5DNVA 3BE8A 1TUBB 3OQOA 2C5AA 4N9QA 3K8ZA 4WESA 4MYCA 4EBFA 2AOWA 5GZ1A 4ZP1A 4H4DA 3TLZA 4Q01A 4C2UA 1OFUA 3KAQA 3ZXIA 8LDHA 4LXGA 3ESZA 3GN2A 5IW8A 1W9HA 2V97A 3LZDA 2B3DA 3K2BA 1SUCA 1U0HC 1JG7A 1XBTA 3KQWA 3Q2KA 3EGVA 3G5MA 1U7PA 2OB1A 1UC8A 2P4HX 4IG9A 2ZWMA 4CQMB 5JDCC 1GLVA 1UMBB 2VP4A 3UQZA 4ILKA 3IEUA 2VATA 5LU8A 1ATIA 1A4IA 4TXJA 1NVTA 3EQ6A 2I1WA 5CP8A 1GZ4A 1AKYA 3LDUA 2QV0A 3B13B 5BOVA 4YJ2A 1K8YB 2AHOA 3GFFA 3VYTB 5B6IA 1GDDA 1F9AA 5LA6F 1ODTC 3LBAA 2Y05A 4RPIA 3O8BA 1YS4A 3L4BA 3RYHA 4A16A 3L18A 2QAGB 4B5LA 2GPYA 1WCWA 2UVDA 1U5BA 3OD5A 3GAAA 4LJ5A 5IKPA 3AKCA 1G5TA 2BBSA 1A9SA 1Y5NA 5EZYF 4I2VA 3HCRA 2Q1TA 3FCSB 3C3DA 2P9HA 4B1FA 1IZYA 4DMMA 2VP2A 1LGYA 1VHWA 3FAZA 3MMZA 3WXMA 1S2MA 2JDIA 4DADA 3ORQA 3TKYA 4TS3A 1KZ1A 2WFLA 2NSLA 2ZYIA 3B89A 4Q18A 3SWWA 2OLKA 3DWEX 2PX8A 1DQPA 4P2BA 5DE3A 4O25A 1RZUA 5ITZA 2ROQA 3FYUA 1BCRA 1QH0A 2A4MA 4YROA 4FCVA 1D4AA 1GG2A 3TE6A 1MW9X 1Y8CA 1JIXA 5DBFA 3K09A 2C5HA 3BC1A 3DAPA 3B38A 3TUZC 5K8TA 1GU7A 1VCIA 4JEIA 3T1YB 2AZMA 4CVNA 1THGA 1T9ZA 5BRJA 1Y6QA 3R75A 3O2JA 5DLEA 1NTRA 4R3UC 5KKCA 1NBWB 2FZWA 3ZJ4A 3BKWA 1G16A 2LP4Y 3C6BA 2OAGA 4INOA 1JFLA 5FOVA 3Q6IA 5EP3A 4CF3A 1QYWA 2IHUA 2VTEA 1NXQA 3Q85A 4ARAA 3DMTC 2OBMA 3G85A 4Y98A 2CXUA 4DEYA 1ORIA 2Z0MA 3OF5A 1YBMA 1QV6A 1NMSA 4I1SA 1Y5MA 1BNCA 1EE9A 3QKTA 1K3TA 2DETA 2QMYA 1P4AA 3D9QX 3W5AA 3P9YA 5FOUA 2ZKIA 1ULHA 3LTNC 2JZOA 3G3EA 5C3UA 1ZBDA 2PU5A 1CJSA 3PEYA 2IPLA 2MSEB 1WIWA 1U1CA 2EV9A 5AUQA 1R50A 5BVGB 2XUPA 1IG3A 3FB1A 4GYJA 2HXSA 3NORA 3ZVRA 2FE1A 1N2CE 5C18A 3JY6A 1E0DA 5TMBA 4RQBA 3JZAA 3EMBA 2BEUA 1KP2A 1L5SA 5JOQA 1RXWA 4L4UA 2EDAA 5K0TA 4IV5A 1QZXA 1XFAA 4LGCA 1YQWA 4AJPA 3KLPX 1ZC3A 2A5LA 2NU9B 2I78A 2PZEA 3KYDA 4ISBA 5EN4A 5JXJA 1W7AA 1YOVB 2XYQA 3LHSA 3MYYA 3TPFA 4NZYA 1DWPA 3K6JA 4DC0A 4BFVA 5KOHA 4LRQA 2VG8A 2WSLA 1LWNA 3NZEA 5DGTA 4E5SA 1KQFA 1FJ2A 1CERA 2NVOA 3IDOA 3DZBA 2B92A 4O4JB 2H1SA 3ISJA 2QK4A 2RC6A 1KQGA 1UP4A 3B2EA 2DFDA 2ZRFA 4FHDA 5SY9A 4NNOA 4BMPB 4R9UC 4JENA 3I9OA 4UDOA 3OPMA 2VUUA 4WUTA 5A5FA 2JI8A 3JYHA 2ZJ5A 1JLLA 4MYTA 3RFTA 2OEPA 2YOGA 3KKQA 2OB2A 4Q1DA 2GD1O 4OMDA 4XH9B 3C5HA 3QA9A 4HRAA 4XB6B 1KYIA 1VSVA 4RKYA 5BWBA 4A0FA 2FPSA 4Q39A 1KNQA 1NQTA 3ET4A 5DIZA 1HL7A 1W25A 1DQYA 2L18A 4Y2YA 3UF0A 2DPLA 4LVOA 1XAJA 3O8NA 3DKIA 2C4TA 3PHCA 4HNGA 2IYQA 4GX5A 1XJ0A 2VJNA 1E1QD 1JFRA 4WJLA 4UPEA 3R20A 1PJBA 1NW4A 2VTBA 2R2AA 3BGVA 4TMWA 3LBIA 5B2ZA 2YVKA 3WGYA 3CW9A 4YUWA 2DH5A 2WMNB 5AM0A 2B78A 5CNJA 3TW8A 3AKEA 1ZRSA 4G0MA 1ACLA 1NXVA 1X3LA 4RMJA 1CP2A 1L9XA 2OO5C 3RFUA 4YYZA 3BDVA 3SQMA 2FFRA 2D3WA 5BXYA 3TBHA 1FTYA 2Q46A 2H5IA 1X92A 3L9XA 2X0KA 4FFDA 2R1UA 4NFHA 4R41A 1NAHA 1KJ8A 1ISHA 2H6EA 3PGLA 4NCJA 4P7BA 1XU9A 5DWDA 4XM0A 4OIFA 1N8SA 1GFIA 4NJEB 5HGJA 1P4GA 1GCGA 2LIVA 4MIYA 4F96A 3PLAE 4E2YA 1X9HA 3LSYA 4Y2XA 3D7KA 3GRKA 3DFMA 3LG2A 5J4HA 3OQ1A 4P2GA 3L0ZA 2A67A 2AW3A 1JSXA 3LQ1A 4F3CA 4FNGA 5IPFA 2ORYA 1ZH4A 4UBLA 3K70D 2YJ3A 2V1UA 2BGTA 4B2LA 1LW6E 4OHCA 1TJNA 2B4TO 4O2RA 1A5BB 4I5FA 4I3HA 4UJ3A 1XTSA 4WVLA 1Y9DA 3DJYA 5U4QA 3QKUA 5J5VA 4UM8B 4RK6A 1M67A 4KODA 5GONF 3BH7A 1DPGA 1OCEA 5A04A 1NL3A 1FQKA 2XHZA 3UM9A 1OILA 2CD9A 3O1LA 4QBIA 4CM3A 4AYXA 5CDFE 5CYOA 3JQPA 3K30A 5G4LA 2I6SA 1C9NA 2AG1A 1BOFA 3D6UA 3FAKA 3KKNA 3R0JA 3TVYA 2WJVA 4K5QA 2GQ0A 1WW3A 2BHNA 5CFLA 2DVMA 4LYAA 2HWWA 5INTA 5CW2A 3KEGA 2CV0A 4TS9A 4AN4A 1QBGA 1AQYA 3LGSA 3EEIA 4OHXA 4RY2A 1V4BA 5HF6A 2BTEA 3RU3A 4G25A 1JFSA 1TCCA 1EZ1A 1HG1A 2H85A 3WDSA 1MORA 5WRFA 3V33A 1USKA 1BROA 1KC1A 3FNGA 1HKUA 3HBNA 2V3VA 2R84A 4GE3A 4XYLA 1RRMA 5K8LA 5HZHA 5DT9A 1RC8A 1NP7A 4AS3A 1VL8A 3L4BC 1Z7BA 4HDMB 1GILA 1X86B 4DSTA 2Z8YM 3JAKB 3ZDXB 4KGDA 1J2YA 5DW3A 7MDHA 1VKJA 1ZH0A 2C8JA 2JKYA 3RVMA 2R4TA 4KSBA 2Q5JA 1Z5ZA 4HZGA 2UVQA 3CS3A 1PGJA 2DHRA 2AFIB 5TF4A 1IG0A 1P9LA 2KE5A 3U7QB 3ZU3A 1F7VA 5HG0A 5J23A 2DBZA 5BWLA 4JH0A 1Y7IA 2ALJA 1H2WA 3BWXA 3DLIA 3N0TA 2MR6A 1M0WA 4K7JA 4TMXA 5JSZA 3K71B 5A3SA 3HVJA 3PHIA 1SXJE 2ZAOA 3IMFA 3PZBA 1RLJA 1W48A 4A15A 3DM5A 3JZIA 3O9ZA 2VSXA 4YR9A 3RYCA 1Z7WA 3FYUC 4LRXA 4MW5A 3R5SA 1IULA 3CINA 2FWBA 2COUA 1NHGA 2RKOA 3K6KA 4UHEA 1SVWA 1LSJA 1H2ZA 2EHJA 4MAAA 4PFKA 3USZA 3CSSA 3K09C 1NRXA 2Q9CA 3HXOA 1A9PA 1GZ7A 3OZCA 4QXPA 2GTIA 1KEVA 4LY6A 4CMEA 3UJHA 2IEZA 3KV1A 1U4OA 3R4VA 4K9OA 5SYMA 3THYA 1SO8A 3JQ8B 1PJTA 3NRCA 3YASA 2R5FA 4KGVA 4F6RB 4KLZA 1NKTA 1C3LA 1OWMA 1QYIA 2HF9A 1E5DA 3EXEB 1N36B 3RHFA 5DGIA 4KXVA 3ZIDA 1XLWA 5BW6B 2GX6A 5FORA 1U7DA 1HWYA 4CE6A 3AVOA 1KO5A 1UADA 4V39A 1JDBC 3MT8A 1K0FA 2A1UB 2PO5A 4FOTA 4X20B 1UJMA 3A2MA 2FXIA 4MULA 3E1SA 5FT9A 3UBTA 3OLZA 3VSDA 1LSSA 3INTA 1V1RA 1ZD5A 1TVEA 5CUQA 5ULLA 4H0NA 1QNLA 2DE0X 1UAAA 3C6YA 5J4KA 2IIQA 2FETA 3PR3A 1FMCA 2WAMA 4KNYA 2C4NA 3ZLVA 2CHQA 2R2GA 4O4IB 3EIXA 2IKSA 3PJFA 4FMPA 4TTQA 3RSHA 1EGMB 3N7UA 3SC2B 3V8BA 2AFHE 4DCTA 1ZN7A 1Z37A 1BXGB 2H1VA 3D8BA 2P9FA 3NHWA 2XUQA 1YKFA 5EZYA 5IT9A 1ZNQO 3HCWA 4L72A 2D1SA 3IT1A 4UPDA 4PN3A 3TCKA 3P9NA 2YW9A 4OXYA 1YZUA 3R5JA 3BWDD 1VLVA 1F17A 2XF2A 4MGKR 3WIBA 1TYZA 2QN6A 4IMRA 4QZVA 3WIDA 4F1JA 2VHWA 1YJ5A 5H4HA 4DIBA 3ZD6A 1F0NA 1Z2EA 5DCYA 1X8XA 2CYCA 2FWNA 3FFAA 4LHZA 1MO2A 1QDUA 2JCBA 4IDHA 1C50A 1XVAA 3WKAA 2I34A 2V7PA 1ISFA 3EODA 3LYLA 2P9JA 5BW5A 3K9LA 1NLYA 3MT9A 1TB4A 2IF2A 2Q21A 2R85A 3A9VA 3I04M 4L8YA 5EIWA 2JS7A 3V7FA 1NQAO 5ARCA 1ZVVA 1IN6A 2R60A 1UF9A 2VQSA 5A6SB 5CPFA 5B7QA 4O4JF 2ON6A 4QSMA 4NOJA 1LDEA 2OGZA 1O9HA 4S1WA 1JLKA 4OQDA 3QVUA 5JALA 2ZB3A 5BQ5A 1UT5A 2X8WA 2CN1A 2YFKA 3BF7A 1ZIPA 1XRPA 1N75A 4MUFA 1T9GR 5D86A 1RXEA 5L3ZA 2R8ZA 3RSFA 4OHYA 3FKJA 3ODPA 3X1WA 1YR8A 4OLBA 4I66A 2Y3IA 1MB9A 3A9TA 4F4DA 2NTEA 4NFSA 1Q1QA 1NNI1 2H3EA 3OSZA 2H1CA 5K2MA 2IXFA 1TA9A 1XCGB 2BDUA 2JI7A 1P17A 3GIWA 5KYXB 4H1UA 5ECYA 4ASUA 5DHRA 1DU4A 2WWGA 2Q45A 4BQSA 2J9FA 1P62B 2WIDA 4PWYA 3PITA 1H5NA 2EBWA 3DB2A 4YA6A 5FTMA 4XI9A 3VMFA 4YV1A 1NVVR 2WD7B 2VPPA 2VK4A 1L2TA 2XNJA 2NAFA 3L8HA 4WCFB 5HCUA 1DKQA 1EWTA 2YQ5A 1QQTA 5FQOA 3K0EA 4YRAA 3MJVA 5KQRA 1YA6A 1NW7A 3HXMA 4RY8A 1CUVA 3CWZA 1T26A 3RYFB 4I55A 2V03A 2CDAA 3L6RA 1FDTA 4L27A 3A25A 1RHKA 3H1BA 1RAFA 3WIEA 3B82A 4M8IA 4H27A 4FDAA 4N41A 5E4JA 1TKCA 3W9YA 1E1YA 1XE3A 2HV8A 5DTQA 4P8RA 1XT6A 4ZO7A 5KYUB 1D8TA 4CLRA 3OY2A 4B33A 1PLKA 1ZGHA 1IH8A 1PF7E 1WABA 4AKSA 2CK3D 3DZIA 4LYDA 1SUIA 4PS0A 4RXUA 5AI9A 1NDQA 2BHTA 4NCHA 5DIFA 5HK9A 2FFBA 4DLUA 3VX3A 2GBPA 4W7SA 1CNMA 1UBLS 3P0EA 3ZBPA 2RH8A 5IDYA 3WLMA 2R68A 2V3WA 2WIGA 5CYPA 2V0GA 2C2ZA 3P71T 1HRDA 1E7RA 3CZQA 1N0UA 4E2XA 1JLHA 4YJGB 2B8JA 1WXHA 3D5QA 4J43A 5IULC 1NXOA 1NI4A 2QL7A 3EEBA 3O84A 1T6BY 2ZUCA 2V6GA 3ABRB 3MBOA 3UCXA 1OR8A 4WNIA 2JFUA 4P3XA 3QWAA 2IEAA 3GJ3A 4QPZA 3K92A 3ZHOA 1CE8A 2JDID 4FFOA 1JFFA 4PC2A 1GV0A 1IDN1 1BW9A 4OA5A 2C31A 3O2SB 1Q7BA 1ECCA 2XF8A 4KQJA 1YC5A 4ZKDA 4UTNA 4QGFA 1FW6A 1QHNA 4C87A 4Y6OA 3PRHA 5I4KA 2V0CA 4LXHA 3E1KA 2AA3A 4UARA 3JVIA 2BE7A 2HPAA 3GRUA 1UBGA 2J6CA 3B1JA 5FD8A 3QJGA 2GRJA 4J76A 3G0CA 4IV8A 3DDOA 4QSHA 4BFCA 1NJ8A 4H17A 1ODCA 4MUBA 2VYFA 2BFNA 3LYUA 1Z5PA 3OU6A 4UM7A 5KJEA 2LPMA 1YSCA 3H97A 3ENVA 4D9FA 1NOIA 3H11B 1L0BA 5FO1A 3ADDA 5DBEX 1ZEMA 4DMLA 3QP9A 1W4CA 1ZGCA 3GEPA 3R7BA 4W8HA 3G7UA 4PZAA 1WB9A 1T0PA 4QHSA 4MEJA 4R51A 3I6YA 2B9VA 1L7NA 4OP3A 3D6MA 5BSKA 1PWXA 2IUSA 1DEHA 4GOND 1ZJ4A 2V7GA 3ONNA 4LRTB 1KOLA 4ZPJA 3QENA 1XG5A 1JIQA 5DNDA 3RABA 4DNFA 1HURA 2WTEA 5JISA 3QX9A 3HSYA 4JGIA 2WDPA 3KEMA 4BN4A 2D2VA 4CMEC 2HJHA 1Y37A 2HRDA 1PU2A 5GONA 3D3WA 3WNVA 3WK6A 2ZJ6A 4Y6LA 5D5PA 4QUHA 3A1CA 4ARIA 5DOZA 1HY3A 1NQVA 1C9YA 5LZ7A 3REOA 3ZWBA 4MV9A 3HJRA 2R7AA 3GA0A 2B34A 3SVLA 1EXMA 4WZAB 4MV8A 1PP4A 3LQ2A 1OQAA 3ZEIA 1V3VA 4BOYA 5JAPA 5KDDA 1TUBA 4PYJA 2Q7XA 2FVYA 4EFKA 1J23A 3ORRA 1JX6A 2AR0A 2O06A 1ZN9A 4URWR 4BE4A 4YLYA 1RR6A 3OZFA 3PRKE 4P3NA 4R6XA 2PUBA 1JHMA 2JAXA 2WAOA 5CEEA 2QG4A 3ESXA 4DWJA 5C1DA 1N7IA 2AUTA 3H86A 2Y1XA 4K81B 1OWNA 2FPWA 1WUJS 3GFTA 3L7AA 4G1VA 2AYYA 2E4ZA 1X0XA 3ND8A 4CQMA 5TQ0B 5AW3A 1C1XB 1GPAA 1UMBA 1KZGB 4UE3S 2WUGA 3LX8A 2UU9B 4JLMA 2Y1GA 5BSRA 4D9GA 2XVAA 2DY0A 4B35A 5K8CA 4LZZA 3BWCA 2EERA 1A7AA 5C1PA 4A5SA 5MDHA 1J8VA 3AKZA 2ZB4A 3QLUA 1VMDA 3NJ8A 1NMQA 3DXZA 3Q8LA 2I6QA 4Y0NA 3MGAA 3WS7A 3JYOA 2QAGA 3LT2A 3E9ZA 1TYCA 1UXIA 3CH5A 4O4IF 3RBXA 2GHIA 3T9AA 1XHLA 2AQ8A 3WGNA 4LF9B 3IEVA 2HW8A 2AN4A 1VYHA 2EL7A 2HHCA 2YWJA 3W8RA 2FZ5A 5JD4A 3WQSB 3B9BA 1B15A 4IRXA 2G9ZA 2BUBA 4QBHA 3TI7A 5LUBA 1O0SA 1PZEA 3R40A 4KQWA 4M88A 4ZAVA 4QPJC 1Y1SA 3W9UA 1O5OA 5IVDA 4KPUB 4PC3A 3ZTYA 4WHMA 2PUHA 4ON9A 4CM9D 1OC4A 4DTCA 2D7JA 3ME5A 4CXMA 3KKMA 1LPBB 3SIXA 5SYNA 1LDNA 4L8GA 4ENRA 4RADA 2JFWA 3G2KA 4QNRA 4RQTA 4FR5A 1DGQA 2EQ5A 2I91A 1KI8A 2OCIA 4PO1A 4M1YA 3SZOA 1D6MA 1YDGA 4LDZA 1B8UA 3TMKA 4TLCA 2DR3A 3GEHA 1KDPA 1HDGO 3TLXA 5EE9A 2HSJA 3U49A 5CLFA 3MJDA 4C14A 1V35A 2ZDQA 3VR2A 4B85A 3QE3A 4ZYTA 3HO6A 4TL7A 1N8NA 1YHNA 1EP1B 1JAIA 4RXMA 2IF0A 4WGGA 2AJ8A 1NM5A 4N5DA 1EE1A 4KDEA 4FE7A 2AVDA 4UHBA 4AJ9A 1FSSA 1NW9B 4KOEC 5FADA 2XUFA 2UUPA 2GPWA 1OWOA 3DOHA 1T2DA 1CZOA 2IHYA 3N2GB 1E0AA 2BI4A 5DZSA 5CAEB 1AQIA 1AK9A 4EK9A 1BEUB 3CRVA 4KRYA 2OVBA 4E21A 1Q0LA 2GVZC 1L5QA 4HVLA 3BF8A 2BMAA 3F46A 4ZVMA 3FE2A 3RWBA 2RK6A 2WEKA 2O19A 2R00A 5BVGA 3T1VA 3VC1A 1STOA 1X9GA 2P0EA 2OL4A 1HE1C 4YRKA 1JB9A 3N3BC 2FPRA 4DEXA 1UC9A 2AV6A 1HMPA 3GLVA 3N8KA 4LDNA 2XMSA 2DEUA 1UJ5A 4REOA 5EMLA 1V2HE 4N0MA 5B3AA 5EKSA 4AQYB 1DC4A 4IHJB 2MMGA 1MC8A 3DQQA 2X5NA 2ZCJA 5E3JA 1WXXA 1KYWA 1WSAA 2QI9C 2NU9A 3LWZA 3UH1A 5JMTA 2R8YA 3GP3A 2OFFA 1YOVA 2KX7A 3SZLA 2G07A 2DLNA 5EINA 4CM5A 2PZKA 4FHEA 2XNSA 2XQJA 4IKOA 5DEOA 1OT5A 4CV2A 3QG5A 1W5AA 2WFMA 1Q7EA 3IQXA 3L4SO 3M1IA 5E0KB 5FPPA 5EVJA 1L1EA 5CA0B 2XUJA 1SU6A 1TF7A 3AR5A 4ZZ2A 5JXWA 1KTIA 1FOEB 4KH1A 2WU1A 4HHEA 3URKA 1EG7A 1LTKA 1ZWLA 3ZJVA 5GM2A 1K2VN 3H1TA 3P9ZA 4MDEA 3I30X 3DFFA 1X8LA 3TWOA 4B3DA 1ICIA 3IP8A 1COWA 4H1HA 4ZVUA 4E4TA 1DBRA 3MBIA 3H04A 3QJYA 3OTOB 2QY9A 3ONDA 3E05A 4I99A 4Q37A 3HDYA 3IV6A 3JASB 1IRXA 3DP7A 4OGLA 4ESHA 1XWFA 5IMSA 4D4KA 2F17A 1KOGA 1J5EB 1UKCA 5DN6A 4PRYA 5LIRA 3JQ9A 2Z2YA 3IB3A 4A2PA 4NKRA 2LZ0A 3T99A 1M8GA 1GCOA 2C29D 3LY8A 5H80A 3W3ZB 3DF7A 3DLBA 3JR7A 3MRTA 2ZBDA 1UM8A 2QBYB 1T4CB 4FFNA 4KZKA 1IB0A 4M6WA 3T7JA 4X1YA 1YCHA 1Z0DA 3ILXA 1HE5A 1KHHA 2Q5CA 5F51A 4NMWA 1X42A 1AY0A 2JNWA 2OUKA 2J33A 5G1OA 1E2IA 4E5PA 1IZ8A 5MHTA 2J5QA 4ARZB 2HRRA 4CIAA 3F7NA 1G6Q1 1Q1BA 4CIDA 2GS9A 3T3DA 4RCVA 1SWWA 1XHFA 3WGVA 5KQSA 4IIEA 2AS0A 1X9IA 2CNNA 4N8EA 5FBLB 3UMJA 4BN5A 4ZEVA 1VKNA 1ZCZA 3WMXA 4RTQA 1SXJB 5JZBA 4M54A 4P32A 3C6ZA 1GFZA 1TEHA 2DZDA 1COZA 3UT5B 4NJEA 1ZX1A 3D0OA 2GYVA 5IDXA 3VTFA 1ISMA 4CI9A 1TTQB 1UAGA 4Y6GB 4HN4B 3M34A 1GADO 1EJ2A 1A8PA 3E5RA 3HXQA 2HSEA 4D97A 2VJBA 1ENPA 4RH3A 3O0TA 4AT1A 4DR5B 3RO7A 1WTCA 5E9AA 2YYYA 1I2DA 1ZMXA 3H5RA 3A6PC 1EM6A 1T5BA 2IIVA 1L4YA 3EDOA 4RM2A 5FHRA 3V4RA 4UHCA 3LKZA 2ZJ1A 3F9RA 4OBEA 4A0HA 1JGTA 1YRHA 1F14A 4J2OA 3H87A 1JA0A 4FBLA 1K6IA 3E58A 4BMDA 1MENA 4LRWA 2MOKA 1BX1A 3VUEA 4WBNF 1BU5A 1IXSB 1LXCA 3RUEA 1UDBA 2JCGA 4JEUA 4C7MA 4EGFA 2A0WA 1LV7A 3HVUA 4UNPA 2Z1MA 2R1TB 3COPA 4TVKA 3VNBA 2NXNA 4Q3LA 3UNXA 5C35A 3U80A 1G41A 2LR0A 1DKUA 3PEUA 5ALDA 3TS1A 1TM2A 5F9HA 1KSHA 2G36A 1ZGZA 1U8XX 3GWZA 2PV7A 3JPWA 4GUDA 5KTPA 2UVPB 3UWDA 3ZTWA 1IHPA 4ZYWA 1NULA 4YR7A 1EP9A 2XAAA 4EVIA 2WJGA 4EKDA 5C8VA 1Z4QA 3QLUC 1J7JA 5CXUA 3IDSA 5JAOA 5TLSA 3C5EA 5K3BA 3CF2A 5E4TA 1U7XA 4LC9A 4HDMA 4UM9D 2QAGC 1Z4MA 3EK2A 3LWDA 1ZYUA 3JAKA 4NYIR 5K0LA 4HS4A 3ZE1B 1UBUS 1PYOA 1XVLA 4W9RA 4CFSA 1B43A 1V8OA 1U5AA 3U9LA 5B2FA 2C58A 3MAJA 3SHOA 3HVIA 2AZ4A 3CY6A 3V2HA 4BAGA 2ZJ3A 5ER9A 2AFIA 2GEDA 2QM7A 4LQCA 1VP9A 1D2CA 3RKUA 1FUIA 3U7QA 2BGUA 4LI3X 3D43A 2XB4A 1V7ZA 1JG2A 1LK5A 4K88A 4OK6A 5DI9A 4Y2TA 5DMHA 3O9VA 4U7GA 3P4XA 1RI2A 5IXYA 1WUKS 5REQB 3KC2A 4JEHA 2B4RO 2O4CA 5ELXA 1J2EA 1PT8A 3EQ8A 3KVOA 4U5QA 1MLDA 1GKYA 1FVFA 1OXMA 1KAEA 2A86A 2DULA 3UJAA 1AX9A 2XMRA 2P6UA 3BWMA 1N2ZA 1WCV1 2M6KA 4D9KA 3N2NA 2X3UA 1B74A 3QY9A 1GKIA 5IC5A 1OKKA 1MABB 1VGRA 1YIAA 4EG6A 1M5RA 3MT0A 4JAVC 2VF7A 1EUZA 4G4SO 1QRTA 2AC7A 3W04A 4KR2A 2F9FA 3FHOA 3JQ8A 4JLOA 3OAAA 4PQGA 4F6RA 5BR7A 3SFVA 1II0A 3LXMA 3EQZA 1NM5C 1I4OA 2B21A 3EXEA 3G0BA 3T7IA 3CXRA 2WABA 2ZR7A 1RFGE 4FPXA 1JBEA 3OEEA 3PI7A 3Q8XB 3Q7EA 2YV2A 3E9CA 3ZI4A 3MELA 2A1UA 3N0WA 4X20A 3T4XA 2HDOA 2PT7A 4QRHA 1NUHA 3IP7A 4DIMA 5BUQA 1YTUA 4RTPA 5A05A 4II3A 1QM5A 2AFRA 3MTQA 2IWHA 3IPYA 3F7TA 1TQ2A 2WIBA 3UAWA 2R00C 3IQZA 2C99A 2XB9A 4LISA 2HRBA 5THKA 1CQXA 1A8IA 3OQBA 1NJ6A 2H29A 1T3GA 3WVNA 1LV8A 4GKAA 3M49A 4O4IA 4XRGA 2D74A 2WJZB 4Q9NA 4KQCA 4OAPA 2JRLA 3ASVA 1GXSB 1EK6A 1QTIA 1SMKA 2WFAA 4NU5A 4OHPA 1BXGA 3BXFA 3QXGA 4KIUA 4C2BA 4M36A 1TCUA 2NO6A 4NOKA 4TMTA 1NX9A 3Q12A 1VDMA 2FSGA 1AXEA 2P7IA 3K7EA 3QQPA 5JAHA 2BF4A 2BI8A 2AWNA 4Y2UA 5AJUA 3NTVA 2R87A 3HTXA 4C4AA 5DHFA 5I6DA 5TXGA 1TNDA 4C4YA 4IHJF 1S96A 4O5OA 4MI9A 4YMGA 1GUAA 3TNFA 3KAKA 5IT4A 3IPRA 2B0JA 1KQ3A 1NKSA 4HDKB 2Z9CA 5AHXA 3RS5A 3HV0A 2VDKB 4DVJA 2QNRA 3S2ZA 2KSQA 2Z2ZA 1F8GA 2JIOA 3CLTC 3HUFA 5KMGB 1KJZA 1V11B 4DNXA 5I9SA 5LNK6 3UV6A 2EZ4A 4LIPD 2FU5C 1PHRA 4JR0A 4AIRA 4JGGA 3BJZA 1E2PA 4OQEA 1EB9A 1U7HA 4XLZA 1K3UB 1RQNA 1TF5A 1KAQA 1R15A 3BMCA 3GEBA 4GPEA 4P81A 5H3CA 3W5HA 2CFIA 2YWHA 3JQ9C 3QVXA 4HKTA 3UB3A 4DV0B 4O3MA 1GQOA 1L9KA 1VE9A 3FLBA 5DSZA 1KDVA 3ZY5A 2IV7A 2Y68A 1C41A 5JMWA 2ZYTX 4Y2JA 2GWRA 2EX1A 4ZANA 3V32A 5IJ9B 1G8MA 3SQLA 2ZRPA 4G8BA 2WQ7A 1G8HA 1XZCA 5AHWA 1J1ZA 5ICEA 5J4LA 3RSOA 3S1SA 3D8UA 1ADGA 1ZXBA 2LUOA 1P29A 1N0WA 1DHRA 3RF7A 2IY8A 1SHZA 4EHAA 5KYXA 5JJIA 4JX8A 5ENVA 4INPA 4YK7A 3H4VA 3OI7A 1R27A 2QJTA 3TL6A 2ZUBA 2WPDA 5M5BA 3RSZA 5LXTB 1BOOA 3PUZA 1CR1A 5AVQA 3UUEA 4GC5A 1C1YA 1TVKB 5JV5A 4WCFA 5C51B 3M9XA 1G8SA 2FMFA 1DV2A 3CUWA 4EA6A 3P5SA 3D8NA 3RYFA 3TBFA 3TAXA 3NX4A 1L4NA 1LDMA 2RH5A 3QOFA 5C7IO 1FYWA 1SZCA 1CUHA 4TN1A 9ATCA 2B20A 3LA8A 1U8AA 3HPRA 1R6TA 3M4XA 5EEGA 4MKRA 2OZVA 1L3BA 2Z6AA 1Z6PA 2I5PO 5KYUA 2ADOA 5DNEA 4RANA 5K2OA 4MVJI 4QNNA 3COZA 1GJRA 1JN0A 1N5JA 1PNVA 4HWGA 3D8RA 3HKDB 1M1XB 3S2IA 4DDVA 3HWRA 1DS6A 5DI3B 3VKVA 1MBZA 2ADMA 5IXSA 3ZLBA 4KPYA 2IH2A 3EZGA 1OSNA 2OGUA 1W0CA 4O3FA 1E61A 4ZZ1A 4KAAA 5C8XA 2LW7A 3PT5A 1Z17A 4WXEA 1EDBA 1HTTA 3IT0A 5FV7A 4UEOA 5HJEA 3GZNB 1BGVA 1SHUX 4YJGA 4LHSA 3N2IA 5T57A 5IBPA 2WA1A 1CZHA 1G8JA 3C4JA 5B5SA 1P0IA 3NI2A 4JJZA 1ST3A 4FHGA 2LNDA 1P77A 2DBQA 2YYZA 4HEQA 3RG8A 1VE1A 3ZYZA 4HVCA 3R74A 3CX8A 2QUBA 2WJWA 5HTKA 2W98A 2AG6A 3G82C 4CL2A 2A84A 1UWLA 1NT2A 4EKEA 2Q3HA 1FMJA 5FA8A 3O3MB 1T6YA 1EWQA 3QE9Y 3PRJA 3ZBQA 2NP7A 5JI2E 4L02A 4CODB 5TVGA 4RZSA 1MO3A 1KE1A 3ZCSA 2IYOA 1WQ3A 1AA9A 4G9GA 3OSUA 4Y6RA 1E0KA 1LK7A 4LMRA 2R6R1 5DYTA 3GJYA 3ANXA 3H11A 4M1WA 1OJLA 2EG5A 2EFCB 5K51A 2PX5A 3K72B 2BTQB 3IIEA 3WLAA 2O8EB 4F2HA 3IBFA 1TRHA 4B46A 2I2XB 5HJ2A 4DREA 4CNQA 5LIPA 2HNAA 2Y4NA 1EFLA 6Q21A 2YIDA 4GBJA 1BTOA 2GM9A 4WPGA 2IZ7A 2HK9A 1V41E 5HW0A 1SVMA 3Q5GA 4D9HA 1FDOA 2FW8A 3VKWA 1SUFA 5BUCA 1WEKA 1Y3AA 2ZRNA 4CTJA 5JJKA 5LDGA 4H1VA 1CG6A 5DGXA 2GDZA 2GFHA 1KKMA 3HBFA 2YRFA 3SCZA 4IXMA 2QAJA 4PGGA 2HJWA 1JIJA 3HLKA 4XEHA 5AR1A 3LW7A 3HB9A 5EIBD 4KYIB 5AICA 2JHFA 1RBYA 3ER6A 3IVAA 4H6WA 3RRXA 2O0MA 1KI6B 1S89A 2IP2A 1PNRA 2P2NA 2GSDA 2H5JA 4K40A 2W37A 2O8FB 1NW8A 2C3YA 3WR5A 1MW8X 2PX3A 3WV5A 3FB4A 3DMHA 2IZOA 4RUKA 2A9JA 2EW8A 3EVNA 3LUAA 4G65A 4ALIA 1ARZA 3L8FA 1K88A 1T9HA 1LWOA 4HXFB 4X61A 2C88A 5DTRA 3O4FA 2VL7A 3BDIA 3I4LA 3T3NA 1SC4A 4RS4A 1QXSA 1VE3A 5KTOA 3BWEA 1USUA 5TQ0A 2GM3A 1C1XA 2P30A 2NYAA 1PJRA 3ANTA 3IUMA 4N65A 4E5DA 1XMPA 2YASA 5HBGA 1DQRA 2X8BA 4YUYA 5H4GA 4A5OA 3EGXB 5K3SA 1CRPA 3QVVA 1M7GA 3GJ7A 3Q10A 1KI7A 3LL4A 3TRDA 2QRGA 3FRJA 2XX3A 2PEYA 3J80A 4OLAA 4AG6A 4FGKA 3ECSA 2P9TA 4ZTBA 5E1OA 1G7RA 2D2FA 3I34X 1MQ9A 1IC6A 4WLEA 5U9CA 3B6EA 3B3QA 4GLJA 4X6UA 1XNRB 4ZYXA 1FP7A 5IAOA 1MC4A 1PFYA 1NVKA 4ISCA 3SOPA 4KFSA 3GRRA 4LQLA 1A9YA 3AVTA 2DLDA 1VL0A 3PJGA 2PCLA 3H84A 4B45A 5DU2A 4R8RA 2BJWA 1WP4A 3MEQA 4AKTA 5E3HA 4DPKA 3G1TA 2VT3A 3VJLA 1T9BA 3JQDA 5COQA 5BQPA 3NHBA 1ZW6A 2O2EA 5KTRA 121PA 4KPUA 4M98A 4AUEA 4OQNA 1EK5A 1UPUA 1YKSA 2A7XA 2AHRA 4AKIA 3V00A 1UXKA 1NMYA 4JS0A 4P35A 1JBQA 4H77A 4PZLA 2XRYA 2HSZA 4JR2A 3GNQA 5EE5B 5HM6A 1HETA 2QTGA 3NONA 5SZHB 1IUNA 1BWPA 1E7SA 1R0YA 1XOIA 2IZZA 3NV7A 3D6VA 5K0GA 2F4VB 5HUQA 2NYRA 1BJKA 4QYXA 1LD3A 3EF3A 1V3UA 3MCZA 1RKXA 2CMFA 3NHUA 1XFDA 4I5GA 4M8KA 1QK5A 3LT1A 1DXYA 1SBZA 4Z1MA 4CGZA 4UDXX 4TGLA 3GEMA 3RT9A 2UZ3A 1BRMA 4XKJA 1SK8A 3P32A 3PDUA 1UDWA 4KGXA 4Y1EA 1P1CA 3WYBA 1O6BA 3VO8A 2L42A 2D1TA 1HH4A 1PV2A 2XYPA 3N2GA 4GX1A 4MW7A 3KQKA 5KWVA 1G6KA 4X92A 4EO7A 5GZ6A 1ZXLA 5CAEA 3KJXA 4NAVA 3UZUA 3KOZA 4KB5A 2GWHA 3AM1A 4JN6B 3MCAA 5FUWA 2BBOA 3SVZA 4KG7A 2JI9A 3Q0IA 5B55A 3HM9A 3MJEA 2CGEA 1CS4C 1Q11A 5JADA 4WCFC 4DG8A 5LLDA 4GNRA 4JBLA 1ZXXA 3MWFA 4W5WA 2GEKA 4FE4A 1Q7GA 1FK8A 1JZTA 3P5BA 4LHYA 1J0CA 2WUVA 1UBHS 4LJAA 4YN3A 4Z4HA 4JUIA 2C57A 2VXYA 4LHVA 4IHJA 5LXTF 5A0FA 4ZN6A 4X90A 4RZHA 2I7DA 3A1SA 1BWRA 5C5IA 4ML3A 2JGJA 3GR6A 4LWPA 1KO7A 3SBOA 4KXFB 5M3BA 3WGOA 3ZN2A 1KQPA 1R9GA 1YIDA 1ZRHA 2FW1A 2VTKA 5ADVA 4PCVA 4B2IA 3OLYA 3QNUA 2W70A 1W36B 1T1JA 5E9JA 3FOZA 2QTMA 4BNYA 1JU9A 2WSSA 5CA0A 4PHHA 1RP7A 2G08A 1K9VF 2P11A 4M0UA 2VDUE 4UD2A 4DBLE 1NLMA 3QEKA 1NASA 3G5LA 4QXMA 4XTRA 3D2BA 4OATA 1KYTA 1KO1A 1KAOA 2BMDA 3FYTA 1VKZA 4FUTA 1OX5A 3NRBA 1VKHA 2RIRA 2DOKA 2XQGA 4I4NA 2O4UX 4B79A 1T6NA 2H1HA 2MYPA 3JASA 2NOAA 2JGDB 2PN1A 4MHTA 1XXLA 4AJHA 3DNPA 5ANRB 2GZSA 3CZMA 5EHNA 3GVCA 4EMTA 1N8KA 2ZM5A 1KY4A 2RG7A 3ENNA 4L8FA 3PQ8A 5CNIA 3D8SA 2HAEA 5JAUA 1JKIA 4IEFB 1YB7A 2RB4A 3L8MA 5JO9A 3RV3A 1YIOA 2OILA 4K1XA 5C1BA 3OP1A 3SM3A 1YXMA 2CUTA 1OXSC 1G5PA 3F6PA 3CB2A 2C78A 4KWCA 4MQFB 2BZSA 3MFYA 5ENDA 3AI3A 4RESA 2OYRA 2V9ZA 4RIHA 4EX6A 5HJ5A 2QBYA 1T4CA 1N2EA 2JFYA 3M6FA 5GV7A 1PTKA 2HIGA 2Z83A 3WLLA 6ADHA 4FZ5A 1VPTA 3D59A 1P0CA 3WBKA 4BNMA 4JI6B 2A58A 1DADA 2GJ4A 3HI6A 3OFVA 4A92A 3CCCA 1Y9JA 3IR5A 4FD3A 2EFYA 1X1QA 2XWQA 3DSRA 3IVXA 3NPAA 3OJWA 4D74A 4ARZA 4BC0A 4KMRA 4N5NA 1QQ7A 2F6RA 3NEJA 4DN6A 3OAAD 2QSJA 4LGMA 1NTOA 4C7JA 3ONEA 2DHEA 3K0AB 4GYYA 4BRUA 4ZMSA 1E6KA 3PXDA 1RPZA 3ZDFA 3L07A 3CE6A 1SXJA 2CEAA 1LB1B 1Z13A 2Z3ZA 1X0VA 4QYTA 1KH1A 4JI7B 3UT5A 2IW1A 3EEQA 3G5UA 3PGJA 3DS8A 3N7AA 4MWGA 4X1KB 1H2HA 3PUKA 3I5AA 2WWXA 2B30A 4NCIA 3L7KA 5KDOA 3AUYA 4Z49A 2QRHA 3NDPA 5IF3A 4QO7A 2CJXA 3ES9A 2G9NA 4QODA 1QVWA 4KVGA 1JH9A 1NYTA 3UIEA 1Y8QB 5CFOA 1CR6A 4LE1A 5EZSA 5BYBA 3WP1B 3X2EA 3P0IA 1UZUA 4CKCB 3NIDB 4URHA 2XVYA 2WSYB 5K45A 4AN0A 2QLJA 1Z26A 3QBEA 3AYXB 1S1CA 2A9PA 2XTAA 4GOJA 4X7BA 5K0JA 1C3VA 4BKPA 1P9OA 4O33A 3WBJA 1Y42X 3KTDA 5JXGA 1CUBA 4FYIA 4RGQA 4QAJA 3AETB 4U2FA 3LV8A 3SD7A 1IY9A 1Q7TA 2X1VA 2C9MA 2G76A 4J9UE 3I0NA 2R1TA 3T54A 3STVA 1D9ZA 3IV9A 1M1NB 1EK1A 1S3GA 5AH0A 1II8B 2P0AA 1OZHA 4KK4A 4X41A 4HDCA 4OKIA 5K3OA 2IV3A 3T41A 3G2LA 4JB8A 1GRVA 2VXCA 3ETGA 2UVPA 2H4JA 3I1FA 5DH9A 5FLEX 5LQJA 1E5VA 1LI7A 1ZNYA 3J81k 3PFIA 4NBRA 4QQNA 4LG1A 5EMNA 1P74A 4B8WA 5IABA 1PKEA 4QLAA 3ZQJA 1AKMA 1I4LD 1JKJB 1Z8FA 3RSLA 4EG0A 3HCOA 1R12A 4JZKA 4O02B 3ZS9A 3TZEA 3BCRA 4BYGA 2N1BA 3ONVA 3FHLA 2ASEA 2WC1A 2BGGA 1XQ9A 3FMGA