4CFZA

Savinase crystal structures for combined single crystal diffraction and powder diffraction analysis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SUBTILISIN SAVINASE
publication title Analysis of an Industrial Production Suspension of Bacillus Lentus Subtilisin Crystals by Powder Diffraction: A Powerful Quality-Control Tool.
pubmed doi rcsb
source organism Bacillus lentus
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4cfzA00
4WOBA 2ZWPA 3L1KA 4OMCA 4H6WA 4LVOA 3DE2X 1SBNE 3WIUA 1TM1E 4CFYA 4NE7A 2SECE 1SUBA 1SIOA 1GNVA 3DVSX 1SCJA 5ARBA 1TO2E 1GTJ1 2B6NA 4MZDA 1SPBS 4KB5A 5JXIA 3DYBA 1P8JA 3UNXA 3F7MA 3DE1X 1C9NA 1TMGE 3DE7X 1Y3CE 1BH6A 1OYVA 3DWEX 1UBNA 3CO0S 4AKTA 1Y34E 1YJBA 3SQOA 3TI9A 5JXGA 1S02A 3ZXYA 3DVQX 1TM5E 1C9JA 1AF4A 1IC6A 4CFZA 3Q5GA 1SELA 4C3VA 3DE4X 3I2YX 1WSDA 1TM3E 2W2MA 3CNQS 2WUVA 1V6CA 1BE8A 3A3NA 1MEEA 2V8BA 1EA7A 5AMXA 1KDVA 2WUWE 1PEKE 1Q5PA 4NMXB 2PWBA 3DE6X 3I30X 3A3PA 1SBTA 1TECE 4KPGA 3VYVA 1GTL1 2IXTA 3DVRX 1SIUA 1R64A 1Y3BE 4J94A 3LXUX 1NLUA 3EDYA 2IY9A 1Y9ZA 4AKSA 5JMOA 2SNIE 1SVNA 5AVKA 2WV7A 1SBHA 3H42B 1SBIA 1EGQA 3DDZX 1AQNA 3AJ8A 1OT5A 4DZTA 5JXHA 3AFGA 1C3LA 1P7WA 5B1EA 1DUIA 2HPZA 3Q40A 5K7SA 2Z2ZA 1AV7A 2TECE 1ZVKA 4KG7A 2SICE 1KDZA 1SIBE 1CSEE 1Y3DE 1GA6A 1THMA 3P5BA 4RYDA 4ZOQI 2X8JA 1WVMA 1YU6A 5ARDA 1SCDA 5AQEA 1JEAA 1GA4A 3GCXA 1GNSA 4Z2AA 1A2QA 2QTWB 1T1IA 1BFUA 2ZWOA 1PJ8A 4OMDA 1BE6A 3SICE 3TECE 1Y4DE 3ZXXA 2Z58A 1SUPA 4ZARA 1IAVA 3WIVA 3DE0X 2XTJA 2XRMA 1R6VA 3OSZA 2DUJA 3F49S 1GA1A 4K8RB 4BWGA 4FONA 3LPCA 2PRKA 1YJCA 1SUCA 1SUDA 2SBTA 1SCNE 1TO1E 3VV3A 1SBCA 2WWTA 3I34X 3TI7A 3VSBA 2DQKA 1R0RE 3GT3A 5I9SA 1AVTA 2DP4E 1T1EA 3VV2A 1KDYA 1ST3A 1KE1A 2X8JB 5CW1A 1Y33E 4H6VA 3PRKE 4CG0A 1NDQA 2P4EA 4YN3A 2Z2XA 3VHQA 3AJ9A 3A3OA 2PYZA 4LVNA 2G4VA 1WMDA 3D9QX 3HJRA 1AK9A 1S01A 5B1DA 1TM7E 2GKOA 5FFNA 1OYOA 3BGOS 1DBIA 3QFHA 3WHIA 5AVJA 3GCWA 2E1PA 2ZRQA 3EE6A 4GI3A 3I37X 1ZVJA 2Z57A 3F7OA 1HT3A 1P7VA 1PFGA 3VTAA 3D43A 4NE9A 1XF1A 2PQ2A 3QTLA 3LPDA 1SCBA 3DE3X 1MPTA 2Z30A 1LW6E 3DW3X 3QMPA 1GT91 4H6XA 2PWAA 1ST2A 1KE2A 1GCIA 1Y48E 1T1GA 1PTKA 3DW1X 5SICE 1CNMA 4M1ZA 1TK2A 4I0WB 3WQBA 2PMWB 5FBZA 2W2OA 3BPSA 1SUAA 4JP8A 3DE5X 1Y1KE 2ID8A 1S2NA 1SN7A 1WMEA 3EIFA 1NDUA 3GT4A 2HD4A 1SH7A 2ST1A 4DWWA 1AH2A 4OV6B 5ARCA 1TM4E 1VSBA 1BJRE 4HX2A 1YJAA 5JXJA 1SUEA 2Z56A 1GTG1 4WOCA 1C9MA 2ID4A 1V5IA 1BFKA 2PKCA 2W2PA 3T41A 2Z2YA 1AU9A 4HVLA 1Y3FE 3LPAA 1SCAA 4B5LA 1WMFA 2W2NA 3BX1A 2W2QA 5FAXA 3PTLA 4C3UA 4DJ5X 1Y4AE
chains in the Genus database with same CATH superfamily
2H2FA 4JZKA 5F3DA 2PT7A 2WRZA 5SV2A 4U5XA 4WMLA 1OWLA 1T36B 4HGNA 5I4IA 3ZDFA 1W9MA 1H2YA 3O0DA 4A10A 1T6ZA 3UPDA 2YHSA 1TM1E 1K7CA 1FIUA 2OLKA 3MUOA 1PD1A 2Q3FA 2HQSA 4DBLE 3DMRA 4XLTA 5AVQA 4FT4A 2IUFA 4L4UA 4P3OA 1HMYA 2IITA 3GAMA 2CDNA 1NJGA 5PGMA 2PXAA 3BK1A 3LC7O 2BDTA 5EQTA 3MJVA 4BLQA 2D1RA 2WPNA 3PRJA 3H1EA 1DIBA 5BUZA 1U2ZA 3G7NA 3JASA 3MGKA 5FJIA 3L4JA 3ZWCA 3UJ8A 5KNLA 4IX1A 4CM5A 4K81B 3P9SA 2RHBA 2XYQA 1KBZA 3ACDA 3OSUA 4JSRA 5K0NA 4NOKA 5FFFA 4GVXA 3I09A 1DV2A 2WAOA 2BGNA 4X90A 4W5JA 3RYHA 3SVLA 2AX4A 4GRDA 1S8FA 3NOVA 3E9YA 4FFBA 4HDMA 2YYZA 3WR5A 1N6HA 1KPIA 1XTSA 2NVBA 3HLKA 4LOKA 3Q8KA 1OYVA 1QO7A 2VBFA 3WBBA 5LOVB 3FOAA 1WBJB 4NS1A 1IJBA 1JEQB 2EL9A 3CKYA 2LRHA 3DS8A 1Q0HA 3QOYA 4O4HA 1KI7A 2YJ4A 3MHTA 4FNMA 1CERA 2PO5A 2MCFA 2BEUB 3A27A 3K5HA 2R6CA 4RZXA 1L4YA 3H8VA 1KZ7B 3A2LA 2OO3A 4XIGS 2QI9C 2X7XA 3P5SA 1NMYA 4DBVO 1GR1A 4FHZA 5EVCA 1ZR2A 2Z2KA 1UFKA 3EPHA 1FFCA 3N0WA 2B4QA 2Q6TA 2WA2A 1FFEA 1N6KA 3E27A 3GUYA 1YVRA 2PK3A 3BD6A 4XM0A 2NSYA 2QL7A 3OIDA 4LRWA 1GADO 2P3SA 1X9IA 2QL6A 1F8UA 1GSOA 1T9CA 4EW6A 2ZAOA 5C1IA 3U62A 1K3FA 5D5QA 4NZMA 4MAMA 2DFVA 1Z39A 4URZR 2GZRA 1OGYA 3E1GA 2I1LA 4RXMA 3WY9A 1U1IA 3M5PA 2PZLA 4PFQA 4UPVA 3ZBUA 3FDZB 2OLJA 2VZ0A 5F78A 4WBNB 1DTWA 3VPFA 7YASA 2Q0XA 4X93A 5A6SA 4DRZA 4X6LA 4Q3BA 1C3XA 2ZREA 5M3BA 3RIXA 3KB2A 5T6BA 1EEHA 1I2CA 1GFZA 4P4SB 4E33A 3SKYA 4NMXB 2CJPA 1JKJB 4C7XA 2O8FB 1KI6B 3DE6X 3I30X 3KZ1E 5EZ5A 1GDTA 5LN1A 3QKRA 1TECE 4OUKX 2Q7XA 1IEVA 1M2KA 2W37A 4TTPA 3H5WA 4R8VA 4A8JA 5J58A 5JJLA 1EJ0A 2RGEA 4J0DA 2H29A 3RREA 3KIPA 7GPBA 4DJTA 1V1JA 3CSSA 4JKOA 4LRSB 5HRAA 2I67A 4RMNA 2W4QA 1SKBA 2QE7A 1MZVA 2C8JA 3DEJA 5BN4B 1JSXA 5AICA 2D2FA 3AV3A 5BSMA 4BMPB 4TV9B 5F73A 2WU8A 4HZUB 4A0QA 1YKSA 2RGNC 1K0UA 5F33A 2DBYA 1V8OA 3JXEA 2CYCA 4XW2A 4JI3B 3H6GA 1XKXA 5EMNA 4V1CB 1Q92A 1RJEA 3CEMA 3MMZA 2I2BA 3ADPA 4EFKA 2I78A 2I6GA 1MA0A 3HI4A 3IUSA 1PUJA 1NLFA 1RWQA 1ZWKA 4JKYA 4F8JA 1JU9A 3EIEA 2R62A 1E8NA 2QN8A 1H9CA 2AK2A 3LA8A 3OKCA 1Y5RA 1Z4LA 3EBOA 3OM0A 4ZALA 3TZCA 3PX7A 2J31A 2HIGA 1RPZA 1NBWB 4HUJA 2IK8A 2OBNA 3UUGA 4DANA 1EWVA 1GJRA 3RCBA 4GMDA 4RVUA 2DFTA 4BQPA 1FMFA 1IOZA 3DDZX 2W93A 3QBTA 3AJ8A 4I5IA 1JJFA 4LJYA 4LHVA 1WNTA 4RCZA 1PT9A 5LMNB 2OCKA 4WERA 1VM6A 3A25A 5L40A 1J8YF 4TQUS 1YB5A 2IPOA 3P9YA 4H3SA 5AJWA 2ZAIA 3DLAA 1KJZA 4B7XA 2YVKA 2RSLA 2ZJ3A 3CVOA 3L7MA 3GAZA 4Q4AA 4Q15A 2OILA 4HAIA 1K97A 4N0QA 3ZN2A 4X00A 5IYZB 1IHYA 1XDBA 3KZKA 3QLVC 3TQIA 2HO5A 5AP9A 3RIYA 3KWMA 1LS6A 2X5NA 4AW9A 1YDFA 2JHPA 4ASUA 1UJBA 5K0LA 3N2NA 4IGFA 4Q21A 3VR3A 4BKMA 4S04A 2PEYA 1TOAA 2WYUA 2XGGA 2B8JA 5GVRA 1OIXA 4IIXA 1P1RA 2JEYA 4K3VA 5JJCA 3JD4A 3WRXC 1G55A 4MIKA 3DBLB 5A3JA 1IXKA 2AHRA 2RK4A 3OBBA 1T1SA 2J6IA 4MCAA 2QMQA 2PUDA 3JYNA 4XJVA 1B0PA 3DBHB 1J24A 1XZ8A 3I52A 1N0UA 3BE5A 4HNGA 3W5AA 2CZCA 4BBPA 1Y1PA 1HG1A 3BF7A 4AFNA 2ZUDA 4IDBA 4D81A 1OB5A 4AY2A 1RLIA 3DQZA 1U9CA 4MWZA 3WMFA 3T3PB 4I6EA 4GP7A 4BZXA 5LZ5A 5ARDA 3I8XA 4EB6A 4WKCA 4D56A 3DFMA 4BLOA 1TJ3A 4NBKA 3HKCB 2FW8A 3IUBA 4XGQA 2CK3A 1NF2A 2R8RA 4C6TB 1EFVB 3KQMA 2JEZA 3PEWA 1P2TA 1UK8A 4EGJA 2D2IA 5JD4A 4OHYA 1E5XA 4Q1VA 2FMUA 1NOKA 3C70A 3SHVA 3GFFA 2VO1A 1RWWA 1BMFD 4GR9A 3IODA 2PU7A 4IYRA 1JMKC 4QUDA 1XAGA 2H2HA 5KNBH 3QKUA 4R5MA 3IPCA 1IEXA 3BULA 2FR8A 4ZIRB 3VDXA 5KEIA 1JIKA 2BPOA 5IXSA 5LLSA 4G1VA 1A9QA 3L05A 4ZQFA 1E6KA 1JBEA 2BL4A 2G80A 3AJAA 3IILA 4KLCA 4PPGA 4Y2PA 3LECA 1OILA 3H5RA 1A76A 4X60A 4UAVA 3DOJA 4Y1EA 5EE3A 5JH7B 3C5VA 2G08A 3A0UA 4LI0A 2B99A 4J0CA 4MUIA 2AXEA 4TLAA 3VU9A 2FN7A 1RKVA 3LE8A 5EUMA 4YWJA 1QP8A 3COSA 4BLPA 1R9GA 3WXMA 1REQA 3ZDQA 1I13A 3CRRA 3EFOB 2JLXA 4X6UA 3VJLA 3QLEA 4D46A 3LIPA 3OVMA 3DBVO 2CVFA 2XDQA 4F72A 4WKOA 4EVSA 1GUFA 5IJAA 5ED4A 1XVVA 2CT8A 1U9IC 1XELA 3QVXA 3G1UA 2BEVB 1Q0LA 2V96A 3KZOA 3NBMA 4YDSA 1OV6A 1ZVQA 3LBAA 4NABA 3ROZA 4EVIA 5LXTB 2BGIA 3BB4A 1CE8A 4CMIA 2H1SA 4GDMA 5AK0A 3UFXB 4DMFA 5ICSA 4K6GA 3RRXA 1T0PA 4QD3A 1H85A 1FS6A 2JLQA 2Q3JA 4ND2A 1UC8A 1XGKA 2VWQA 1KFJB 1FYDA 5HILA 5E95A 4AO7A 2Q8QA 2JAHA 4PXSA 3AVPA 4G1BA 4R1SA 3MBIA 4F9EA 1SCNE 4ISBA 1FNMA 1NRIA 1X0XA 4KR9A 1YRHA 4PC1A 1J8VA 4OQPA 3WJAA 2PBZA 2YJ3A 1IBRA 5CX4A 1SEPA 4DA6A 2I62A 5CEJA 1YS9A 5EQDA 4UEJA 5C1PA 5B3AA 3W6PA 4Q0MA 4XYLA 2FTKE 2ZJ5A 4OH1A 4S1TA 3IMGA 1IHPA 4QXAA 2HEIA 1ML4A 4ZREA 2DQKA 3DWFA 2H52A 5DGTA 4MB6A 4BDTA 4O25A 3QIAA 3BJZA 1IY2A 5J4HA 1PK8A 1N8TA 2QPTA 4PU0A 3TLKA 2PWZA 1P2BA 1SHKA 3TMYA 1IBMB 1HORA 1TLFA 2PRZA 3EZ7A 4WZAE 1B15A 1T1EA 3THOA 1AHPA 3GCDA 1ES9A 2GERA 5CJJA 2B8EA 3AYXB 5EZYA 1D4AA 3H83A 2PIAA 4I50F 3EUWA 2A9QA 5BQOA 2V7UA 3NHAA 1QDEA 3OQIA 1B3BA 4BQQA 1WO8A 1S4QA 1WHSB 4JEIA 4LK3A 1YR6A 4L73A 1C9DB 2FCRA 2ISQA 1CR2A 2MSEB 1N1MA 1V37A 3AFMA 3M2TA 5JD5A 2J3DA 1I7SB 4D9GA 2OQIA 1A27A 5H82A 2X41A 4IMJB 3VHQA 1Z0AA 3I3OA 1JYFA 3NTUA 4ON9A 4RWZA 1SVLA 5C4IA 1UAYA 2AKEA 2W43A 2A4MA 2J09A 3HA2A 4QOEA 3ZDBA 3SY8A 3A6PC 1SRQA 5B2ZA 4R1PA 3FTDA 3PGXA 1QMGA 3IEPA 1T2NA 3BA6A 1PJBA 3HK2A 4FR2A 4H3VA 2UUCB 1K8YB 2BGUA 1C1XB 1I33A 3OIGA 4EHLA 5A4MS 3NEPX 1CDDA 5K0CA 2G70A 4HXGA 1P2GA 2XODA 2B7LA 1F3LA 3L7CA 4N12A 4FBLA 1OREA 4DR1B 1ZCBA 1E5DA 1N6NA 2AJTA 3MMSA 4FDVA 1ZA1A 1DBIA 1E62A 1EVLA 2V3VA 1JP7A 2ZS9A 2FZCA 1W0CA 3BMNB 3WYGA 4DQUA 3C3WA 1T9DA 3FJ1A 2R68A 4H77A 3SYMA 3KTAB 2F4VB 3SEQA 2GN4A 2GKSA 4B6JA 3NXSA 1W94A 4X61A 1WTAA 4UFPA 5LP6B 4OI0A 2VKQA 4KWIA 1ZOLA 4RGQA 3DYIA 2FZ4A 2IP1A 3MTEA 4Q1BA 1AUPA 1SXHA 1E0DA 3WXBA 4B3XA 5A04A 5BNZA 2I99A 5F9MA 2V7QD 4K9OA 1Q7TA 4MRAA 5ECWA 4GBED 3NO4A 1XDSA 4TL7A 4BLRA 2XHZA 1BO6A 3JWPA 1JA1A 3E1SA 2KM1A 3K92A 2ICAA 2PKYX 3T1NA 3ZQKA 4KOAA 1Y3HA 1GILA 2CVPA 1FMJA 1WWKA 2WHRA 2PQ2A 4FNAA 4Z8YA 1B0ZA 3NEJA 1Z7YA 3COWA 3QTLA 2MMGA 4OBXA 2ZBFA 2O8VA 4FINA 4RLQA 2AWOA 3EGDB 2YC4C 3KJFA 2BJVA 2RK3A 1QHEA 2GYUA 3M9XA 1LX7A 3DMGA 5TPZD 5CLJA 1HLDA 4LWOA 4WZBE 3U4CA 1AY0A 4AT1A 5D5HA 1MPTA 4YP0A 1QF6A 1D2MA 4JLAA 2Q0SA 5J9FA 1G9SA 1WKBA 4QWWA 2X2FA 3IV9A 3KPWA 4KXNA 5FL7D 2E6UX 4IDHA 5K2OA 3IE2A 3B1WA 5F3RA 5JISA 2HJRA 5FH9A 5DCLA 1PAUA 2FR8C 4DREA 4C4ZA 3H3FA 2A3RA 4PCLA 4J0HA 4L8YA 4IKPA 3PL1A 2EP5A 3H18A 2AEMA 1OTYA 2BBSA 3HXLA 4L7QA 1E7MA 1V1MA 4XJTA 2F9LA 4KK3A 2B1IA 4EJ2A 2Q2OA 2WM8A 5LDDC 3LF1A 4TKVA 2IBSA 2B9VA 4QWMA 1SHLA 3T8YA 5HPYB 1MX9A 2HPVA 3CO5A 1C3VA 1EA5A 2AI3A 3HBFA 2GM4A 2ZJ0A 4E5SA 3VZPA 1AA9A 2G3YA 4C4OA 2GN8A 3EW9A 2VJAA 3IQFA 3OLQA 3SC6A 4DCTA 5H83A 1TUGA 1WXEA 3BDAA 1MO2A 2Z6UA 4L76A 4K9LA 5J47A 3FFTA 4KO8A 4EHJA 3A36A 5J2TA 1V1RA 1EX1A 5E9AA 2Q45A 4M37A 4ARSA 3TTVA 1NW5A 4KH1A 5TQ0A 2GEVA 3VPHA 4F93B 3H86A 1HRKA 4BGIA 1RR6A 4XQ9A 3DE5X 5GP1A 3UMMA 4KDEA 1TAHA 1Z33A 2HFJA 4PS1A 1D4FA 5K3BA 4JOQA 1CUJA 4WNIA 2G9NA 1PG0A 3LY8A 3DD5A 1U8XX 1FUUA 4CIWA 4RJ2A 4CTOA 4ZXPA 1ILWA 2V6FA 3AEXA 3NH6A 3Q9SA 2H2WA 3MW8A 3PRYA 4G5HA 2FFJA 4C7OB 2CHGA 1SH7A 2YWCA 3KYDA 1FUEA 1V6AA 3BTSA 3ORQA 4IHKA 5CVDA 5D2CA 4CN9A 2ZRHA 3FHOA 8LDHA 2OBXA 3P27A 4Q34A 1BHO1 3VJKA 5KYKA 5DNWA 3K5WA 2J3MA 1JHZA 1QFSA 3EFHA 4O2RA 3I1FA 3RT1A 3HH8A 5CJPA 1EESA 3I8SA 5ECDA 2BEKA 5EKSA 4OJYA 2NQ2C 5FOWA 5B37A 3U26A 3K2BA 1JSZA 1NLYA 4A8TA 6ADHA 3LHDA 3CWZA 1SZPA 4KX5A 4QDTA 4WOCA 3TW8B 1V5IA 5AXAA 2Q8NA 1G21A 5K4GA 1FMLA 1DCFA 4J2TA 4YAEA 5NULA 4FFVA 1A9SA 1C7RA 1RHQA 3WHKA 2P77A 4IIBA 3FZEA 3SN6A 1R4MB 1RNLA 3M4YA 4RQBA 3C3MA 5AW8A 3SS7X 1RI1A 2I2AA 3DKRA 3H2YA 4P9NA 3VTZA 1TAQA 4G5XA 2IRWA 2YWBA 5C3MA 1JT2A 3KO8A 5B1HA 3F3KA 4ZYUA 4BNXA 1I7QB 1VDMA 3GELA 4IVRA 4MIEA 5A9RA 4OU4A 4W7IA 5EIBD 3ZY2A 5HYVA 1G3UA 4NLLA 5ALMA 1KOLA 2WPDD 1H0KA 1CNEA 4C08A 1RRGA 1TU0A 3EXIA 2VP9A 4NNJA 2P5YA 4DKJA 3NASA 3O4GA 1QBKC 3GJTA 1E2MA 5CRIA 1T5DX 1RAEA 2R8XA 5K0JA 4HLDA 3K05A 4ISCA 2F17A 1SY7A 4J1TA 2XNDD 4JJGA 2AN3A 5EY5B 4ADSG 4F1JA 2E7ZA 1QQAA 1AIPA 1CLUA 3WNZA 4MR7B 3NP7A 4C04A 2JFFA 2OZPA 2Q5OA 2IV2X 3PEFA 1ZM9A 1RYBA 2EJCA 4BO5A 5BORA 3K9GA 3NNDA 5C35A 1OV4A 4QVIA 1G9TA 3AKCA 4KQMA 5JS8A 5DO9A 5F3WB 4PXYA 5HG0A 1LNQA 5FWAA 5KBYA 1Q7CA 3SZOA 4IO1A 1RAGA 2XIJA 2Q3LA 4DVGA 4W8HA 3BWCA 3KD2A 4G4SO 1JJBA 4OFXA 4CEHA 3DVSX 1P6QA 3TR0A 4OGGA 1CCWA 5CVEA 2YMLA 1KP2A 5DIZA 4PZLA 3ZJUA 1X8XA 1K68A 2ZBDA 2Q9CA 1N5JA 2RI0A 1Z45A 3I05A 2I91A 2H4XA 2C2OA 3O93A 3CW2A 3WVNA 1IU9A 1T4MA 3HKEA 4D8WA 1AXGA 3ELUA 3HUTA 4Q1DA 4YP5A 3KV3O 1FSZA 2OHFA 4K9NA 2I2FA 4HFJA 4QUKA 5CG1A 2F1IA 2WE7A 3SAJA 4ZZ2A 3FETA 1XD2B 2OXFA 2C5AA 2BOVA 1ZW1A 1T35A 2YHUA 4AKTA 1OBFO 1GPNA 1SG0A 1A1SA 2A5JA 4C76A 4E2XA 2XGJA 3TAUA 3NKFA 3ZU4A 3TEJA 2XDYA 4MRMA 4P3PA 4AROA 2ZR9A 3AFNA 3LO8A 1MC1A 1TB4A 1KTVA 4U6NA 3KQNA 5EAIA 3AY6A 1WSBA 2Z2IA 4LXXA 3GHYA 1CZNA 3IP1A 4B2PA 3U0BA 4FKBA 4MKFA 5DNUA 3WB2A 3GZJA 3DEAA 4HKTA 3UGTA 1T5IA 3MMXA 2OGWA 4WVFA 4F21A 5J4VA 3O26A 1OR8A 3F6PA 3FUTA 1YBHA 3OMWA 2P1RA 2AIRA 2Q6OA 3WV5A 4FM9A 1B2LA 3FHCB 2Y27A 1EXMA 3IHKA 5LBUA 5HX7A 2YDXA 5HF8A 2EVWX 2XWPA 4PG7A 3BT7A 3R23A 4HFRA 3DQQA 4DLBA 3FIUA 1K6IA 3O8DA 1DQSA 4Q4JA 4JHLA 3HYNA 4FD2A 5DLQC 4BVKA 4DUGA 3M5DA 3D4PA 3DM9B 3KVYA 1U8FO 2B0CA 3D7NA 4X1IB 4X20B 1FBTA 3H1TA 3M82A 3RF6A 1U7DA 3WIEA 3CNQS 3UXEA 3OZTA 5AM0A 4A6PA 5EJ9A 1GPMA 2V9CA 1BE8A 2VCYA 4I2VA 3NTVA 3PEYA 4R1OA 2QW8A 3BIXA 3CRNA 3L6BA 4FZJA 4OTZA 5ERGB 5HUQA 3HVIA 5BY2A 3BJEA 3DFZA 3WLRA 1V3QE 5GMOA 4JLDA 4WEOA 1RPTA 4FFWA 4ETNA 1X74A 4IXDA 1EFLA 1Q5PA 1QDUA 2F2TA 4UTVA 3DQPA 5JLJA 3PR1A 2I6FA 2VUTA 2FRDA 2YV2A 3D2BA 4JVSB 3B3JA 2POQX 3STYA 3ZVRA 3VSCA 4P4NA 1JG6A 4I3GA 3A1SA 1GKIA 5F2KA 4G5SA 4Z49A 1R0WA 3GQVA 5CD9A 1Z4NA 1PD0A 2EAUA 3VC3A 3QHQA 3TJMA 2BZ1A 4R3UC 2AX3A 2ZU0C 2WWYA 1O6ZA 1J33A 4JA2A 3EX7C 2TYSB 2OTCA 5DNCA 2ZBVA 1Z8FA 2P65A 3NDRA 2ZM6B 4L0QA 3IIKA 4XSHA 1RZVA 2COEA 5CNMA 1LA2A 2FZ5A 3PGA1 4FYHA 4UHCA 4RTLA 3FPJA 5JEEA 1IOVA 2DG2A 2ZROA 4IDFA 4PNEA 3D8RA 3N2YA 3T0IA 4YUXA 2J0SA 1RYYA 5I7VA 3IIEA 2CUNA 1SBHA 2NYUA 2C84A 3L6RA 4M83A 3LYLA 1KH1A 4HAZA 4BQIA 3Q8MA 1XTRA 1OLXB 2FGJA 3IDFA 2VBCA 4KYVA 4XIFA 1UKBA 3RHSA 3TLGB 3UMGA 1N4AA 3ZCRA 2VXOA 1X80B 3OC6A 4D79A 3FSJX 1D6JA 1T5HX 2H0RA 2EGUA 2QL5A 1QVRA 3LPLA 2RJOA 4L5YA 4RL4A 3R5FA 1IB6A 4PAWA 3V1UA 3SLRA 2NXCA 4HH4A 3A3YA 1L5NA 1IPFA 5KNBA 1VG8A 3U7RA 1GRQA 3NDBB 4NDAA 3FNIA 2O14A 3JALA 2Q28A 2EFEB 3GLQA 2JFBA 3LX4A 1C8BA 4L5CA 4KHZA 2LE0A 3FGNA 4R8RA 5JG7A 3ROMA 2Z2ZA 4KPYA 3QOFA 4NPAA 5BV1A 4BQEA 2B69A 5F64A 2VT2A 3R75A 3NGXA 2OZLA 5DTMA 3FOZA 2AEJA 1Q1BA 2VKTA 5KQLA 2ZYAA 1LDGA 1XB2A 4OHFA 2WT9A 3G5TA 3L4BC 2X4DA 3AY7A 1B14A 4UE6A 1VL0A 2O2SA 2J41A 4Q1EA 3OI7A 1VSUA 2VUSA 4H4DA 4HL6A 4PZ0A 3P5BA 2C2BA 4G2NA 1Y8QA 1XG5A 2EJWA 4O2AB 1U98A 3RS4A 3NWPA 3SZLA 3U7GA 5GJVC 1SHUX 1RI5A 4QQ8A 1T6BY 4F0JA 4JHXA 2AOUA 4TTQA 1VE9A 2C4WA 2NTNA 1PWZA 4JROA 3ZQJA 4JITA 3IPYA 4XH9B 2CF6A 3EULA 2HRBA 3HCNA 3URMA 1R37A 1I14A 3WLFA 4YXFA 4DL9A 3BZWA 5HKBA 1JS1X 2QLBA 3IUPA 1XA3A 4BX0A 2Y2UA 5IS2A 2WJPA 2DKFA 2JA1A 4TMWA 3R9XA 4OJMX 1IZZA 1Z5UA 4UUPA 1W5FA 2G0TA 2QMOA 4M9CA 2N9UA 3L4KA 4DMCA 3DDUA 3Q3GE 3ET5A 3INGA 4ECEA 4W8GA 4E4RA 1A2QA 1FX0B 1NUTA 2RB5A 1BFUA 3DHEA 4Z3DA 3VYRB 3MTIA 5TPZA 2GNPA 2CB9A 3ZWMA 5FA5A 1CULC 1PNQA 1V6SA 3TECE 5BSFA 4GBGA 3PICA 5EXTA 3VR6D 4WCVA 1ETUA 2P2LA 4UBIA 2H85A 3E35A 2XX3A 3UWKA 2CJWA 2UYQA 1OXMA 3G0DA 5A71A 1NP7A 3TQQA 1PIWA 2JIOA 2X9GA 3H9JA 3T4UA 5JNWA 3F7NA 3FCYA 3UC9A 1LZKA 2QR3A 3DEYX 4BBJA 4CM4B 3ABOB 2D2VA 4HPJB 3U17A 2V4UA 3PUHA 1VCMA 1P1KA 3QKSA 4GKVA 1ULZA 3QPCA 3R3YA 4QREA 3EVCA 4UM5A 1EWRA 3IPRA 2Y1EA 2NU7B 1TT5A 3CZ4A 2J87A 3DZBA 3HDTA 2GXSA 3ITKA 3UJCA 2M9MA 4XDYA 2J3LA 3WP1B 2AFRA 1N57A 4BP8A 2NNLD 3GPDG 4FEAA 4YCAA 4XQGA 4JI4B 4P7KA 1G3IA 1G6HA 2YZNA 3F49S 4AF6A 5K2MA 3GLUA 2EG5A 3FDFA 3QVKA 1ZEMA 5BO5A 4DR3B 2I8CA 1WD5A 1W9HA 3BRWD 1KEVA 1VL2A 3N2KA 2RFLA 3FX2A 4A6XA 3PXXA 4YR9A 5JSZA 2I76A 1Z56C 1CUFA 4CF7A 5AUPB 2VYQA 1X7XA 1F17A 1FOEB 2BE9A 4JUFA 3Q12A 5ENDA 3ZC3A 4A8PA 4BOYA 2VHYA 1P5JA 1SUCA 3GJZA 1O95D 3CLUD 3NDIA 1NBME 2JGNA 2A1UB 4OL9A 4MI3A 4PZCA 1A3CA 2VK4A 1LTQA 1SXJE 1MJ5A 3ETCA 4QLAA 5FQNA 4RY2A 1C1DA 4GM0A 4BB0A 2WTEA 1NSYA 2GEBA 3FWYA 4ZANA 4EYGA 3VV3A 5BSEA 4ZU1X 4B17A 2ZBGA 2O1EA 1D2EA 3IH5A 4YI5A 3U1BA 2F59A 3P0EA 2Z6QA 2CDBA 3I12A 4D9HA 1YRWA 4PYMA 3EQ8A 2Z0MA 4CHTA 1QH1B 3ANLA 3FOBA 1G0OA 4WEQA 2VNJA 2YUTA 4HXEB 2KLBA 3BK7A 1UXIA 2H1IA 1MB9A 2QAJA 4AULA 1DBWA 1R0RE 1T6XA 3H5IA 2HBYA 3KAPA 4Y9TA 4N5HX 4JYCA 3LSYA 4RD2A 5JCJA 3RJ9A 2IGTA 5JCXA 4V2IA 1OBVA 1Y8RA 1KDYA 1LS1A 1N5KA 1YGYA 4KJZA 4ZC8A 1KE1A 2PFKA 2KBEA 1CJBA 3DTYA 1TE2A 4LXHA 1UBFA 2X9LA 4Q9JA 4LC1A 4P54A 1XN4A 3CU5A 2QTAA 4R0MA 3WAJA 1SQ6A 1NDQA 3EGXB 5DASA 4A36A 1XMIA 1GSAA 1KY3A 2C4TA 4ZCQA 3WL4A 5KYYA 4HDOB 1FNNA 3GP5A 5IJWA 3ICEA 4TKUA 5H59A 2QYTA 2QG9A 2INGX 3KAKA 5BPHA 2ZJYA 4G1EB 3FTEA 3UWPA 2P90A 3MPUA 3UKDA 4PYLA 4B7CA 3HUUA 3NXKA 4CMKA 3DBRB 4MP6A 1PR3A 4ICIA 4WTOA 3QH4A 5JFTA 5ES3A 5AUNB 5LQUA 4ER3A 3M4JA 4Y0AA 1DKOA 1KI2A 1R0SA 2QRUA 3MLEA 5FUYA 4R01A 3SZMA 1Q2XA 1I4LD 2SKCA 1TK3A 4EQ6A 4ZI3A 5KSYA 3DGFC 4HUQA 1EUCA 1QOPB 3A7DA 2VSNA 2ZUTA 3FKQA 1AHNA 2FLWA 3ETGA 2GD2A 2XNDA 3F5QA 2IWHA 1S2LA 2GB4A 2MYUA 2GEDA 4KV9A 4BS9A 1XMJA 3M34A 1LNSA 2VUUA 4LQ4A 1I01A 1N9GA 2ZR0A 3NRCA 2CXSA 3RS0A 4YONB 1LX6A 5FBHA 2EJVA 3PJFA 1HDEA 1XDDA 1P33A 3U4QA 1EUDA 2LDXA 3COZA 3N2LA 4GOKA 1VHLA 5F4BA 1M34B 4AZ0B 1KQPA 1T8SA 2EWWA 2HA7A 5FLYA 1UK9A 2GF2A 5JNTA 2J4CA 2Z9DA 3KR1A 1W87A 1WZ2A 1KPHA 3U16A 2AFVA 2FR0A 3WICA 2PGOA 3DMTA 1PZXA 2G77B 4WN9A 4ZTBA 2NQTA 1O1YA 1KSHA 3N8GA 4QATA 3ODGA 4AS2A 4XWTA 2EEPA 2QUZA 4Y1RB 4P38A 1C4XA 4JU9A 4WV3A 2ZRAA 3IESA 4IR7A 2ZXEA 4PHGA 3KOXA 4WIAA 3K6SA 2X19A 1KMHB 2MU1A 3O38A 5E9QA 4BWYA 4CKCA 4OJQA 1NV8A 5F1YA 3SC2B 3FVWA 1JR2A 1UT6A 3IDSA 1E2EA 2X3UA 3G1WA 2DPXA 5CX1B 2RHHA 5IVPA 3KOMA 1DUSA 2Q62A 4GICA 4R2JA 1M7HA 2P4QA 4IQGA 1W46A 2YZ2A 3FZQA 4YALA 2F3RA 3ZWPA 1O89A 2F6RA 2VJKA 5AJHA 1DRVA 2ZPAA 4II2A 3KUCA 4H6XA 5JT1A 3ES9A 2YFKA 4G84A 5JRJA 2VDPB 1EB9A 3N7AA 4RDXA 2OXCA 4PLPA 4TTVA 4RK1A 3FR8A 2BUCA 5DOZA 1WP4A 3TNLA 1GCUA 2B4AA 3I9KA 3V2HA 4Q6WA 4GXQA 1EVYA 4UBMA 1FX1A 3WFIA 1B41A 3D3WA 3DV9A 4FOSA 3T0GA 5KSZA 3A6FA 1B3RA 1JIJA 1O97D 1BDMA 1YQTA 3DW1X 4ZEMA 3E3MA 3A4YA 4KBYA 4PRLA 4UNIA 4C1BA 4R1MA 4DY4A 3ANNA 3U56A 1N2EA 2E48A 3LBNA 2ZJAA 3N07A 4L95C 4O0LA 1KQGA 1OHHA 3OQ1A 1K8QA 4BO6A 1YL5A 3IAHA 3L1HA 4DMRA 1KP3A 1QIGA 2WIBA 3DV0B 1GUYA 2H5IA 2ZB2A 4FYMA 3KEMA 2VTBA 4R2WA 1CQXA 2PCLA 2QN3A 4J9UE 5FBZA 3VTFA 4D7AA 2YW2A 5IBQA 3WK4A 1TTTA 3CN7A 4Q82A 2QTFA 5AXCA 4GPAA 3UWSA 1YD7A 4RV9A 5I51A 1U02A 1SKYE 1EUZA 4ZWNA 5TPWA 5BVHB 1P31A 4N6NA 4AWAA 3CJTA 2JANA 4BMCA 1ZJZA 2FSIA 3V4FA 4R2KA 1E6EA 3LPMA 3S99A 3WLKX 1C8LA 2DVMA 3R5KA 1CY1A 2FFRA 1GVHA 4QXPA 3CLHA 4NENB 4U2KA 4L22A 1W59A 4QXMA 5ADWA 1SR8A 4B3TB 4JFAA 2XNJA 4H7EA 4DYVA 4BNYA 5L3SA 1YBVA 3OLYA 3AI2A 5JRZA 2NU9A 2LPMA 2VVTA 2QNRA 4NNOA 1NNEA 1MV8A 1UMKA 4BP3A 4HQOA 4HLCA 5JJBA 1XU7A 5L95A 2VHTA 2PSEA 4MV7A 3RWOA 4HDSA 3GI1A 2YNMD 1IXYA 1T6YA 1C7EA 1Y82A 3QMMA 1FL9A 2P75A 3Q10A 3OD1A 3QQ5A 4PYRA 5DGHA 3MWGA 4ZDWA 3N8NA 4LE1A 1R0XA 3B1JA 3QLUC 4LY3A 1QYCA 5CT9A 3TOCA 3G13A 1P1IA 2PHZA 2IXAA 3LQRA 4LMBA 4WZ6A 4XYMA 5C8YB 4TL8A 3WK6A 1M2OB 3FOFC 1FZTA 4AKHA 4RMGA 3AB3A 1SVUA 3JD1A 3LPAA 4E12A 3WGGA 3MWDA 3T35A 2JRCA 2PKXA 3F6RA 2UAGA 1V9CA 4F46A 2GZ1A 2VR1A 4WY8A 3V2UA 3KKNA 1P2UA 4GPEA 1N3LA 1FFXA 2G36A 2PA3A 3NIDB 3R6WA 3BMOA 3QU2A 4B0OA 4I1PA 1YKGA 2GN2A 3OCYA 5DBIA 4Q7MB 2X15A 3IJPA 4WOJA 3HM9A 1UJMA 4WY2A 5EIBC 4U7FA 3CS3A 4GBMA 1Z5WA 5M04A 3TOXA 3UMRA 3W78A 2HJVA 2HLDA 1E2DA 4KZKA 3X1YA 4RBNA 3V7WA 4MNTA 4OQXA 3UK1A 3JQRA 4ZVLA 3GMDA 4NZPA 3V4SA 4V0ME 4V38A 2HZ7A 5K05A 2G1JA 3ZD8A 1ZJ5A 3FPSA 3RUAA 4FI3C 3SKVA 3WAGA 2GCNA 3AZQA 1J49A 3DZKA 2IYAA 4UVEA 4KE6A 4BASA 3PWZA 1U2TA 2JI7A 2X2PA 3QENA 1KDPA 3AR8A 1EI9A 4TQ9A 3X1KA 3DFFA 1C0LA 2SKEA 2IHZA 5FLXA 3KLBA 1O08A 5AKGA 4K7JA 3WAKA 4FYKA 5BMVF 1C3OA 3O83A 4A2PA 3QUBA 1M2HA 2ZIGA 4S1WA 1C1YA 4O63O 3PD7A 1XNRB 4DCGA 2ZFUA 3GVIA 3W4JA 4ED9A 1N1EA 3T7JA 5C34B 5E6SB 4DCPA 2WG1A 1SWWA 1SC1A 2CLCX 1E64A 3DXFA 5EJAA 1H23A 2I2XB 2OOSA 1BH6A 1G7TA 2PV7A 3ZOKA 3C6YA 3I2GA 2ZSJA 1ZFNA 4G2TA 3WGMA 2BKXA 5LB2A 1XLTC 1ESNA 121PA 1T5TA 1IEWA 2I3DA 2KW5A 5FADA 2QBYA 2H4HA 1YQXA 2WMDA 3KKQA 4EUHA 1A5TA 1NQXA 2QZ4A 3B8HA 3EZXA 1GRRA 1JG1A 3QZUA 1SJ9A 1O58A 2EHDA 1S02A 5CAEB 1K6MA 1PK7A 1ZONA 4MYDA 2IWRA 1U5CA 3ZW8A 2A0XA 5H3HA 2ZWMA 5JD3A 4B82A 3CVXA 1M7GA 3WSTA 3BJRA 5LQDA 4COOA 4PX9A 1C9YA 2Q49A 2D5BA 2XZDA 1T8YA 4J0QA 1NVBA 4C0XA 3P2KA 1EDOA 4KLAA 3SZGA 4EW1A 3M4ZA 3W90A 2WJGA 3X2EA 5K3AA 1SVMA 3WWDA 2IYZA 4AX4A 1ECJA 4MDFA 2DX7A 3UN1A 2BKUA 4U2GA 3EAQA 1T25A 4IV8A 4PRKA 5K9ZA 3TTTA 5D87A 1R8XA 3F74A 4NJMB 3ZHBA 1XRJA 4KBGA 3FOCA 3LDHA 4Z1MA 4BBZA 3ICWA 4RGVA 5E7QA 2PYDA 3BRWA 1TQ6A 1Y4SA 2GEFA 4URVR 3CA8A 5KX5B 2O8CA 5LU8A 5IT9A 2QSJA 2PL9A 4GWLA 4D9MA 3A3KA 1W52X 1P2VA 4IQ8A 3BE4A 4HDQB 4ENVA 1O95A 1P9OA 1PR5A 3OTHA 4NR0A 1Y7LA 1UODA 2BV3A 3GEBA 4FFRA 1FSFA 3WA7A 1EK2A 3WO1A 1IQPA 3KKEA 5F2NA 5EZSA 1GGEA 2GS9A 3NYIA 3JYOA 1Y3BE 2G88A 5FRDA 3IPAA 4BZWA 5ALVA 2UZIR 1V8BA 1Q1GA 5CBKA 1TFUA 1IRIA 2CZGA 3V1MA 2GD6A 3Q5EA 4G67A 4MUGA 3C5WP 2PUVA 4XEHA 2WJJA 1DLJA 2VDUE 3PUVA 1PKXA 4JDUA 3K8ZA 5DMXA 2PFGA 1KK2A 4AKSA 4ZVNA 1WE2A 5SYNA 3TSZA 2IBTA 2WJHA 3HB7A 4O29A 2G4LA 5CLHA 1X1SA 4UULA 5DM4A 3M1AA 3AJDA 5E1OA 3EN0A 3LH5A 5A7GA 3T99A 3VNAA 2QU7A 4N3BA 1G8SA 3H42B 2FPWA 2KWIA 4FXPA 2BCEA 1XDWA 1ODJA 1MR3F 2DECA 2UZ3A 3A37A 5MN5A 1J2YA 4C4AA 3BTVA 3CLVA 1UFQA 2H9IA 1AQNA 1QVWA 3LQ2A 4DLXA 4GL2A 5DYNA 3JPWA 1O77A 1PW5A 3BHJA 3AHFA 3D2LA 1TUBA 2Z4RA 3BC1A 2YHBA 3N58A 1QO0A 2PBLA 3LBYA 1IQRA 3RVKA 3AFGA 9ATCA 5B30A 1IZ9A 1RAHA 2Z3WA 3KSRA 3H2IA 3ZKWB 2E4ZA 2VRBA 3X1WA 4MGYR 4Z9YA 1YCFA 3QVWA 4I46A 4IIGA 5A2GA 3VKHA 4CKWB 3OJXA 3H17A 2VT3A 4Y6QA 1WUJS 4QPCA 4CM1A 1OF1A 3WZ2A 1JIUA 4W6QA 3M6UA 4ZT5A 4KZPA 1GLVA 2WAAA 1ZICA 3JQFA 3PUJA 5GADl 1V96A 4MUMA 4UAGA 5U9CA 2PWYA 1S8NA 3PUYA 4B84A 1KWGA 2IS1A 5HQTA 2FFHA 1LBHA 2KYRA 4LJ6A 2Z83A 3O31A 3WKAA 3C4JA 2FDCA 4Q7QA 1FS5A 2HJWA 3QLJA 2HU5A 4WBNF 1L4UA 3SYKA 1NF8A 1TEHA 2CXUA 2P6RA 4TYYA 4NBLA 4TRMA 3MWEA 3AKEA 3NI2A 4B6SA 3HXTA 1RC1A 2HA3A 3OU6A 3CF6R 1QFJA 3JD0A 1G20A 1UBSB 3EXHB 3LHIA 3K9WA 3QOWA 5HIKA 4RUKA 4GI5A 4Q1FA 4X97A 4RVNA 2ZYTX 2FSUA 3TLBA 3K0BA 2GCIA 3MGCA 2OV1A 4IGEA 5JYEA 1ZN8A 3AJRA 4F1KA 4F2DA 3GLIE 1XX6A 3BL6A 3LX5A 5DGXA 3WJ1A 3DT6A 3HU1A 4NYJQ 1YZLA 4JJFA 1TGVA 2OCBA 2Y9PB 5JE8A 3ZTTA 1PWEA 3AM5A 4BQFA 4PN3A 1GYQA 2RKWA 3DB2A 4HB3A 5IANA 3NX4A 1MKYA 4DGSA 1OX4B 2FSVC 4OXYA 3RG2A 1RLOA 2ZWOA 5EJ5A 4RAOA 1WCXA 3LUBA 2CMDA 2X86A 3E48A 3JQEA 4O5AA 1JJVA 1FVOA 3RBXA 2GN0A 1GPUA 2AB0A 1MC4A 4KPEC 1JV2B 3KSUA 2OV8A 1AUQA 1YDWA 1Q77A 3U13A 1B76A 5K8JB 3DJFA 1UT5A 5CVUA 2QTRA 4DUYB 3EVBA 1ATZA 3A04A 1X13A 2FMXA 3FUWA 3KK0A 4Y9SA 4ZRDA 3VO1A 4CEJA 1LC3A 1XP5A 3L8MA 3R0ZA 1F8FA 5JPCA 4IDCA 2IZ1A 3CURA 4YMLA 5EINA 2WKSA 4IILA 3DKVA 1P4GA 2HLPA 1OU4A 2QIPA 1UJCA 1R66A 2W5UA 2V5UA 1IWPB 3DDCA 3DM5A 4M86A 5HBGA 4BNMA 4E09A 4N9QA 3HC7A 1DBVO 3HA7A 2XTJA 3Q7TA 4XFDA 1PSDA 5FWXA 3GLGB 4GPBA 4JQCA 1AN0A 1CT9A 3K0CC 3L7OA 1Z7BA 2CXHA 4NCAA 4H4EA 2G6TA 1K7XB 2QRPA 5HJEA 4LFAB 2Y0DA 4NFSA 5TQVA 4BQRA 4BE9A 4M22A 2Q5EA 5EHNA 2FJPA 4FEEA 4LZAA 3EWIA 3QBVA 1JQAA 1NE2A 4LWZA 2WTXA 4JLVA 4YCDA 2W6ID 4E1AA 7REQB 2DEUA 3H2BA 5MHTA 3CMCO 3S1LA 2FGKA 3U7QA 3H65A 4MVJE 1G8KA 2EGHA 4G23A 1C0IA 4RELA 3GWZA 4QOFA 4R81A 4RZIA 3L06A 3G5UA 2W11A 4GZLA 4LSZA 1RJ9B 5H3LA 4C1NA 3N2GA 2VYVD 4IH1A 3V3KA 4RF2A 4ZVSA 5D86A 1N1GA 3JS5A 4MDEA 4GRAA 3OHPA 2IEDA 3JQAB 3TBHA 1ANKA 2ORVA 4C3OB 2PZKA 3VSEA 3V8EA 1O95C 3CLUC 4ZMSA 2WWTA 4KC0A 5BQFA 1AMUA 2BIFA 5BVGB 4KXYA 4GOOD 3BXFA 4G36A 1VA5A 1UUFA 1ZGBA 4AK9A 2O3UA 3PVCA 4OB6A 5DN6D 1LFDB 1LI7A 1PDVA 2D4AA 3S4YA 5JMTA 1A7KA 1ZAKA 1UQTA 4BLTA 4CWAA 1VMEA 4DJFC 3L02A 1BEUB 4RKQA 1N2GA 2CFCA 2OY0A 1WBDA 3G82C 3BGVA 1NI4A 2Q46A 2VAXA 3LUGA 2I87A 2VNIA 4A92A 1H1LB 2Q0QA 5AJXA 1DRWA 1O8CA 1RBYA 4U6QA 4DQ0A 2H31A 3AHEA 3GA5A 4IF6A 4W5QA 4U63A 3OX1A 3PRKE 1PJ3A 4W6ZA 1C30B 2JLSA 3KQQA 3VO2A 1RSZA 4N7MA 1ULTA 3Q9UA 1DVRA 1R9NA 2LD4A 2H07A 1MJHA 3C87A 3GOQA 3IQIX 4IHQA 4U8HA 1KBOA 1X7ZB 2O8NA 4WXPA 3T0FA 4TTTS 5LB4A 3W05A 4OAOA 4FEYA 3HFJA 2HB6A 2OYRA 4TMKA 2O6LA 5IKEA 3IJ5A 4NG4A 1YR9A 3M4XA 3UT5B 2IDKA 1RRPA 2P7HA 2XCOA 3T3IA 1IIRA 2OOKA 1L1FA 4KQKA 3ZGNA 5JH7F 3FDIA 4DNXA 2AZMA 3T5TA 2EKDA 2IDMA 2VH5R 5EJ4A 4BRWA 1Z2DA 1VIDA 4H7FA 1KKUA 4LSWA 4HLUA 4XOIA 4DSZA 1N36B 5A0TA 1UOOA 4RVFA 1I94B 1PS8A 3GP3A 1TM7E 2RH8A 2B4YA 3T9BA 3WQHA 2FX5A 3ND6A 1NVVQ 4HBGA 3ER8A 1RLJA 3BGOS 3GIWA 5JQGA 2VJNA 1U2EA 1CUVA 1TEVA 2DBZA 3AF4A 5EI5A 2DRIA 2NNWB 3STUA 3U6KA 2VHVA 1K4KA 2D3WA 4MW4A 2KJQA 2MSWA 3H11A 4R40A 4X65B 2E1PA 3WGKA 5FDFA 3LBFA 2PUWA 3LP5A 3PUXA 5G40A 3JAKA 5ALYA 3N2ZB 1RD4A 2JI6A 2J4DA 4OOEA 2XYVA 2B20A 2GRUA 1ZM2A 2BKEA 2ZRPA 3ADKA 3EOAI 3MT8A 4GPZA 3D4BA 5D8DA 3VTAA 3HA5A 3CY6A 2HK9A 3ABZA 2QEQA 4ES6A 2FMTA 2YOHA 3JWIA 3GY0A 1T43A 2O23A 2YWRA 3PXBA 2P4HX 1Q0QA 1LB1B 2W4IA 4HZGA 2P3OA 1BVYF 4JP3A 4UFOA 2GJAA 5HIAA 3NBFA 3CNOA 4F4UA 1LDYA 1OTHA 1CZRA 4NL4H 2XZLA 5AM4A 3OZSA 4YAFA 3GVHA 2PLRA 3RAEC 2QN6A 4F4IA 1FDRA 3BMCB 4KK4A 4I6JA 5FPTA 4AY6A 5HKOA 3CRVA 4U9UA 4PN7A 1XJWA 1WXFA 1WCIA 2Z30A 4Y2QA 1A1VA 2GJ9A 4L7VA 4CIXA 1JVSA 1BDBA 1UPTA 2PPVA 2YQ4A 2QD1A 4UEKA 1RQPA 4XE5A 2DT5A 4UUOA 1GT91 5CW2A 3C6MA 2ZT6A 1YUBA 4JI1B 4IG4A 1Y1LA 2BONA 1EUYA 3LT2A 4XGKA 1KOGA 5IWAB 1CR4A 1R3DA 1L8XA 3IUNA 2BUAA 4OYRA 1A9ZA 3DJYA 1DC6A 4HAXA 5D5PA 2ORED 3T7EA 1LLCA 2HBRA 3G0BA 4ENWA 4UNNA 5B3KA 4ITVA 1QWOA 3CONA 4LJAA 4LZWA 3WLAA 4Q05A 4Q39A 2F55A 1SU6A 4E2ZA 1KOJA 3ROFA 3H04A 2OWEA 1UJ5A 2B61A 3BRQA 4H16A 4RIIA 4LXQA 1E9RA 1K2VN 3GH3A 1WETA 3L92A 3H0EA 1HURA 4RJJA 2IEAA 1N5DA 3B6MA 1XWWA 5DLPA 1LBIA 2CKDA 5DHTA 5F7JA 3RHFA 1C3EA 4MUKA 1X38A 3WLJA 4H0FA 1S9HA 2GZ2A 3P94A 4QYSA 4UTZA 4EMTA 3BXGA 3OZXA 4GE0A 5IULC 1ENZA 4X85A 4D0GA 4TVBA 1JMVA 1A8PA 1L7RA 2IE8A 1IUKA 2OSBA 4R0NA 4JP8A 5ALWA 3HCFA 3K6RA 2BYTA 1ORIA 3MRTA 2J9RA 2GJ4A 3O82A 5EUBA 2DFPA 3RSFA 3RIEA 1U2SA 1DTSA 4GYKA 2OWDA 1WMEA 3KYCB 2JH8A 2HGZA 3H8JA 3SS9X 2EV9A 3Q6MA 1V5FA 4J0KA 2OXRA 4M8KA 5LP6F 4HSGA 4LXYA 4D3YA 1KEUA 5BR4A 2PS3A 1BWQA 1ZD9A 3QU9A 2VDMB 1RTTA 4F3TA 2I6XA 4OXQA 1U4SA 4PQFA 2WWVD 3DDOA 1B16A 3COJA 5CFQA 4EELA 4EKEA 721PA 5JASA 2Q3CA 1BXGB 4H2DA 2F64A 1FFYA 1DAEA 3OETA 1CX9B 4HMOA 4EFDA 4TWAA 4MGHA 4KR3A 1VSBA 3KUKA 3UY4A 2Y6VA 3PXEA 4RIHA 2CD9A 2GESA 3E7PA 2WIFA 4GSLA 1EBFA 1R0KA 2Z56A 4IH4A 5HTKA 1Z0UA 3KUUA 4GECA 3GGPA 3R0QA 1KI9A 4YCBA 1OH6A 4DCNA 1N3IA 3RV4A 3DO5A 4LECA 4U2EA 5ED0A 2EU8A 3WK9A 4PSDA 5KVAA 1TM2A 1TF5A 5BMVA 5LZ9A 1XTIA 1UWKA 1A9PA 2GYVA 1LV8A 4AG6A 5JCOA 5FTJA 4B3GA 2YNMC 2XDAA 1RHMA 2R1VB 3NTLA 4U0JA 3TMAA 2RG1A 5AKLA 1W96A 3QKIA 1ZHHA 1JQ3A 2IVZA 2C7PA 1EVZA 1ISJA 5FT9A 4GXTA 2ZPTX 4EKIA 1LD3A 4HFMA 4LMAA 5T4FA 4PZEA 5AJYA 3IMKA 1I24A 4HS4A 2A4KA 3RYTC 4X71A 4WN3A 2IH5A 1X7DA 4CCYA 1WD7A 3OZ7A 3Q8LA 5AOCA 5CK4A 2HNKA 1CVLA 4N8SA 5AW5A 3J7AC 3GV0A 3LBIA 3ZCXA 4UUAA 1NNLA 2C3MA 4HLUC 3FWKA 4RZUA 5BNWA 2Q7OE 2APJA 2FN9A 2VUHB 3A1NA 5EE5B 2PS1A 1Q21A 1DCMA 4DIMA 3T5BA 3RS2A 4B31A 7ABPA 5DEIA 1JEYA 1WOYA 4TYWA 1ZRMA 3H4VA 3BIOA 4CXMA 1ZIPA 1E3TA 2FG7C 2LDBA 2ALJA 2R66A 3G89A 4FGUA 2WJIA 4D8VA 3C6QA 2BFCA 3ELYA 4ZAXA 1XRPA 3RS7A 4AJ9A 1QV7A 1APBA 2HQRA 4O4IA 2B6NA 1U8CB 2P5TB 3OT1B 4IUCS 5B6IA 4ZK6A 1GDDA 2V7BA 3BG5A 2OHIA 3HP1A 3OOWA 3TRDA 3PXAA 2Z1DA 1X19A 4IDEA 4B3BA 4RFLA 3ZU6A 5LPNA 5AIBA 3TLCA 1O5OA 4W4TA 4HVAA 2EDAA 3DL7A 5KI6A 4TVOA 4E22A 1R16A 4F6CA 4Y30A 1W6UA 3G2MA 1Z0KA 1LV7A 2WQ6A 4S3MA 3IP3A 3SF8A 4P3XA 4B3JA 1DX9A 3OJLA 2WU1A 3CO0S 1TADA 3ZS9A 3VNRA 4AU1A 1YJBA 3C8ZA 4PO3X 3VI4B 2PFSA 2C4KA 3LXRA 3BKWA 1QH8B 1ZX1A 2Q1WA 3PC3A 3TI9A 1DXOA 3T9AA 3ZHXA 2XYRA 4E2WA 4EUNA 5ADUS 4HGYA 1UWCA 4OP2A 1T36A 2G17A 4P5EA 2Y77A 2P3QA 3QWFA 4FLEA 3EVAA 4RF4A 3TLJA 2COKA 3RSLA 4CL8A 5J23A 1L5KA 1UIRA 3KM0A 3RF7A 3HPRA 2VQFB 2Q3MA 4HDNB 3FCAA 3VYSB 4ZQGA 4CR8A 4LGCA 4CF6A 1VI2A 2H4JA 3OHMA 1LK7A 4TVKA 4FMCB 3WGUA 3U80A 1DC5A 1WABA 3CH6A 2QTNA 2DR3A 3QVVA 2CBZA 3GDHA 4M3NA 2OA0A 3SOZA 2QRVB 5J1TB 2F00A 4ZEXA 2XAAA 3EQ7A 4P7JA 3FWHA 3EF3A 4FNOA 1ODCA 1TM3E 1JPUA 1DUVG 2QQ0A 3HB1A 5AI6A 4Q3OA 4F4HA 2P9JA 4RA6A 4YDQA 1MHTA 3ZLJA 3KJEA 1W2WB 1QUFA 2JZCA 4V39A 1HQKA 1J56A 3DXYA 2IE0A 2PMDA 2AXQA 1KO7A 4NP6A 1NF9A 2V58A 3R2JA 3P20A 2GJ8A 2WUWE 3TO5A 3QFSA 5ALSA 2J8ZA 2GASA 4YUVA 1O0BA 3RYIB 2IA5A 3NNSA 1IY1A 2PWBA 5D1NA 3W8RA 5CD1A 1PV1A 5KMGA 2CLDX 3AXTA 5E1BA 5HFNA 1ILEA 3SWWA 1U7WA 3NKVA 1U2PA 3E1KA 4D92A 4J2HA 4PRZA 4Q9IA 1SUWA 4N47A 3W8NA 1W44A 4D8XA 1TMYA 3HWSA 4XI9A 3NBQA 4NV1A 3QUSA 4P31A 4EF5A 4QICA 5JFGA 3K0AB 5DHUA 1DZ3A 3QG1A 1NP6A 1F51E 4LYFA 2JDID 1L7XA 2XUOA 4BKRA 4OHKA 3EBLA 3V8NA 5ITSA 1BRTA 1ICIA 5DV9A 1ECBA 3ITEA 5AW7A 5COBA 5DTQA 1XFAA 4E1BA 3UMCA 3PKJA 2JD2A 2FMIA 1GZDA 3DVLA 1N6OA 1PZFA 2G82A 1ZCAA 1GY8A 1CUAA 5A5GA 3YASA 2F1RA 2HFKA 3HO6A 4G5GA 3NAGA 2WFAA 1QYIA 1ESDA 1FRNA 2XD9A 3FDZA 2YY7A 2WFMA 3ICCA 4LNAA 1NA5A 4DYHA 1ZHOA 5HKLA 1DTEA 4KRGA 3T5GA 4DMGA 1M0WA 5B1IA 3L7LA 2FEWB 4Q3EA 2P9CA 3KLMX 3H5VA 4KDCA 1J0EA 1F0KA 1PZGA 2QMUA 2GTHA 4IFBA 4UHKA 3SD7A 3V33A 3VH1A 4A1OA 1GSIA 1KYXA 4EG7A 3OOSA 1OB2A 3FLEA 4YT8A 4F86A 1NMZA 1LLDA 4DZTA 4X8OA 2DT8A 4H17A 1FXSA 1ZNQO 3PDWA 5LA6A 5TRTA 3RC2A 2WDPA 1ENYA 3SZUA 3ZW7A 4Q1CA 3NBUA 4BQSA 5JCOC 4X63A 1N5LA 1B8OA 5MN6A 3K6JA 2ADOA 4IHJA 1V48A 1THZA 3ZCPA 5IARA 3ZGYA 2XV1A 1AV6A 3DBOB 4I4TB 2FPUA 4RHYA 4E5YA 1FY2A 2QTBA 3MLBA 5IAGA 2SICE 1KMMA 3AM4A 3NHZA 3VISA 4NCBA 4YO7A 1A98A 3RD5A 3C4VA 3NUQA 3EGCA 5FLEX 4V24A 1KHTA 3LQ1A 5GGXA 1E7RA 2Z8XA 4PPFA 4G0NA 5A5FA 5I7EA 4G56A 2BEWB 1K66A 2F8SA 5FWNA 1L5HB 3CGGA 4J7CA 1KAOA 2LKCA 4JXXA 3B9RA 3HUEA 1MT0A 2G9ZA 3H8WA 2C83A 2FPGA 5EJ8A 3JAMA 1QLJA 4ZODA 4RS3A 4HI0E 1BCRB 2X0RA 3L8FA 4N9WA 5BN5A 2JGDB 3QF7A 1E2UA 1GA4A 1CXZA 4WK4B 1JLLB 3AEUA 1WF6A 3UK6A 4K0KB 5JCJD 1SHJA 4GLBA 4IS2A 3CW8X 3ZHRA 1JHMA 2CXTA 3R9IA 1JPJA 4L3WA 3VHLB 4OG2A 3EDOA 1A5ZA 4KIJA 1ZAYA 3WGNA 2HCBA 3MGGA 1U0BB 1QSGA 1N5OX 3MTBA 5BWLA 1BNCA 4PPNA 3M1YA 3SEZA 3W77A 4J8PA 2IZZA 4BC0A 2BT4A 3DG9A 3INNA 1W4ZA 4DDTA 3TQHA 1TYAE 4HQNA 4EIWA 1ZM4A 5FORA 1VLMA 2WKWA 4RKEA 2WOJA 5BUCA 4WZAA 2R9VA 2UZ4A 2YVUA 4JQOA 5COAA 4LYAA 1BS1A 3AHGA 3LNTA 4FBGA 3W9YA 1FLVA 5HQ3B 5C8VA 1I7PA 4EP1A 2ZSAA 4M8IA 4TRRA 1E98A 4OL0A 4U9IS 1ZJYA 3ZWWA 3ZW9A 1AKQA 1VE5A 2RHWA 3TH5A 5K51A 2B0JA 2HV9A 5JBIA 1AMNA 2G25A 3GFRA 4RJTA 1O57A 3DE0X 2J7KA 3T7IA 2XQFA 3NYQA 5TLSA 4PINA 2KMLA 1NUSA 3PC2A 5C5IA 2XVXA 5JMPA 1EM8A 3ZX5A 4WBXC 4ZI7F 1EVKA 1OXBB 4M8NE 3VVLA 1XF9A 3BE6A 1JDNA 2YBEA 5IXYA 3C4QA 1BC5A 3LPCA 3IFSA 3KKOA 1ZS9A 4DMUB 4Q1AA 1GSHA 3AYZB 5I8ZA 4LHZA 1HWYA 5SY9A 2GBPA 3V6MA 2XWQA 3HEAA 1AQIA 2ASVA 2VK2A 4RV5A 3VC1A 4R51A 4EDHA 4DDVA 3FPHA 3LLSA 2A9KA 3A7EA 4YRLA 4ZT3A 2HHCA 4JUAA 1YC5A 2XUAA 4QHTA 1XL1A 1NL3A 4B4WA 3T1HB 1DADA 4NJEA 3RNOA 1U0GA 5JH7A 3FMGA 3ZI0A 3UK2A 1QG2A 1RE1A 2XCLA 2P9FA 3WHLA 4WBSA 1IONA 1PL0A 5EYPA 3T7RA 2HIHA 4GLLA 3I6ZA 2PR7A 1ZOOA 1J7JA 1LRJA 4WLOA 3BA1A 1RWKA 1POWA 1ZD4A 4K8OA 4AQDA 1KQOA 3X1XA 4DA8A 1SC6A 1EHIA 2H54A 3K3PA 1ELOA 2C2HA 3NHPA 3H87A 5MN4A 1G5RA 1MAHA 1GKYA 3ZHZA 1YL7A 4MUBA 3EXAA 1NR5A 3GFOA 3QA3E 1FJXA 4EI8A 1VP3A 1NXQA 4DMKA 4URXR 2C88A 1USGA 4DT1A 4Q4HA 1ZUWA 1IHUA 4KQEA 4I5DA 4MMZB 4ND8A 4TX1A 2XZTA 3ZGXA 4KR7A 3AUUA 2R5FA 1E5LA 3NVMB 5KTRA 3FN4A 3K9HA 5EESA 4TXLA 5GM1A 4B32A 2JB9A 2VTEA 1MG0A 3FPBA 2FDRA 2QIOA 1YRLA 2Z98A 3MSCA 4FMBB 4PSKA 3OZDA 4IPTA 4XJXA 3TVYA 3HWRA 5GZ1A 5CYOA 1N7IA 1WMDA 3HJRA 3II6X 3OUUA 2WJZB 2IZ6A 1FP4B 3MOGA 1HK7A 1MOZA 4AJEA 5HS4A 3NR2A 3BH0A 3L8GA 2WFZA 5FJJA 4B83A 4KIWA 3UCXA 2OGZA 3B85A 3CYFA 4Q7KA 5I8WA 3IO5A 1I0IA 1BS9A 4V0NA 4C0BA 3F7TA 3GK3A 5JO0A 4URFA 2C07A 1DZIA 1KC1A 2AR0A 1VHTA 2XJ9A 3PNKA 5K0BA 4DR6B 1WMBA 3VMFA 1SULA 2QVCA 2DBQA 3FLMA 3L6OO 4RD1A 5ADHA 1C9KA 1NFQA 3QELB 1M8FA 1V7PC 3RS8A 4MJ7A 3TRIA 1TVKA 1LPPA 4F8EA 4JJZA 1ZXBA 1U2DA 4PHHA 1H4QA 3DFKA 1MUUA 1FFGA 3JSXA 2Z1MA 1QIHA 4D82A 4F6RA 1MQ8B 3IHLA 2E2WA 3ZIAD 1NLZA 2FPIA 2GEUA 5ILQA 3U40A 5A3VA 5IZCC 4D4MA 2D5CA 4IKEA 4AMBA 1KIAA 4Z86A 2Z5GA 4R3NA 3BIJA 5T5QA 1I10A 1EXDA 2VPXA 3N3AC 3HXMA 3NHRA 1VI5A 3AEQA 1DBPA 3DUFA 3OZRA 4F3RA 1E4EA 1G8JA 2J3HA 2PXCA 3OE1A 4XVRA 3W5DA 4PE5B 3PZRA 4LNUB 4M89A 4PQEA 4EECA 4OHPA 4G0WA 5KJ6A 1FDTA 4MAAA 3I6MA 4TLMB 5B6JA 4FYXA 3GRVA 3MNFA 2VJYA 5C3UA 3SDSA 5IHXA 4CQMA 2HNBA 4FJ2A 5CDGA 1P18A 4RVOA 5BN3B 3QWBA 5C1OA 1WX1A 5IXJA 1P7CA 3W9BA 2VUIB 3JWEA 3AUAA 4O2BB 2FMHA 4XYBA 3RJTA 1E79D 1OC2A 2BTOA 4MMXB 5LWHA 1FDUA 4ND4A 1QFMA 2JG3A 3HXOA 5HR5A 2PT9A 4QJIA 4KRYA 1TAGA 4G0QA 2X8WA 3D3NA 2QJOA 4ZXFA 5HXAA 4N3GA 2P40A 3QSYA 1GCIA 3UMBA 4ZYWA 3HR7A 4H7KA 1RPJA 2XCRB 3CSUA 3OTOB 3A9CA 1T0UA 3IJEB 4FUTA 3C8UA 2FEAA 4LMRA 3B20A 3HCBA 1AN9A 3SM3A 1WVGA 2JGEA 3PLAE 2XQGA 3H4TA 3QW4B 1X15A 4K40A 4ID3A 4P3KA 3H05A 4L78A 4I55F 2ZJ2A 3HHEA 4F97A 1GCOA 5HCNA 3WGVA 1SUAA 4MQ5A 2IYFA 3ZDAA 4CV1A 4I5FA 4RMJA 2A5FA 5FB3A 4US1R 3BRSA 4ZT6A 1M2NA 1NXPA 1WZIA 2FFAA 4W9RA 3T5PA 4C20A 4ZVVA 3VR0A 3PNQA 2GETA 3N7UA 3L0CA 4KAXA 1WZNA 2ISSD 4LUCA 3ZWKA 3TQCA 1UDCA 4YJFB 1EP1B 1T2DA 4B8YA 3EISA 4UTRA 4HEHA 2X14A 1PI3A 2VAPA 3D1JA 4KW7A 3ZJVA 1H0RA 1XP8A 3R4CA 4MINA 3ZTWA 4R1LA 2XQIA 1Z75A 4YP1A 5FOTA 2H5JA 3E03A 4F8YA 3BDIA 1Z6AA 1KHHA 3IVRA 5HF6A 2Y1OA 1BMDA 2IW3A 3I28A 1AURA 3HNOA 4PLCA 2DCUA 1JG3A 2XIQA 1I5OA 1VLQA 4IIVA 1RWMA 2ZQ5A 4FGJA 4JLUA 3E22A 2YZKA 2DFLA 1I0ZA 3NDPA 5DKFA 1R6BX 2P9YA 3KSMA 3UHJA 1RYFA 1QC5A 4GLJA 2VATA 4L3OA 3DULA 4J0FA 4FGLA 3T34A 1KMCA 2R44A 3R8XA 4HF7A 1LBQA 1RBMA 2E87A 3MUEA 2ZYHA 4QUJA 4XUEA 4FHDA 1B7GO 1U7OA 4ZVUA 3FPGA 5AFSA 5IT5A 4FX5A 2B5OA 3QVSA 4K6HA 2NVOA 1ZRSA 1WDWB 3HNPA 1P1JA 1DI0A 3C0KA 4XYGA 1UBEA 3BFPA 5CFRA 2HRDA 4M9XA 1WXQA 1HOXA 3DWIA 1OIVA 4HGPA 4AVYA 4DN6A 4MR8B 2P27A 4RHXA 1VHQA 2PKQO 4D02A 2DHQA 1H65A 3BX1A 4L2IA 1T2AA 5KSPA 1D03A 4Z53A 1MA3A 1KYQA 1IZ8A 5I9NA 4EUFA 2FUCA 5IAEA 3IEVA 4M9ZA 1OWNA 2VSQA 2XQKA 1GVNB 2H6EA 2WSIA 1W76A 4OMCA 5EHZA 4W9NC 1FTQA 2FWRA 2YJ5A 2ZVPX 3C45A 4G6ZA 5L3VA 5FI5A 5BOSB 1F14A 2HADA 4C7BA 1C29B 4LVOA 1JTFA 1F48A 2F1JA 1W4RA 3K9QO 4OIFA 4WI1A 3TL6A 8OHMA 2I66A 3EDCA 3TW8A 4PIVA 4M46A 1PJAA 1YACA 3S6JA 3CUSA 4D45A 1QWSA 3MQ2A 4IXTA 3FLAA 2BFNA 1R4MA 4LBYA 2ZBUA 4Z8XA 3T9CA 2XMRA 1P60A 2DHEA 1B74A 2PLFA 3KOZA 2OP0A 2R7KA 1WPXA 2RARA 3G88A 1Z73A 4H0CA 2XTAA 4REQB 5EXEA 3EHDA 2PPLA 3D7MA 4XQCA 4UVDA 2F3PA 3ZE6A 3TM4A 1H4TA 2C0PA 4QGGA 4NICA 1U2GC 1U0OC 3H16A 3QF4B 3LY7A 1Y3CE 4KXMA 1ULUA 1I36A 2ZEJA 3H8SA 4RZQA 1VG9B 5CDFA 4ZYLA 4YAJA 1GG2A 3H9CA 3UICA 2G8LA 1EFRA 1MAWA 2IPAB 1J9EA 5JNVA 1J8DA 1HQCA 2JC3A 3GB9A 2VDLB 2QRGA 5JV5A 1CDEA 4PGHA 3MINB 3ELDA 4EZEA 4F7WA 1K5PA 4PNHA 3A6DA 2GX6A 4XB1A 4ZVOA 3K09A 3RTAA 2VWGA 3K15A 3KQVA 1GZSA 3OLCX 3EVDA 1CZHA 2NSJA 1U31A 1CBUA 4Q93A 3LBHA 3NOXA 1FSGA 2OCGA 1TU4A 2A7QA 3FPAA 3D3KA 3RK0A 3FFAA 2XYPA 3PC8A 4J90A 4E11A 4ZJPA 1VIAA 3I83A 4JR0A 2VIIA 2ZOSA 1E0JA 5ESXA 3TPZA 5T3YA 1FBNA 1ORHA 1WQ3A 3CF2A 3G2OA 4RJLA 4XVHA 5FTWA 2FFQA 1F7UA 3FBGA 4P5DA 1QQTA 3AC0A 1OI4A 3CNHA 3KEQA 3O91A 2NWQA 2ZE8A 4HHEA 4I81A 4JASB 1P1CA 4L5IA 5LP6C 1TYEB 3I2YX 4PYJA 5HA5A 4MYHA 1K5DA 2D0PB 2X5XA 1XRQA 1YQQA 2FPOA 2VCHA 3W2TA 4L16A 3QFCA 2FZVA 4HP8A 3RYFA 3MOSA 3C3DA 5BQ3A 1FP6A 1W4BA 2JIZA 2ACWA 4Z99A 1IJEA 1Z5NA 1CHNA 1SCIA 2XYGA 3LX6A 1WHTA 4G5YA 1EA7A 4LY9A 5E3IA 3Q3CA 4HQLA 3N3BC 3KPJA 1J70A 1NQWA 5DP2A 2X2EA 4HVTA 1Y6JA 2WJ3A 3E8XA 5DRTA 1BKSB 2V9PA 2ERCA 4QSMA 4CCAA 1T9AA 1RACA 4DDWA 1CC1S 1LTKA 2QOEA 4EMSA 2OPBA 1YE5A 2A9FA 3PFWO 3T3MB 4K86A 4KI0A 5ICMA 2GXUA 1DKLA 3NKLA 5GZ3A 1HEIA 2A35A 3AG5A 2HOQA 3G2JA 1AUOA 4GYYA 1JLRA 3ROEA 3X1DA 3FWNA 3H1AA 1Q17A 4MLDA 1L7NA 1TIPA 2IKSA 5C52B 4WCFB 5HM6A 4NZYA 4IIYA 4XWGA 3IB3A 5B4TA 3GLGE 2D8AA 4FZRA 4IV0A 3TDNA 1MORA 1LPSA 1GPH1 1P0CA 1X77A 2GKGA 1L8LA 3EDYA 1M2EA 2FX3A 2P9BA 2ZU6A 1N75A 1RWXA 3TB6A 1UM9A 4EARA 5A5EA 2OQ2A 1UXOA 2FETA 4K9KA 3VFDA 1GZUA 3JYQA 3PHHA 3RS5A 1NPYA 3EZ9A 1JILA 1Y98A 2AS0A 4IEEA 4BNHA 3E3AA 2ZYGA 1DV1A 3JARA 3VHXB 3RS9A 3WLIA 1JJAA 4G65A 3OU2A 2C7RA 1K3UB 2VAVA 4XX0B 2GCEA 4UASA 1X7WA 4CT4B 4E13A 5CYFA 1HF3A 1QHHA 5DXFA 3TXYA 1OYWA 1G8HA 1P4HA 4GD3Q 4RQTA 1I6WA 1NW8A 3H5TA 4PC2A 5KJ1A 1HL7A 3SR4A 3JU3A 1U4NA 1UBOS 3I76A 4PC3A 4BMVA 4IDAA 2PU5A 3JQ8B 3PVZA 4CKXA 3AERB 1PQPA 3WK7A 2YIMA 4Z4HA 1DMSA 2FG5A 3GARA 1CJSA 1L7BA 2GHTA 4ZGGA 4BNLA 3C1AA 3T4XA 4I14A 3HN7A 4GSYA 3ILSA 1N7JA 2GPJA 3K9BA 3F46A 2G06A 2HZBA 2O2YA 1XTUA 3NC4A 1ZNWA 2X7JA 3VQTA 4KRFA 2XB6A 4K0RA 5KOIA 4X24A 4QQKA 4ETMA 4F2GA 5KAPA 4C2TA 1A9YA 1QTRA 1CDZA 2CLOB 5CVVA 2B5VA 2W90A 4ZCTA 5GVSA 3FVQA 5E9WA 2AF3C 5EPEA 4LXGA 5ETJA 3S8YA 5A1TA 1QK4A 3GJ7A 4UMVA 3BIWA 2JK0A 3KT8A 5HJ2A 1H5QA 3BL8A 3MM4A 4N5MA 1EX6A 1TTPB 1NI5A 3L4EA 4NZZA 4L0DA 4A1FA 2JI9A 3Q72A 3L7AA 1QYVA 5J3JA 2OLEA 1OLXA 1QGUB 2YXEA 3TLGA 3VI3B 3X43A 4A2WA 3JQ6A 4BXOB 4L3VA 5FOUA 3RSSA 4CMHA 4V03A 1BXRB 4Z1OA 4Q9DA 1VRWA 5ALRA 1W5TA 1JFLA 1YS2X 1WXGA 2PX4A 4PZYA 1L5FA 1SXJA 4ZVQA 5IAKA 1NXVA 2GWRA 3TQRA 1DC4A 3A10A 1YIOA 1LH0A 4JNKA 1Q0TA 4OX9B 4HATA 4ZI7A 2JLUA 1M2WA 4BNNA 4D3XA 1GNSA 3D54D 3GLSA 3T12A 2JJ2A 2ZIEA 2QM0A 3AEKB 1XV5A 1RADA 1OXTA 4KXQA 3R41A 1XC7A 3LNCA 4ONEA 2RIRA 4CLRB 1NJFA 2JRLA 2CHFA 4JBIA 3PUWA 1RRCA 4RTSA 4CM8B 2GM3A 1GL7A 2ZQZA 1FYEA 3K1ZA 1JXQA 3LMKA 4P0PB 5CMLA 4YXWA 1RAFA 1GDHA 3K09C 4MPPA 2RGXA 3UC5A 1OAOC 3ZWDA 2GHIA 2VNSA 4CT0A 1N4DA 1DWOA 1T6NA 2CHQA 3HXKA 3JQ7A 1LSSA 3P9PA 3U3RA 2DB3A 5DWDA 3VDQA 1D6SA 1HO3A 1WZUA 2FW1A 4UDYX 1O9BA 3I9JA 5HE8A 3A9TA 3W5HA 5KWSA 2GRJA 3AB8A 2HU2A 3PC8C 4X45A 1LQUA 4UNSA 4KDFA 4B74A 4EKGA 1YAHA 4ETIA 2OT3B 1MJFA 2J3IA 3I01M 4FE4A 1DS6A 2B36A 2RGGA 3VYWA 3WNDA 5JR3A 1R0LA 1II8A 4D3DA 4Q3AA 2WILA 3U3MA 1H2XA 3AU9A 3OEEA 2Z6AA 1FX0A 4XARA 3O2JA 3STVA 5A03A 3UUEA 1RYDA 2GO1A 2MIIA 1DC8A 3AKZA 3TM5A 2BGMA 4NONA 2A94A 4UXJA 1H8EA 1WSAA 4JQYA 1OCEA 2WF7A 5HMLA 4PHFA 3PQ6A 4D44A 1KZYC 4ZYTA 3ESQA 1QQ7A 4XASA 1UBRS 1AHIA 1KFBB 3E3NA 3C7DB 3JZMA 4LWPA 1Z8DA 4OYHA 4CW7A 5DI3B 4N0PA 5KKAA 4UCWA 1VIMA 3DAYA 3AUFA 3TNJA 3I04A 1ZW6A 1NPDA 3QUTA 1W8IA 4HDKB 4J1SA 3L8YA 5CT5A 4JUBA 1E3EA 1DPFA 3FB4A 4DQVA 1CETA 1E2GA 1D9ZA 3IKLA 2EF1A 1EJBA 1R9JA 5CT4A 5H9VA 1SCUB 1U0JA 3FM9A 2CHEA 4GIBA 4XRRA 3NTXA 2BDUA 5EWLB 2MT9A 1AQ6A 1J8QA 1ST3A 4IGAA 4OYLA 2MWMA 4P53A 4QDJA 2PKEA 2CMHA 1KFKB 5JAHA 2RHGB 3VZSA 5LJIA 4CCSA 4ESOA 1V9LA 4B4VA 5IN5A 1D6MA 2NM0A 3OMLA 2G09A 1QYWA 3NT5A 3PJGA 1BVUA 2NYAA 3B5JA 3DEKA 3BCUA 4QTZA 4REMA 3TZHA 5AVRA 3PYLA 2R8BA 2OMEA 1T9ZA 4AZVA 1F9EA 1V8DA 3JCZA 4YRSA 1XZMA 1SAYA 4ALIA 2O50A 2A1UA 2C31A 4LV8B 4UZSA 3O8RA 4B6EA 4K6OA 1XN1A 3AETB 3L6UA 1RRKA 1A4RA 1QHSA 1Y6QA 1EVIA 2X77A 1PYOA 4IMRA 1EP9A 4LPKA 4Q00A 4BNGA 2WWRA 2CUKA 1RXSA 1PJ2A 1L5WA 3G6KA 4YJDA 3TL2A 3RYCB 4OK6A 5B1DA 1JR3D 2KS6A 4PFKA 3R8CA 4J3NA 3FR7A 1QH9A 2BFBA 3GRRA 4A8HA 3BWEA 5JDIA 5IJ0A 2Z04A 4IDNA 1QRRA 3MGAA 4EYQA 4I9NA 1NZDA 4YJGB 3T52A 4JLJA 1U1DA 5CGQB 4QHYA 1JEJA 4N76A 1NJ5A 2MINB 4UPDA 2JAUA 2VF5X 1R50A 2K87A 4IOKA 1GGFA 3DVAA 4DLNA 2G71A 3L93A 5M7EA 1B0UA 3NWBA 4CR7A 1HYHA 4FPXA 5E2IA 5H7XA 4ZJUA 3WOVA 1DQZA 2Q07A 5T64A 3HJUA 1C1HA 4LYDA 3FNRA 4PC7A 2XUIA 3T7AA 3TYXA 1E3JA 5JADA 4MTCA 4KQIA 2WAMA 4C4TA 2XB8A 5K6AC 4CTMA 1E9BA 4ZOEA 4DB4A 1YMUA 5BV2P 3V97A 5I7HA 2H0AA 4PGFA 4ZJZA 3NHYA 1SUSA 1AG9A 2QDKA 4C43A 1UAAA 2JKVA 4ENRA 1QPGA 3T5MA 5U4XA 1YFZA 2I7TA 1M7BA 3KXKA 4I55A 4QSHA 1SXPA 2BY4A 4G86A 1GFSA 3GFVA 4FT2A 3EIQA 3T7SA 3RVJA 1JFFA 3EXEB 4PNPA 3PGMA 3GRFA 3AHHA 3SJCA 4LA4A 1AZWA 4JYBA 1IRXA 2GGSA 1VKZA 2CMGA 4PC6A 1BXKA 2G04A 5FPPA 3QNUA 4ML3A 1ESZA 3E0QA 3LDFA 2EIHA 3PIIA 2UZ1A 2ODWA 1TL7C 2XNKA 4M9UA 3PQFA 1MQAA 1ISPA 4RJKA 3NHUA 3HJFA 1O96B 3QXHA 1I2ZA 4AZ0A 3GLIB 1K08A 3GA0A 4R1UA 1CKEA 3MK31 3O0TA 3ETHA 1KQFA 3H2JA 2IU4A 1YS7A 2F9MA 2J3QA 3NRJA 5ALXA 3ONVA 2FF7A 4DCCA 5GV7A 1CDOA 1GKKA 2BTQA 3PGJA 8GPBA 1NONA 3KDSE 4PZ9A 3GUCA 3FYUA 5BRJA 1E6LA 4BVAA 4GI2A 5AVTA 3GUVA 1RWBA 2YCBA 3SIPA 4S1OA 4EPXA 3A2KA 2OFPA 5IH3A 1DDOA 4LWQA 1XSEA 1Q3HA 1Q84A 2J5RA 4HNUA 3KJHA 5WRFA 1XVIA 1FE8A 1NUHA 3IEIA 3BFJA 4L4XA 2YRWA 3MLAA 4HN2A 1S2OA 4JAVC 5IKPA 4IDPA 1N6LA 3KFXA 4DV1B 3JQ9C 4TSRA 3W2FA 2OO5C 4G1FA 1E3WB 1UKVY 4GMFA 4KNWA 1ODSA 4MS3B 2QQGA 2FOXA 1CP3A 4FXOA 1DPGA 3EVEA 3PB3A 4HD8A 4V0MA 3TZEA 4C4YA 3CBQA 1GPYA 3VDRA 3DCYA 4K9MA 2SCUB 2BKVA 3S5UA 3OESA 2VA8A 3DL0A 4L5BA 4WXEA 3MCAA 4EYOA 3RFCA 4X64B 3H4MA 1BE1A 3F8TA 2ACVA 4CQLA 2OHHA 3IBTA 1YZKA 1ML3A 2JCGA 1IWBB 4MA4A 4RFSB 4XM1A 3ZHQA 2V03A 3MGBA 1JAXA 4KQ1A 1P77A 2X4LA 2HUPA 3K1AA 2ZM5A 5KC8A 2OBFA 2HF2A 3A4VA 2XSZD 2G7MC 4HSEA 2OHJA 4BVBA 1HSOA 1U8ZA 1W0KD 3DC2A 4M6WA 1FYVA 3RSHA 2JCYA 1WV0A 3P32A 3RLIA 3U3JA 4Z4IA 4LK2A 3T3DA 3QV2A 3RIHA 1ZJ6A 3HDJA 3KTDA 1NBOA 4H1WA 3BH6A 5K3FB 2BMAA 3LL4A 4FYYA 2J9FB 4P0TA 3W79A 3WQQA 2WJWA 2FN3A 3B12A 3IDOA 1ZHFA 4KQFA 1XWIA 5E4JA 1E1CB 1W5AA 2G7ZA 4K05A 1VB3A 4ZEOA 1PNTA 4CMJA 1YHZA 3JQAD 2HJSA 2WSMA 1ZMOA 4GX0A 5ALTA 4CQNA 5HZKA 1E2IA 2A5DA 5FAKA 2O7SA 1X0VA 1UEJA 2UVPA 3UB3A 1G4UR 2HA5A 1M6YA 3P9XA 2XB2A 4LKOA 1UBKS 1U8YA 1ZIOA 3BOSA 1PJZA 3DAGA 4DOMA 3R3XA 1J97A 2CLLB 1J00A 3GJ4A 4QARA 1XYGA 3LSTA 1G6Q1 1Z6QA 3OMXA 5REQB 1Z6XA 4OHWA 1YA8A 2N3ZA 1KYTA 4QBFA 2I2CA 3O9VA 4YYEA 1P4JA 1RQNA 1XI2A 2ZAMA 4EGSA 1IUOA 4ND3A 5JDIC 1LJ8A 3TGPA 2QYHA 5HEKA 1DAKA 3A1UA 1E9FA 4ZICA 4L57A 1ONPA 2D4HA 3AB7A 2QG4A 3LM8A 2W0SA 4PLVA 4X1YB 2H2GA 1Q1ZA 1WZEA 4FFOA 4KYTA 4MRPA 5E0OA 5DM0A 2C78A 1AQUA 2XOKD 5BWOA 1T8PA 3ZV5A 1YRAA 3DUWA 2I7CA 1G1AA 1YI1A 1SCJA 2CFTA 1E6WA 2AFHA 2WUGA 3FCSB 1GTZA 1L1EA 4G0YA 3ZLTA 3TD6A 4DLTA 2FEMA 1EFDN 1SPBS 4M53A 2ZWIA 1QLWA 4BKUA 4UQLA 2ZRLA 2IHNA 3KQTA 2VTDA 1H3FA 4Y2YA 3QY0A 1EINA 3N2IA 3NM6B 1SKUA 2R6R1 3UAZA 1H6CA 1SXIA 4EKNB 3DD1A 3O4VA 3FFXA 4TYQA 5G0VA 4DSAA 1ZGZA 4C6SA 1EEXB 1YTLA 5H1YA 3DE7X 1FW6A 3NOOA 1D0IA 1NW3A 1VC2A 1ZMXA 4F71A 3OOEA 3KV1A 3AKYA 3A6LA 1WB5A 1Z38A 2GYYA 4A16A 4YAWA 1ECPA 1FLDA 4QOJA 4Y8VA 1NVKA 1TQ8A 3KBBA 5FEUA 1RKUA 2WU3A 2PS0A 1E2JA 4LHEA 2DWOA 3ZV3A 5DXAA 3ESDA 4J75A